Query         psy14147
Match_columns 100
No_of_seqs    128 out of 1414
Neff          11.3
Searched_HMMs 46136
Date          Fri Aug 16 20:41:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14147.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14147hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.3E-28   5E-33  139.6   0.8   93    3-98    164-256 (279)
  2 KOG2462|consensus               99.9 6.1E-26 1.3E-30  129.8   1.2   95    3-100   133-230 (279)
  3 KOG3623|consensus               99.8 3.1E-19 6.6E-24  113.5   3.0   74   26-100   892-965 (1007)
  4 KOG3576|consensus               99.7 3.4E-19 7.3E-24   98.8   1.7   92    2-94    119-221 (267)
  5 KOG1074|consensus               99.7 1.4E-18   3E-23  111.6   2.0   46    3-48    356-401 (958)
  6 KOG3623|consensus               99.7 3.2E-17   7E-22  104.6   4.8   97    3-100   213-324 (1007)
  7 KOG3576|consensus               99.6   4E-17 8.8E-22   90.6   0.5   73   26-99    115-187 (267)
  8 KOG3608|consensus               99.3 5.5E-13 1.2E-17   79.7   2.7   92    3-97    210-304 (467)
  9 PHA02768 hypothetical protein;  99.3 1.4E-12 3.1E-17   58.5   2.9   41   57-99      5-45  (55)
 10 PHA00733 hypothetical protein   99.3 1.1E-12 2.5E-17   69.4   2.3   83   14-98     26-112 (128)
 11 PF13465 zf-H2C2_2:  Zinc-finge  99.3 6.2E-12 1.3E-16   48.8   2.6   26   72-97      1-26  (26)
 12 KOG3608|consensus               99.3 9.7E-12 2.1E-16   74.5   4.5   85    3-90    240-324 (467)
 13 KOG1074|consensus               99.2   2E-12 4.3E-17   84.1   0.3   90    7-97    612-721 (958)
 14 PLN03086 PRLI-interacting fact  99.2 1.9E-11 4.1E-16   77.7   3.1   88    3-97    456-553 (567)
 15 PHA00733 hypothetical protein   99.1 1.5E-10 3.3E-15   61.4   4.8   65   14-82     60-124 (128)
 16 PHA02768 hypothetical protein;  99.0 9.8E-11 2.1E-15   52.6   1.6   42   29-73      6-47  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.3E-10 2.8E-15   45.1   0.2   24   16-39      2-25  (26)
 18 PHA00616 hypothetical protein   98.8 2.2E-09 4.8E-14   46.1   1.8   33   57-89      1-33  (44)
 19 PLN03086 PRLI-interacting fact  98.8 8.8E-09 1.9E-13   66.0   4.8   65   26-96    451-515 (567)
 20 PHA00732 hypothetical protein   98.6   4E-08 8.6E-13   47.9   2.7   49   28-82      1-49  (79)
 21 PHA00732 hypothetical protein   98.6 4.5E-08 9.9E-13   47.7   2.1   33    4-39      5-38  (79)
 22 PHA00616 hypothetical protein   98.5   6E-08 1.3E-12   41.7   2.0   36   28-64      1-36  (44)
 23 PF05605 zf-Di19:  Drought indu  98.3 1.6E-06 3.4E-11   39.4   3.7   51   28-81      2-53  (54)
 24 KOG3993|consensus               98.2 2.6E-07 5.6E-12   57.1  -0.6   69   29-98    268-369 (500)
 25 KOG3993|consensus               98.1 2.1E-06 4.6E-11   53.2   2.7   79    2-81    269-380 (500)
