Diaphorina citri psyllid: psy14100


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MKLVLLWTLLIFYQMEHPVYKASGTCEKTIQDVVERFWDIIEEININKVLLFLRDNVVGTVVVVSAALWIPASCLISYIDRARLRAAYNEHRKRNAHLEPMFNPEALRPRRIIKTRVTRQMPVSMSSHQQMMGQMQG
cEEEEEHHHHHHHcccccccccccCEEEccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHHHHHHHHHcccccccccccccccccEEEECccccccccccHHHHHccccc
*KLVLLWTLLIFYQMEHPVYKASGTCEKTIQDVVERFWDIIEEININKVLLFLRDNVVGTVVVVSAALWIPASCLISYIDRARLRAAYNE***********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVLLWTLLIFYQMEHPVYKASGTCEKTIQDVVERFWDIIEEININKVLLFLRDNVVGTVVVVSAALWIPASCLISYIDRARLRAAYNEHRKRNAHLEPMFNPEALRPRRIIKTRVTRQMPVSMSSHQQMMGQMQG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Disintegrin and metalloproteinase domain-containing protein 17 Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form. Responsible for the proteolytical release of soluble JAM3 from endothelial cells surface (By similarity). Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1 and the amyloid precursor protein. Also involved in the activation of Notch pathway.confidentQ9Z0F8
Disintegrin and metalloproteinase domain-containing protein 17 Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form. Responsible for the proteolytical release of soluble JAM3 from endothelial cells surface. Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1 and the amyloid precursor protein. Also involved in the activation of Notch pathway.confidentP78536
Disintegrin and metalloproteinase domain-containing protein 17 Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form. Responsible for the proteolytical release of soluble JAM3 from endothelial cells surface (By similarity). Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1 and the amyloid precursor protein. Also involved in the activation of Notch pathway.confidentQ9Z1K9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KNC, chain B
Confidence level:probable
Coverage over the Query: 79-91
View the alignment between query and template
View the model in PyMOL