BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy14128
(393 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3S30|A Chain A, Crystal Structure Of A Hypothetical Glycoside Hydrolase
(Bvu_0247) From Bacteroides Vulgatus Atcc 8482 At 2.46 A
Resolution
pdb|3S30|B Chain B, Crystal Structure Of A Hypothetical Glycoside Hydrolase
(Bvu_0247) From Bacteroides Vulgatus Atcc 8482 At 2.46 A
Resolution
Length = 354
Score = 29.6 bits (65), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
Query: 42 KVDLRYDYEHLGESADLIKQLASGSHPFSKKLSAAKKPLIVVGA 85
+ +L ++YEH G++ D ++LA+G + S LSA+K + GA
Sbjct: 293 RFELDFNYEHYGKTID-PQKLANGGYNVSIVLSASKDGDVFQGA 335
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.134 0.377
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,230,961
Number of Sequences: 62578
Number of extensions: 383255
Number of successful extensions: 862
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 861
Number of HSP's gapped (non-prelim): 2
length of query: 393
length of database: 14,973,337
effective HSP length: 101
effective length of query: 292
effective length of database: 8,652,959
effective search space: 2526664028
effective search space used: 2526664028
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)