Diaphorina citri psyllid: psy1410

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------

MASSIELAQFLLIRAVELDERGRWTESLTFYQDGVTELLKHVRGLSNKGDQQKIRDKIETYINRAEVLKGKLDEKKKMGNYHEQIEIANNEKGVTYEKLFGRFLDENVEQIDVTDPYIHNKHQCYNFLQFCELAIKNCKNVKRINLLTTYADRPQHSNKTARVKQEENLKQLQESLRKMKITLNINYSNTLHDREIVLSNDWVIKIGRGLDIFCHVPEFSIGFTDLSLRPCKETVVNIFHRASLIK

ccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccccHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEcccEEEEEcccccccccccccccccccccccccccEEEEEEEcccccc

*****ELAQFLLIRAVELDERGRWTESLTFYQDGVTELLKHVRGLSN*****KIRDKIETYINRAEVLKGKLD****MGNYHEQIEIANNEKGVTYEKLFGRFLDENVEQIDVTDPYIHNKHQCYNFLQFCELAIKNCKNVKRINLLTTYADR**************NLKQLQESLRKMKITLNINYSNTLHDREIVLSNDWVIKIGRGLDIFCHVPEFSIGFTDLSLRPCKETVVNIFHRAS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSIELAQFLLIRAVELDERGRWTESLTFYQDGVTELLKHVRGLSNKGDQQKIRDKxxxxxxxxxxxxxxxxxxxxxGNYHEQIEIANNEKGVTYEKLFGRFLDENVEQIDVTDPYIHNKHQCYNFLQFCELAIKNCKNVKRINLLTTYADRPQHSNKTAxxxxxxxxxxxxxxxxxxxxxLNINYSNTLHDREIVLSNDWVIKIGRGLDIFCHVPEFSIGFTDLSLRPCKETVVNIFHRASLIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
MIT domain-containing protein 1	May play a role in endosomal protein transport.	confident	Q5I0J5
MIT domain-containing protein 1	May play a role in endosomal protein transport.	confident	Q8VDV8
MIT domain-containing protein 1	May play a role in endosomal protein transport.	confident	Q8WV92

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0019898 [CC]	extrinsic to membrane	probable	GO:0005575, GO:0044425, GO:0016020
GO:0000281 [BP]	cytokinesis after mitosis	probable	GO:0000910, GO:0006996, GO:0007049, GO:0000278, GO:0044699, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0051301
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:2000695 []	cytokinetic cell separation involved in cell cycle cytokinesis	probable
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMB, chain A
Confidence level:very confident
Coverage over the Query: 82-241
View the alignment between query and template
View the model in PyMOL