 26 PF00096 zf-C2H2:  Zinc finger,  98.0 4.5E-06 9.6E-11   31.0   1.4   21   29-49      1-21  (23)
 27 PF00096 zf-C2H2:  Zinc finger,  98.0 4.4E-06 9.5E-11   31.1   1.4   23   58-80      1-23  (23)
 28 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.1E-05 2.4E-10   31.1   1.4   21   28-48      1-21  (27)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.6E-05 3.5E-10   29.5   1.9   21   29-49      1-21  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.3E-05 2.8E-10   31.0   1.4   26   57-82      1-26  (27)
 31 PRK04860 hypothetical protein;  97.8 1.5E-05 3.3E-10   43.9   2.2   37   57-97    119-155 (160)
 32 COG5189 SFP1 Putative transcri  97.8 7.1E-06 1.5E-10   49.4   0.6   63   26-98    347-411 (423)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.3E-05 4.9E-10   29.1   1.8   24   58-81      1-24  (24)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.7   3E-05 6.5E-10   39.1   2.2   71    4-80      3-73  (100)
 35 COG5189 SFP1 Putative transcri  97.7 2.6E-05 5.7E-10   47.0   1.9   25   54-78    346-372 (423)
 36 PF09237 GAGA:  GAGA factor;  I  97.6 8.2E-05 1.8E-09   32.9   2.4   32   54-85     21-52  (54)
 37 smart00355 ZnF_C2H2 zinc finge  97.3 0.00032 6.8E-09   26.2   2.3   19   30-48      2-20  (26)
 38 PF05605 zf-Di19:  Drought indu  97.2 0.00053 1.2E-08   31.0   2.7   39   57-96      2-42  (54)
 39 smart00355 ZnF_C2H2 zinc finge  97.1 0.00054 1.2E-08   25.5   1.7   24   58-81      1-24  (26)
 40 PF09237 GAGA:  GAGA factor;  I  97.0  0.0012 2.6E-08   29.3   2.7   33   24-57     20-52  (54)
 41 PF12874 zf-met:  Zinc-finger o  97.0 0.00046 9.9E-09   25.9   1.1   20   29-48      1-20  (25)
 42 PF12874 zf-met:  Zinc-finger o  96.8 0.00082 1.8E-08   25.2   1.3   23   58-80      1-23  (25)
 43 PRK04860 hypothetical protein;  96.7  0.0012 2.5E-08   36.6   2.0   38   28-70    119-156 (160)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.3  0.0026 5.6E-08   23.6   1.3   19   29-48      1-19  (24)
 45 PF12756 zf-C2H2_2:  C2H2 type   96.3  0.0051 1.1E-07   30.9   2.5   23   27-49     49-71  (100)
 46 PF12171 zf-C2H2_jaz:  Zinc-fin  96.1  0.0019 4.1E-08   24.8   0.3   20   29-48      2-21  (27)
 47 cd00350 rubredoxin_like Rubred  95.9  0.0048   1E-07   24.9   1.1    8   85-92     17-24  (33)
 48 smart00451 ZnF_U1 U1-like zinc  95.3   0.015 3.3E-07   23.5   1.6   21   28-48      3-23  (35)
 49 PF13913 zf-C2HC_2:  zinc-finge  95.2   0.023   5E-07   21.4   1.8   18   59-77      4-21  (25)
 50 KOG1146|consensus               94.9   0.027 5.9E-07   40.4   2.6   71    9-79    445-540 (1406)
 51 COG4049 Uncharacterized protei  94.3   0.044 9.6E-07   24.8   1.7   29   21-49     10-38  (65)
 52 PF09538 FYDLN_acid:  Protein o  93.4   0.082 1.8E-06   27.5   2.1   13   57-69     26-38  (108)
 53 COG2888 Predicted Zn-ribbon RN  93.2   0.053 1.1E-06   24.9   1.1   33   55-92     25-57  (61)
 54 PF13719 zinc_ribbon_5:  zinc-r  93.2   0.095 2.1E-06   21.7   1.8   32   59-95      4-35  (37)
 55 cd00729 rubredoxin_SM Rubredox  93.0   0.056 1.2E-06   22.0   0.9    8   29-36      3-10  (34)
 56 COG5048 FOG: Zn-finger [Genera  92.6   0.022 4.7E-07   35.7  -0.9   63   27-89    288-355 (467)
 57 PF13717 zinc_ribbon_4:  zinc-r  92.4    0.15 3.3E-06   21.0   1.8   32   59-95      4-35  (36)
 58 KOG2893|consensus               92.4    0.03 6.4E-07   33.1  -0.4   42   30-76     12-53  (341)
 59 TIGR02098 MJ0042_CXXC MJ0042 f  92.2    0.13 2.8E-06   21.2   1.6   11   85-95     25-35  (38)
 60 TIGR00622 ssl1 transcription f  92.2    0.14   3E-06   26.8   1.9   66   27-96     14-92  (112)
 61 COG1592 Rubrerythrin [Energy p  92.1    0.09 1.9E-06   29.4   1.3   10   55-64    147-156 (166)
 62 PRK00464 nrdR transcriptional   91.9   0.025 5.4E-07   31.2  -1.0   11   58-68     29-39  (154)
 63 PF07754 DUF1610:  Domain of un  91.3   0.099 2.2E-06   19.5   0.6   10   84-93     15-24  (24)
 64 PF09986 DUF2225:  Uncharacteri  90.5   0.028 6.1E-07   32.7  -1.8   22   26-47      3-24  (214)
 65 smart00659 RPOLCX RNA polymera  90.1    0.24 5.3E-06   21.4   1.4   10   29-38      3-12  (44)
 66 TIGR00373 conserved hypothetic  90.0    0.54 1.2E-05   26.2   3.0   12   57-68    109-120 (158)
 67 KOG2186|consensus               89.5    0.26 5.7E-06   29.4   1.6   52   28-83      3-54  (276)
 68 PF15135 UPF0515:  Uncharacteri  89.4    0.38 8.2E-06   28.7   2.2   57   26-96    110-166 (278)
 69 smart00531 TFIIE Transcription  89.4    0.76 1.6E-05   25.2   3.3   13   56-68     98-110 (147)
 70 COG5048 FOG: Zn-finger [Genera  89.0    0.18   4E-06   31.6   0.8   44   56-99    288-337 (467)
 71 PRK09678 DNA-binding transcrip  88.9   0.084 1.8E-06   25.4  -0.6    9   30-38      3-11  (72)
 72 KOG4173|consensus               88.4    0.63 1.4E-05   27.1   2.6   70    6-78     87-167 (253)
 73 PRK06266 transcription initiat  88.3    0.88 1.9E-05   25.9   3.1   16   26-41    115-130 (178)
 74 KOG2186|consensus               88.3    0.36 7.9E-06   28.9   1.6   43   13-58     15-57  (276)
 75 KOG2893|consensus               88.1    0.08 1.7E-06   31.3  -1.1   44    6-53     16-59  (341)
 76 TIGR02300 FYDLN_acid conserved  87.8    0.47   1E-05   25.4   1.7   30   29-70     10-39  (129)
 77 PF14353 CpXC:  CpXC protein     87.3    0.72 1.6E-05   24.5   2.3    8   31-38      4-11  (128)
 78 PRK14890 putative Zn-ribbon RN  87.1    0.24 5.3E-06   22.8   0.4   34   55-93     23-56  (59)
 79 PF10571 UPF0547:  Uncharacteri  86.8    0.35 7.6E-06   18.4   0.7   10   87-96     16-25  (26)
 80 KOG1146|consensus               86.8    0.59 1.3E-05   34.3   2.2   48    2-49    467-539 (1406)
 81 smart00834 CxxC_CXXC_SSSS Puta  86.5    0.36 7.8E-06   20.1   0.7   11   86-96      6-16  (41)
