Query         psy14119
Match_columns 90
No_of_seqs    71 out of 73
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 20:01:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14119.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14119hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10853 DUF2650:  Protein of u  96.2  0.0051 1.1E-07   36.3   2.7   28    2-29     11-38  (38)
  2 PF01788 PsbJ:  PsbJ;  InterPro  68.8     8.6 0.00019   23.1   3.1   19   14-32     13-31  (40)
  3 PF05082 Rop-like:  Rop-like;    60.4      10 0.00023   24.6   2.6   26   36-64     27-52  (66)
  4 PF11084 DUF2621:  Protein of u  55.7      24 0.00052   26.2   4.1   33   10-44      5-39  (141)
  5 PF08285 DPM3:  Dolichol-phosph  52.5      29 0.00063   23.4   3.9   53   10-65     35-87  (91)
  6 PF06480 FtsH_ext:  FtsH Extrac  48.8     7.5 0.00016   24.0   0.5   19   16-34      2-20  (110)
  7 PF05486 SRP9-21:  Signal recog  48.3      16 0.00035   23.8   2.1   25   48-72      2-26  (79)
  8 PF07503 zf-HYPF:  HypF finger;  46.2       7 0.00015   22.3   0.1   10    1-10     24-33  (35)
  9 CHL00108 psbJ photosystem II p  45.9     3.5 7.6E-05   24.8  -1.2   15   18-32     17-31  (40)
 10 PRK02565 photosystem II reacti  43.3     5.3 0.00011   23.9  -0.7   16   17-32     15-30  (39)
 11 PF11638 DnaA_N:  DnaA N-termin  38.6      24 0.00051   20.9   1.6   23   51-73      4-26  (65)
 12 KOG3707|consensus               35.9      22 0.00048   32.6   1.6   40   19-61    410-449 (844)
 13 PF14354 Lar_restr_allev:  Rest  35.6      17 0.00036   21.5   0.6    6    1-6       6-11  (61)
 14 COG5420 Uncharacterized conser  33.2      37  0.0008   22.5   2.0   27   35-64     30-56  (71)
 15 PF08163 NUC194:  NUC194 domain  33.2      22 0.00047   29.5   1.1   18   56-73    122-139 (394)
 16 KOG1513|consensus               31.5      24 0.00052   33.5   1.1   28   10-37   1237-1266(1300)
 17 PF05545 FixQ:  Cbb3-type cytoc  30.5      82  0.0018   18.3   3.0   20   15-34     11-31  (49)
 18 PF02419 PsbL:  PsbL protein;    30.5      58  0.0013   19.3   2.3   16   17-32     18-33  (37)
 19 PF10958 DUF2759:  Protein of u  29.6      54  0.0012   20.6   2.2   26   13-38      6-35  (52)
 20 COG0109 CyoE Polyprenyltransfe  28.1      81  0.0018   25.8   3.5   24    9-32    102-136 (304)
 21 PF08756 YfkB:  YfkB-like domai  26.6      58  0.0013   24.5   2.3   38   37-79      6-43  (153)
 22 PF05814 DUF843:  Baculovirus p  26.5 1.6E+02  0.0034   20.1   4.2   48   13-64     28-75  (83)
 23 PF08362 TetR_C_3:  YcdC-like p  26.5      57  0.0012   23.3   2.2   42   11-55     91-132 (143)
 24 CHL00038 psbL photosystem II p  25.5      77  0.0017   18.8   2.2   16   17-32     19-34  (38)
 25 PRK00753 psbL photosystem II r  24.8      79  0.0017   18.9   2.2   16   17-32     20-35  (39)
 26 PF07589 VPEP:  PEP-CTERM motif  24.2 1.1E+02  0.0023   16.1   2.4   15   16-30      6-20  (25)
 27 COG4476 Uncharacterized protei  24.0      48   0.001   22.9   1.3   26   40-65      8-33  (90)
 28 KOG3465|consensus               23.6      63  0.0014   22.2   1.8   24   48-71      4-27  (86)
 29 PF03969 AFG1_ATPase:  AFG1-lik  22.5      81  0.0018   25.6   2.6   32   34-65    287-319 (362)
 30 PF00113 Enolase_C:  Enolase, C  21.5      59  0.0013   26.0   1.6   24   35-59    151-174 (295)
 31 PF09779 Ima1_N:  Ima1 N-termin  21.2      73  0.0016   22.3   1.8   36   32-69     87-127 (131)
 32 PF14276 DUF4363:  Domain of un  20.3      69  0.0015   21.3   1.5   23   20-42      6-29  (121)

No 1  
>PF10853 DUF2650:  Protein of unknown function (DUF2650);  InterPro: IPR022559  This region is found in proteins with unknown function in metazoa. 
Probab=96.23  E-value=0.0051  Score=36.32  Aligned_cols=28  Identities=32%  Similarity=0.652  Sum_probs=26.2

Q ss_pred             cccCccchhHHHHHHHHHHHHHHHHHHH
Q psy14119          2 KICGPKLSLCGLVISAWGIVQLVLMGFF   29 (90)
Q Consensus         2 ~~CGPKcS~CclvLSvWGiImL~lLGiF   29 (90)
                      +.||.+-+-||.-|-.|.+++|+++|++
T Consensus        11 ~CCg~~~~eCCf~lq~Wv~v~l~v~~v~   38 (38)
T PF10853_consen   11 KCCGDLNKECCFRLQIWVIVLLAVLGVC   38 (38)
T ss_pred             ECCCCChHhHHHHHHHHHHHHHHHHhcC
Confidence            5799999999999999999999999974


No 2  
>PF01788 PsbJ:  PsbJ;  InterPro: IPR002682 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbJ found in PSII. PsbJ is one of the most hydrophobic proteins in the thylakoid membrane, and is located in a gene cluster with PsbE, PsbF and PsbL (PsbEFJL). Both PsbJ and PsbL (IPR003372 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbJ cause the light-harvesting antenna to remain detached from the PSII dimers []. In addition, both PsbJ and PsbL are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_J 3ARC_J 3A0B_J 3KZI_J 2AXT_J 3PRQ_J 4FBY_b 3BZ2_J 1S5L_j 3PRR_J ....
Probab=68.76  E-value=8.6  Score=23.10  Aligned_cols=19  Identities=32%  Similarity=0.469  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q psy14119         14 VISAWGIVQLVLMGFFYSV   32 (90)
Q Consensus        14 vLSvWGiImL~lLGiFF~v   32 (90)
                      |--+=|+.-+.++|+|||=
T Consensus        13 Vgtv~G~~vi~lvglFfYG   31 (40)
T PF01788_consen   13 VGTVAGIAVIGLVGLFFYG   31 (40)
T ss_dssp             HHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHheec
Confidence            4445688899999999984


No 3  
>PF05082 Rop-like:  Rop-like;  InterPro: IPR007774 This family contains several uncharacterised bacterial proteins. These proteins are found in nitrogen fixation operons, so are likely to play a role in this process.; PDB: 3CSX_A 2JS5_B.
Probab=60.35  E-value=10  Score=24.65  Aligned_cols=26  Identities=31%  Similarity=0.441  Sum_probs=17.2

Q ss_pred             ecccCCCCCccccccHHHHHHHHHHHhhh
Q psy14119         36 ALAEDLPGAEHHYASAKEFYAAADKGYTL   64 (90)
Q Consensus        36 aLiEDLP~~ee~~~s~~~f~~~~~~~Y~q   64 (90)
                      -|.||||.   +|.++-+--++.+++|.+
T Consensus        27 DLaEdLP~---~w~~i~~vA~~ty~a~~~   52 (66)
T PF05082_consen   27 DLAEDLPT---NWEEIPEVAQKTYDAYAE   52 (66)
T ss_dssp             HHHHCTTT---TGGGHHHHHHHHHHHHHH
T ss_pred             HHHHccch---hHHHHHHHHHHHHHHHHH
Confidence            37899997   666655555666666654


No 4  
>PF11084 DUF2621:  Protein of unknown function (DUF2621);  InterPro: IPR020203 This entry represents a group of uncharacterised proteins.
Probab=55.73  E-value=24  Score=26.16  Aligned_cols=33  Identities=27%  Similarity=0.407  Sum_probs=24.5

Q ss_pred             hHHHHHHHHHHHHHHHHH--HHHhhcceecccCCCCC
Q psy14119         10 LCGLVISAWGIVQLVLMG--FFYSVRSVALAEDLPGA   44 (90)
Q Consensus        10 ~CclvLSvWGiImL~lLG--iFF~v~SvaLiEDLP~~   44 (90)
                      .+-.++-.|+++|+++|+  +||-.+  -++--+|.+
T Consensus         5 wFm~fI~~W~~vli~l~~IGGfFMFR--KFLK~lPKe   39 (141)
T PF11084_consen    5 WFMWFILFWVVVLIGLMAIGGFFMFR--KFLKRLPKE   39 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHHH--HHHHhCCcc
Confidence            455688899999999884  566655  467788863


