Diaphorina citri psyllid: psy14119

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MKICGPKLSLCGLVISAWGIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFYAAADKGYTLCKSSKRGARGSLPFCLMGNPALVNIS
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHccccccccccccCECcccccccccc
*KICGPKLSLCGLVISAWGIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFYAAADKGYTLCKSSKRGARGSLPFCLMGNPALVNI*
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKICGPKLSLCGLVISAWGIVQLVLMGFFYSVRSVALAEDLPGAEHHYASAKEFYAAADKGYTLCKSSKRGARGSLPFCLMGNPALVNIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribonuclease kappa Endoribonuclease.confidentQ8MSF5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004521 [MF]endoribonuclease activityprobableGO:0016787, GO:0004518, GO:0004519, GO:0004540, GO:0016788, GO:0003824, GO:0003674
GO:0009303 [BP]rRNA transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted