Diaphorina citri psyllid: psy14105


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MDFSVGKWYKNVSQEIAIGISAESGIPTFRGDGGWWRNNHVAHIANIESFKENPGRVWAFYNYRRQQAASKAPNKAHYALARFEEECIRQNKSFVLFTQNVDGYHQAAGSRNVIELHGSLWRTKCSWCDKVEENRKIPIVPVLDEAICNPNASDVWYSDEEINVNDLPRCSDKACGGLLRPDIVWFGEQLNPQYVKMA
ccHHHHHHcccEEEEEccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEccccccHHHHccccccEEccccccccEEcccccccccccccccccccHcccccccccccccccccccccccccccccccccccccEECccccccHHHHHHc
***SVGKWYKNVSQEIAIGISAESGIPTFRGDGGWWRNNHVAHIANIESFKENPGRVWAFYNYRRQQAASKAPNKAHYALARFEEECIRQNKSFVLFTQNVDGYHQAAGSRNVIELHGSLWRTKCSWCDKVEENRKIPIVPVLDEAICNPNASDVWYSDEEINVNDLPRCSDKACGGLLRPDIVWFGEQLNP**VKMA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFSVGKWYKNVSQEIAIGISAESGIPTFRGDGGWWRNNHVAHIANIESFKENPGRVWAFYNYRRQQAASKAPNKAHYALARFEEECIRQNKSFVLFTQNVDGYHQAAGSRNVIELHGSLWRTKCSWCDKVEENRKIPIVPVLDEAICNPNASDVWYSDEEINVNDLPRCSDKACGGLLRPDIVWFGEQLNPQYVKMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent protein deacylase NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form. May also have NAD-dependent lysine demalonylase and desuccinylase activity.confidentQ8D9J9
NAD-dependent protein deacylase NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form. May also have NAD-dependent lysine demalonylase and desuccinylase activity.confidentQ5SIH7
NAD-dependent protein deacylase NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form. May also have NAD-dependent lysine demalonylase and desuccinylase activity.confidentQ87PH8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016787 [MF]hydrolase activityprobableGO:0003824, GO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M2K, chain A
Confidence level:very confident
Coverage over the Query: 5-136,161-198
View the alignment between query and template
View the model in PyMOL
Template: 3RIY, chain A
Confidence level:very confident
Coverage over the Query: 5-198
View the alignment between query and template
View the model in PyMOL