No 5  
>PF08285 DPM3:  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3);  InterPro: IPR013174 This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex [].
Probab=52.50  E-value=29  Score=23.39  Aligned_cols=53  Identities=13%  Similarity=0.021  Sum_probs=40.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhcceecccCCCCCccccccHHHHHHHHHHHhhhh
Q psy14119         10 LCGLVISAWGIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFYAAADKGYTLC   65 (90)
Q Consensus        10 ~CclvLSvWGiImL~lLGiFF~v~SvaLiEDLP~~ee~~~s~~~f~~~~~~~Y~qv   65 (90)
                      ..-..+-+|.++.++.-..+=-.-.|+-+.|-|   |.+.++++..+++.+-+++.
T Consensus        35 ~ii~~lP~~~Lv~fG~Ysl~~lgy~v~tFnDcp---eA~~eL~~eI~eAK~dLr~k   87 (91)
T PF08285_consen   35 EIIPYLPFYALVSFGCYSLFTLGYGVATFNDCP---EAAKELQKEIKEAKADLRKK   87 (91)
T ss_pred             HHHHHhhHHHHHHHHHHHHHHHHHhhhccCCCH---HHHHHHHHHHHHHHHHHHHc
Confidence            345677788888888888888888899999988   35666767777777777654


No 6  
>PF06480 FtsH_ext:  FtsH Extracellular;  InterPro: IPR011546 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in the FtsH family of proteins that include FtsH a membrane-bound ATP-dependent protease universally conserved in prokaryotes []. The FtsH peptidases, which belong to MEROPS peptidase family M41 (clan MA(E)), efficiently degrade proteins that have a low thermodynamic stability - e.g. they lack robust unfoldase activity. This feature may be key and implies that this could be a criterion for degrading a protein. In Oenococcus oeni (Leuconostoc oenos) FtsH is involved in protection against environmental stress [], and shows increased expression under heat or osmotic stress. These two lines of evidence suggest that it is a fundamental prokaryotic self-protection mechanism that checks if proteins are correctly folded. The precise function of this N-terminal region is unclear. ; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0016021 integral to membrane; PDB: 2LNA_A.
Probab=48.79  E-value=7.5  Score=23.98  Aligned_cols=19  Identities=16%  Similarity=0.144  Sum_probs=0.5

Q ss_pred             HHHHHHHHHHHHHHHhhcc
Q psy14119         16 SAWGIVQLVLMGFFYSVRS   34 (90)
Q Consensus        16 SvWGiImL~lLGiFF~v~S   34 (90)
                      -+|-+|.+++++++++...
T Consensus         2 ~~~ili~~vi~~l~~~~~~   20 (110)
T PF06480_consen    2 ILYILIILVILLLFNFFFF   20 (110)
T ss_dssp             -----------------S-
T ss_pred             cceehhHHHHHHHHHHHHh
Confidence            3688899999999888654


No 7  
>PF05486 SRP9-21:  Signal recognition particle 9 kDa protein (SRP9);  InterPro: IPR008832  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the 9 kDa SRP9 component. Both SRP9 and SRP14 have the same (beta)-alpha-beta(3)-alpha fold. The heterodimer has pseudo two-fold symmetry and is saddle-like, consisting of a curved six-stranded beta-sheet that has four helices packed on the convex side and an exposed concave surface lined with positively charged residues. The SRP9/SRP14 heterodimer is essential for SRP RNA binding, mediating the pausing of synthesis of ribosome associated nascent polypeptides that have been engaged by the targeting domain of SRP [].; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0045900 negative regulation of translational elongation, 0048500 signal recognition particle; PDB: 1E8O_A 1RY1_C.
Probab=48.32  E-value=16  Score=23.85  Aligned_cols=25  Identities=28%  Similarity=0.263  Sum_probs=19.7

Q ss_pred             cccHHHHHHHHHHHhhhhhhccccc
Q psy14119         48 YASAKEFYAAADKGYTLCKSSKRGA   72 (90)
Q Consensus        48 ~~s~~~f~~~~~~~Y~qvAyN~~~a   72 (90)
                      +.++|+|.++..+.|+++--++++.
T Consensus         2 ~~~~deF~~~s~~L~~a~P~~TR~~   26 (79)
T PF05486_consen    2 VKSWDEFIEQSEKLYEANPSTTRYS   26 (79)
T ss_dssp             ESHHHHHHHHHHHHHHH-TTT-EEE
T ss_pred             CCCHHHHHHHHHHHHHhCCCceEEE
Confidence            3578999999999999998888763


No 8  
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=46.16  E-value=7  Score=22.29  Aligned_cols=10  Identities=40%  Similarity=0.992  Sum_probs=7.1

