Diaphorina citri psyllid: psy14144


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MTYEMSANSQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRAKDGMAPIHAAAQMGCLSCLKWMLYEACNIFKLTACIILSHYNIIRRRRVVFKIWI
ccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHHcc
*****SANSQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRAKDGMAPIHAAAQMGCLSCLKWMLYEACNIFKLTACIILSHYNIIRRRRVVFKIWI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYEMSANSQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRAKDGMAPIHAAAQMGCLSCLKWMLYEACNIFKLTACIILSHYNIIRRRRVVFKIWI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Espin Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.confidentQ9ET47
Espin Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.confidentQ63618
Espin Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.confidentB1AK53

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031941 [CC]filamentous actinprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051494 [BP]negative regulation of cytoskeleton organizationprobableGO:0033043, GO:0009987, GO:0051493, GO:0010639, GO:0051129, GO:0051128, GO:0008150, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0030046 [BP]parallel actin filament bundle assemblyprobableGO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0051017, GO:0016043, GO:0044085, GO:0044763, GO:0030036, GO:0008150, GO:0071840
GO:0035017 [BP]cuticle pattern formationprobableGO:0032502, GO:0007389, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005903 [CC]brush borderprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0031674 [CC]I bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045202 [CC]synapseprobableGO:0005575
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032426 [CC]stereocilium bundle tipprobableGO:0032421, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0035317 [BP]imaginal disc-derived wing hair organizationprobableGO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0044763, GO:0048731, GO:0022008, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0008150, GO:0048736, GO:0048737
GO:0008407 [BP]chaeta morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0007275, GO:0022416
GO:0048800 [BP]antennal morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0009791, GO:0002165, GO:0035214, GO:0009653, GO:0007275, GO:0044699, GO:0007455, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0032501, GO:0035114, GO:0008150, GO:0007469, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 15-96
View the alignment between query and template
View the model in PyMOL