Q ss_pred             CcccCccchh
Q psy14119          1 MKICGPKLSL   10 (90)
Q Consensus         1 ~~~CGPKcS~   10 (90)
                      |.-|||+.++
T Consensus        24 C~~CGPr~~i   33 (35)
T PF07503_consen   24 CTNCGPRYSI   33 (35)
T ss_dssp             BTTCC-SCCC
T ss_pred             CCCCCCCEEE
Confidence            5679999875


No 9  
>CHL00108 psbJ photosystem II protein J
Probab=45.89  E-value=3.5  Score=24.78  Aligned_cols=15  Identities=33%  Similarity=0.587  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHhh
Q psy14119         18 WGIVQLVLMGFFYSV   32 (90)
Q Consensus        18 WGiImL~lLGiFF~v   32 (90)
                      =|+.-+.++|+|||=
T Consensus        17 ~G~~vi~~vgiFfyG   31 (40)
T CHL00108         17 AGIAVIGLLGIFFYG   31 (40)
T ss_pred             hhHhHHheeeeEEee
Confidence            367778999999984


No 10 
>PRK02565 photosystem II reaction center protein J; Provisional
Probab=43.30  E-value=5.3  Score=23.91  Aligned_cols=16  Identities=19%  Similarity=0.472  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy14119         17 AWGIVQLVLMGFFYSV   32 (90)
Q Consensus        17 vWGiImL~lLGiFF~v   32 (90)
                      +=|+--+.++|+|||=
T Consensus        15 v~G~~vi~~vgiFfyG   30 (39)
T PRK02565         15 VAGMGVIFVVGLFFYG   30 (39)
T ss_pred             hhHHHHHhheeeEEee
Confidence            3467778999999984


No 11 
>PF11638 DnaA_N:  DnaA N-terminal domain;  InterPro: IPR024633 The bacterial DnaA protein [, , ] plays an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) []. This entry represents the N-terminal domain of DnaA. This domain is monomeric in solution and has a hydrophobic cleft flanked by several negative residues on one side and positive residues on the other [].; GO: 0005524 ATP binding; PDB: 2JMP_A 2E0G_A.
Probab=38.58  E-value=24  Score=20.92  Aligned_cols=23  Identities=4%  Similarity=-0.192  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHhhhhhhcccccc
Q psy14119         51 AKEFYAAADKGYTLCKSSKRGAR   73 (90)
Q Consensus        51 ~~~f~~~~~~~Y~qvAyN~~~a~   73 (90)
                      +++..+++.+.|...+|+.|++.
T Consensus         4 W~~vl~~lk~~l~~~~f~tW~~~   26 (65)
T PF11638_consen    4 WEKVLERLKKELSEQSFNTWFKP   26 (65)
T ss_dssp             HHHHHHHHHHHTSS-HHHHTTTT
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHh
Confidence            56778889999999999999973


No 12 
>KOG3707|consensus
Probab=35.95  E-value=22  Score=32.55  Aligned_cols=40  Identities=13%  Similarity=0.054  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHHHhhcceecccCCCCCccccccHHHHHHHHHHH
Q psy14119         19 GIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFYAAADKG   61 (90)
Q Consensus        19 GiImL~lLGiFF~v~SvaLiEDLP~~ee~~~s~~~f~~~~~~~   61 (90)
                      |.+||+=+---..-|+|+|+||..+-+|   |++.|..++++.
T Consensus       410 aflmmgnLs~~lkshAVTlfevgkL~De---sldsfl~qle~v  449 (844)
T KOG3707|consen  410 AFLMMGNLSPTLKSHAVTLFEVGKLPDE---SLDSFLSQLEEV  449 (844)
T ss_pred             HHHHhccCCcccccceeeeeeecccchh---hHHHHHHHHHHh
Confidence            5566655545566799999999998554   555666666555


No 13 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=35.62  E-value=17  Score=21.54  Aligned_cols=6  Identities=33%  Similarity=0.999  Sum_probs=3.0

Q ss_pred             CcccCc
Q psy14119          1 MKICGP    6 (90)
Q Consensus         1 ~~~CGP    6 (90)
                      |||||.
T Consensus         6 CPFCG~   11 (61)
T PF14354_consen    6 CPFCGS   11 (61)
T ss_pred             CCCCCC
Confidence            455553


No 14 
>COG5420 Uncharacterized conserved small protein containing a coiled-coil domain [Function unknown]
Probab=33.24  E-value=37  Score=22.54  Aligned_cols=27  Identities=22%  Similarity=0.252  Sum_probs=14.6

Q ss_pred             eecccCCCCCccccccHHHHHHHHHHHhhh
Q psy14119         35 VALAEDLPGAEHHYASAKEFYAAADKGYTL   64 (90)
Q Consensus        35 vaLiEDLP~~ee~~~s~~~f~~~~~~~Y~q   64 (90)
                      -.|.||||.   +|....+--.+..++|.+
T Consensus        30 hDLAEgLP~---~wtei~~VA~kt~~~yae   56 (71)
T COG5420          30 HDLAEGLPV---KWTEIMAVAEKTFEAYAE   56 (71)
T ss_pred             HHHhccCCc---cHHHHHHHHHHHHHHHHH
Confidence            357899996   343333333444444443


No 15 
>PF08163 NUC194:  NUC194 domain;  InterPro: IPR012582 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This is domain B in the catalytic subunit of DNA-dependent protein kinases.; GO: 0003677 DNA binding, 0004677 DNA-dependent protein kinase activity, 0005524 ATP binding, 0006303 double-strand break repair via nonhomologous end joining, 0005634 nucleus
Probab=33.22  E-value=22  Score=29.50  Aligned_cols=18  Identities=11%  Similarity=-0.090  Sum_probs=15.3

Q ss_pred             HHHHHHhhhhhhcccccc
Q psy14119         56 AAADKGYTLCKSSKRGAR   73 (90)
Q Consensus        56 ~~~~~~Y~qvAyN~~~a~   73 (90)
                      .+.-+.|++.||||.+|.
T Consensus       122 ~e~~r~y~cAAYncl~av  139 (394)
T PF08163_consen  122 LELRRQYHCAAYNCLIAV  139 (394)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566699999999998874


No 16 
>KOG1513|consensus
Probab=31.45  E-value=24  Score=33.50  Aligned_cols=28  Identities=36%  Similarity=0.555  Sum_probs=21.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHH--Hhhcceec
Q psy14119         10 LCGLVISAWGIVQLVLMGFF--YSVRSVAL   37 (90)
Q Consensus        10 ~CclvLSvWGiImL~lLGiF--F~v~SvaL   37 (90)
                      +|+.+|||||.|=.+|-+.-  -++|-+-+
T Consensus      1237 LsGsvLsVW~rVE~Vla~~s~sskmQIIRl 1266 (1300)
T KOG1513|consen 1237 LSGSVLSVWGRVEAVLADSSSSSKMQIIRL 1266 (1300)
T ss_pred             eccchhhhhHHHHHHHhcCCCcceEEEEEE
Confidence            68999999999999887765  44444433


No 17 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=30.48  E-value=82  Score=18.27  Aligned_cols=20  Identities=15%  Similarity=0.133  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHH-HHHHHhhcc
Q psy14119         15 ISAWGIVQLVL-MGFFYSVRS   34 (90)
Q Consensus        15 LSvWGiImL~l-LGiFF~v~S   34 (90)
                      =|+|.++++++ .|+.+++=+
T Consensus        11 ~~~~~v~~~~~F~gi~~w~~~   31 (49)
T PF05545_consen   11 RSIGTVLFFVFFIGIVIWAYR   31 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHHc
Confidence            34455554444 377777654


No 18 
>PF02419 PsbL:  PsbL protein;  InterPro: IPR003372 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbL found in PSII. PsbL is located in a gene cluster with PsbE, PsbF and PsbJ (PsbEFJL). Both PsbL and PsbJ (IPR002682 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbL prevent the formation of both PSII core dimers and PSII-light harvesting complex []. In addition, both PsbL and PsbJ are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_L 3A0B_l 3ARC_l 1S5L_l 2AXT_l 3BZ2_L 4FBY_L 3PRQ_L 3PRR_L 3KZI_L ....
Probab=30.47  E-value=58  Score=19.26  Aligned_cols=16  Identities=19%  Similarity=0.791  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy14119         17 AWGIVQLVLMGFFYSV   32 (90)
Q Consensus        17 vWGiImL~lLGiFF~v   32 (90)
                      -||.+...++|++|..
T Consensus        18 Y~GLllifvl~vLFss   33 (37)
T PF02419_consen   18 YWGLLLIFVLAVLFSS   33 (37)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhh
Confidence            4999999999999864


No 19 
>PF10958 DUF2759:  Protein of unknown function (DUF2759);  InterPro: IPR024490 This family of proteins with unknown function appear to be restricted to Bacillales.
Probab=29.63  E-value=54  Score=20.60  Aligned_cols=26  Identities=19%  Similarity=0.553  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHH----HHHHHHhhcceecc
Q psy14119         13 LVISAWGIVQLV----LMGFFYSVRSVALA   38 (90)
Q Consensus        13 lvLSvWGiImL~----lLGiFF~v~SvaLi   38 (90)
                      .++++||++.-.    ++|+.|..-|++.+
T Consensus         6 tlla~~g~~rslK~KN~l~i~F~~~t~~VF   35 (52)
T PF10958_consen    6 TLLAAFGVLRSLKNKNFLGIGFALVTVAVF   35 (52)
T ss_pred             HHHHHHHHHHHHHHhhHHHHHHHHHHHHHH
Confidence            578999999864    78888877776653


No 20 
>COG0109 CyoE Polyprenyltransferase (cytochrome oxidase assembly factor) [Posttranslational modification, protein turnover, chaperones]
Probab=28.07  E-value=81  Score=25.77  Aligned_cols=24  Identities=38%  Similarity=0.585  Sum_probs=19.4

Q ss_pred             hhHHHHHHHHHHHHH-----------HHHHHHHhh
Q psy14119          9 SLCGLVISAWGIVQL-----------VLMGFFYSV   32 (90)
Q Consensus         9 S~CclvLSvWGiImL-----------~lLGiFF~v   32 (90)
                      -.+++++++=|+++|           ++.|+|||+
T Consensus       102 l~fgl~L~~~g~~~l~~~vn~laa~l~~~gi~~Yv  136 (304)
T COG0109         102 LAFGLVLGVAGFSLLWFLVNLLAAVLGLFGIFFYV  136 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            457888888888887           678899986


No 21 
>PF08756 YfkB:  YfkB-like domain;  InterPro: IPR014866 YfkB is adjacent to YfkA in Bacillus subtilis. In other bacterial species, it is fused to this protein. As YfkA contains a Radical SAM domain it suggests this domain is interacts with them. 
Probab=26.56  E-value=58  Score=24.46  Aligned_cols=38  Identities=24%  Similarity=0.251  Sum_probs=31.8

Q ss_pred             cccCCCCCccccccHHHHHHHHHHHhhhhhhccccccCCCcee
Q psy14119         37 LAEDLPGAEHHYASAKEFYAAADKGYTLCKSSKRGARGSLPFC   79 (90)
Q Consensus        37 LiEDLP~~ee~~~s~~~f~~~~~~~Y~qvAyN~~~a~g~~~~~   79 (90)
                      +.++||.     -|++|.++.+.+.-+----|.|.--|-|||-
T Consensus         6 FAs~L~v-----LsL~e~r~aIh~LLd~Rd~~~WMLFGTLPfy   43 (153)
T PF08756_consen    6 FASNLEV-----LSLDEMREAIHRLLDIRDPNVWMLFGTLPFY   43 (153)
T ss_pred             hhhhCcc-----CCHHHHHHHHHHHHhccCCCeeEEecccccc
Confidence            4455554     5788999999999999999999999999994


No 22 
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=26.53  E-value=1.6e+02  Score=20.08  Aligned_cols=48  Identities=8%  Similarity=0.209  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcceecccCCCCCccccccHHHHHHHHHHHhhh
Q psy14119         13 LVISAWGIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFYAAADKGYTL   64 (90)
Q Consensus        13 lvLSvWGiImL~lLGiFF~v~SvaLiEDLP~~ee~~~s~~~f~~~~~~~Y~q   64 (90)
                      +.+-+=-+|+..+++++ |++-=.-..|+|-  |+-++.+.. ++.+++++.
T Consensus        28 ~~~LilfviF~~~L~~y-y~kteS~~~dL~t--~k~K~~KKK-~~ln~afDA   75 (83)
T PF05814_consen   28 ITLLILFVIFFCVLQVY-YIKTESTPQDLQT--EKAKSIKKK-RDLNDAFDA   75 (83)
T ss_pred             HHHHHHHHHHHHHHHHH-HcCCCCcHHHHhh--hhhhhHHHH-HHHHHHHHH
Confidence            33444456777778876 5566666889985  333444333 556666553


No 23 
>PF08362 TetR_C_3:  YcdC-like protein, C-terminal region;  InterPro: IPR013573 This entry represents the C-terminal domain found in the hypothetical transcriptional regulators RutR and YcdC (P75899 from SWISSPROT) from Escherichia coli. Both of these proteins are member of the TetR (tetracycline resistance) transcriptional regulator family of proteins. RutR negatively controls the transcription of the rut operon involved in pyrimidine utilization. The C-terminal domains of RutR, YsiA and TetR share a multi-helical, interlocking structure. These proteins also contain helix-turn-helix (HTH) DNA-binding domains.; GO: 0045892 negative regulation of transcription, DNA-dependent; PDB: 3LOC_B.
Probab=26.51  E-value=57  Score=23.28  Aligned_cols=42  Identities=19%  Similarity=0.245  Sum_probs=24.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcceecccCCCCCccccccHHHHH
Q psy14119         11 CGLVISAWGIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFY   55 (90)
Q Consensus        11 CclvLSvWGiImL~lLGiFF~v~SvaLiEDLP~~ee~~~s~~~f~   55 (90)
                      -=+++|||++-|-=   .=|-.|..++...-++++++|++..++.
T Consensus        91 ~hL~f~IWa~TQ~Y---ADf~~Qi~~~~g~~~~~~~d~e~a~~~v  132 (143)
T PF08362_consen   91 EHLFFMIWAMTQHY---ADFAAQIRAVLGKSELSEEDFEQAAEFV  132 (143)
T ss_dssp             HHHHHHHHHHHHHH---HHTHHHHHHHHS--TTSHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhhhh---hhHHHHHHHHhCCCCCCHHHHHHHHHHH
Confidence            45789999998842   2244555566665566666666544443


No 24 
>CHL00038 psbL photosystem II protein L
Probab=25.53  E-value=77  Score=18.83  Aligned_cols=16  Identities=19%  Similarity=0.767  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy14119         17 AWGIVQLVLMGFFYSV   32 (90)
Q Consensus        17 vWGiImL~lLGiFF~v   32 (90)
                      -||.....++|++|..
T Consensus        19 y~GLLlifvl~vlfss   34 (38)
T CHL00038         19 YWGLLLIFVLAVLFSN   34 (38)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4999999999999864


No 25 
>PRK00753 psbL photosystem II reaction center L; Provisional
Probab=24.84  E-value=79  Score=18.89  Aligned_cols=16  Identities=19%  Similarity=0.607  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy14119         17 AWGIVQLVLMGFFYSV   32 (90)
Q Consensus        17 vWGiImL~lLGiFF~v   32 (90)
                      -||.....++|++|.-
T Consensus        20 y~GlLlifvl~vLFss   35 (39)
T PRK00753         20 YLGLLLVFVLGILFSS   35 (39)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            4999999999999864


No 26 
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=24.21  E-value=1.1e+02  Score=16.08  Aligned_cols=15  Identities=27%  Similarity=0.558  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHH
Q psy14119         16 SAWGIVQLVLMGFFY   30 (90)
Q Consensus        16 SvWGiImL~lLGiFF   30 (90)
                      |.|+...++++|+.+
T Consensus         6 st~~l~~~gl~~l~~   20 (25)
T PF07589_consen    6 STLALLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            457888888888877


No 27 
>COG4476 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.05  E-value=48  Score=22.95  Aligned_cols=26  Identities=23%  Similarity=0.314  Sum_probs=17.4

Q ss_pred             CCCCCccccccHHHHHHHHHHHhhhh
Q psy14119         40 DLPGAEHHYASAKEFYAAADKGYTLC   65 (90)
Q Consensus        40 DLP~~ee~~~s~~~f~~~~~~~Y~qv   65 (90)
                      |+....|+..|.-.|.++++.+|.+-
T Consensus         8 dldWsTEE~~~Vl~Ffn~VE~aYE~g   33 (90)
T COG4476           8 DLDWSTEEMISVLHFFNAVELAYEKG   33 (90)
T ss_pred             CCCccHHHHHHHHHHHHHHHHHHHcc
Confidence            34444555666667888888888763


No 28 
>KOG3465|consensus
Probab=23.64  E-value=63  Score=22.23  Aligned_cols=24  Identities=21%  Similarity=0.279  Sum_probs=21.0

Q ss_pred             cccHHHHHHHHHHHhhhhhhcccc
Q psy14119         48 YASAKEFYAAADKGYTLCKSSKRG   71 (90)
Q Consensus        48 ~~s~~~f~~~~~~~Y~qvAyN~~~   71 (90)
                      +.+|+||.++.++.|..+--+|+.
T Consensus         4 ~qtwdEF~~ase~L~~A~P~~~Rl   27 (86)
T KOG3465|consen    4 LQTWDEFFTASESLYLANPEKTRL   27 (86)
T ss_pred             eeeHHHHHHHHHHHHhcCccceEE
Confidence            468999999999999998888875


No 29 
>PF03969 AFG1_ATPase:  AFG1-like ATPase;  InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP. AFG1 also has substantial homology to these proteins outside the ATPase domain []. This family of proteins contains a P-loop motif.; GO: 0005524 ATP binding
Probab=22.47  E-value=81  Score=25.58  Aligned_cols=32  Identities=22%  Similarity=0.272  Sum_probs=23.8

Q ss_pred             ceecccCCCC-CccccccHHHHHHHHHHHhhhh
Q psy14119         34 SVALAEDLPG-AEHHYASAKEFYAAADKGYTLC   65 (90)
Q Consensus        34 SvaLiEDLP~-~ee~~~s~~~f~~~~~~~Y~qv   65 (90)
                      +.-+++|+|. ++.+-+....|.+=+|..|++.
T Consensus       287 ~ti~I~~VP~l~~~~~n~arRFI~LID~LYd~~  319 (362)
T PF03969_consen  287 HTIFISDVPVLSESDRNEARRFITLIDVLYDRK  319 (362)
T ss_pred             CEEEEcCCCCcccCChhHHHHHHHHHHHHhhCC
Confidence            3578999996 3334445678899999999865


No 30 
>PF00113 Enolase_C:  Enolase, C-terminal TIM barrel domain;  InterPro: IPR020810 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ]. In vertebrates, there are 3 different, tissue-specific isoenzymes, designated alpha, beta and gamma. Alpha is present in most tissues, beta is localised in muscle tissue, and gamma is found only in nervous tissue. The functional enzyme exists as a dimer of any 2 isoforms. In immature organs and in adult liver, it is usually an alpha homodimer, in adult skeletal muscle, a beta homodimer, and in adult neurons, a gamma homodimer. In developing muscle, it is usually an alpha/beta heterodimer, and in the developing nervous system, an alpha/gamma heterodimer []. The tissue specific forms display minor kinetic differences. Tau-crystallin, one of the major lens proteins in some fish, reptiles and birds, has been shown [] to be evolutionary related to enolase. Neuron-specific enolase is released in a variety of neurological diseases, such as multiple sclerosis and after seizures or acute stroke. Several tumour cells have also been found positive for neuron-specific enolase. Beta-enolase deficiency is associated with glycogenosis type XIII defect.; GO: 0000287 magnesium ion binding, 0004634 phosphopyruvate hydratase activity, 0006096 glycolysis, 0000015 phosphopyruvate hydratase complex; PDB: 2FYM_D 3H8A_C 1E9I_D 3TQP_B 2PU1_A 1OEP_A 2PA6_A 1PDY_A 1PDZ_A 3UJ2_E ....
Probab=21.54  E-value=59  Score=25.95  Aligned_cols=24  Identities=17%  Similarity=0.207  Sum_probs=16.3

Q ss_pred             eecccCCCCCccccccHHHHHHHHH
Q psy14119         35 VALAEDLPGAEHHYASAKEFYAAAD   59 (90)
Q Consensus        35 vaLiEDLP~~ee~~~s~~~f~~~~~   59 (90)
                      +..||| |++++|++.+..+.+++.
T Consensus       151 IvsIED-pf~edD~e~w~~lt~~~g  174 (295)
T PF00113_consen  151 IVSIED-PFDEDDWEGWAKLTKRLG  174 (295)
T ss_dssp             EEEEES-SS-TT-HHHHHHHHHHHT
T ss_pred             eEEEEc-cccccchHHHHHHHHhhh
Confidence            566788 788888888877766654


No 31 
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=21.20  E-value=73  Score=22.28  Aligned_cols=36  Identities=25%  Similarity=0.370  Sum_probs=23.2

Q ss_pred             hcceecccCCCCCcc----ccc-cHHHHHHHHHHHhhhhhhcc
Q psy14119         32 VRSVALAEDLPGAEH----HYA-SAKEFYAAADKGYTLCKSSK   69 (90)
Q Consensus        32 v~SvaLiEDLP~~ee----~~~-s~~~f~~~~~~~Y~qvAyN~   69 (90)
                      ++.+|=+  +|.+++    .|+ .+++++++.++.|=++=-+|
T Consensus        87 ~~~LA~f--~P~~e~p~y~~~~~e~~~Yr~~LE~rYP~lC~~C  127 (131)
T PF09779_consen   87 INQLASF--LPDPEDPEYANYEEELPEYRRSLEQRYPQLCSSC  127 (131)
T ss_pred             HHHHHhc--CCCCCCccHHHHHHHHHHHHHHHHHHhhHhhhhh
Confidence            4445545  576444    454 47888999999996554444


No 32 
>PF14276 DUF4363:  Domain of unknown function (DUF4363)
Probab=20.33  E-value=69  Score=21.31  Aligned_cols=23  Identities=13%  Similarity=0.208  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHhhccee-cccCCC
Q psy14119         20 IVQLVLMGFFYSVRSVA-LAEDLP   42 (90)
Q Consensus        20 iImL~lLGiFF~v~Sva-LiEDLP   42 (90)
                      ++.+++++.+|..+.+. .-++++
T Consensus         6 i~~lii~~~~~~~~~l~~~~~~i~   29 (121)
T PF14276_consen    6 IFILIIALSIFSNNYLNNSTDSIE   29 (121)
T ss_pred             HHHHHHHHHHHHHhhhhhHHHHHH
Confidence            44455666666666663 445555


Done!