 82 PF13451 zf-trcl:  Probable zin  85.7    0.62 1.3E-05   20.7   1.3   36   27-64      3-40  (49)
 83 PHA00626 hypothetical protein   85.4    0.58 1.3E-05   21.3   1.1   15   83-97     21-35  (59)
 84 PF09723 Zn-ribbon_8:  Zinc rib  85.0    0.46   1E-05   20.2   0.7   11   86-96      6-16  (42)
 85 COG1997 RPL43A Ribosomal prote  84.9     0.4 8.7E-06   23.9   0.5   12   85-96     53-64  (89)
 86 PLN02294 cytochrome c oxidase   83.6    0.64 1.4E-05   26.2   1.0   14   83-96    139-152 (174)
 87 smart00734 ZnF_Rad18 Rad18-lik  83.1     1.3 2.8E-05   16.7   1.5   19   59-78      3-21  (26)
 88 PF12760 Zn_Tnp_IS1595:  Transp  83.1     1.2 2.5E-05   19.3   1.6   29   56-93     17-45  (46)
 89 KOG3408|consensus               82.9    0.92   2E-05   24.1   1.4   27   53-79     53-79  (129)
 90 smart00154 ZnF_AN1 AN1-like Zi  82.8    0.75 1.6E-05   19.2   0.9   12   85-96     12-23  (39)
 91 PF12907 zf-met2:  Zinc-binding  82.6    0.65 1.4E-05   19.7   0.6   24   29-52      2-28  (40)
 92 PRK03824 hypA hydrogenase nick  82.2    0.43 9.3E-06   25.9   0.0   13   57-69     70-82  (135)
 93 cd00924 Cyt_c_Oxidase_Vb Cytoc  81.5    0.86 1.9E-05   23.3   1.0   17   79-96     74-90  (97)
 94 COG1996 RPC10 DNA-directed RNA  81.5    0.86 1.9E-05   20.2   0.9   11   28-38      6-16  (49)
 95 KOG2785|consensus               81.4     2.3 4.9E-05   27.2   2.9   51   27-78    165-241 (390)
 96 TIGR02605 CxxC_CxxC_SSSS putat  81.1     0.8 1.7E-05   20.2   0.7   11   86-96      6-16  (52)
 97 PF01428 zf-AN1:  AN1-like Zinc  79.4    0.68 1.5E-05   19.7   0.2   12   84-95     12-23  (43)
 98 PF05191 ADK_lid:  Adenylate ki  79.2     0.5 1.1E-05   19.4  -0.3    8   31-38      4-11  (36)
 99 PF06524 NOA36:  NOA36 protein;  77.2       3 6.4E-05   25.4   2.4   72   23-95    137-219 (314)
100 PF08274 PhnA_Zn_Ribbon:  PhnA   77.1     1.2 2.5E-05   17.6   0.5   12   83-94     17-28  (30)
101 COG2331 Uncharacterized protei  76.7       2 4.2E-05   20.9   1.3   32   28-67     12-43  (82)
102 PF09845 DUF2072:  Zn-ribbon co  75.9     1.4 3.1E-05   23.7   0.8   15   28-42      1-15  (131)
103 PF05443 ROS_MUCR:  ROS/MUCR tr  75.7     1.7 3.7E-05   23.5   1.1   25   58-85     73-97  (132)
104 PRK00398 rpoP DNA-directed RNA  75.7     1.5 3.3E-05   18.9   0.8   11   85-95      3-13  (46)
105 PF01286 XPA_N:  XPA protein N-  75.7     1.5 3.3E-05   17.8   0.7   13   86-98      4-16  (34)
106 TIGR01206 lysW lysine biosynth  74.8       2 4.3E-05   19.5   1.0   10   29-38      3-12  (54)
107 PF02892 zf-BED:  BED zinc fing  74.7     3.3 7.2E-05   17.5   1.7   23   26-48     14-40  (45)
108 PF04780 DUF629:  Protein of un  73.5     2.8   6E-05   27.7   1.8   29   27-55     56-84  (466)
109 PF08790 zf-LYAR:  LYAR-type C2  73.1     1.8 3.9E-05   16.8   0.6   11   86-96      1-11  (28)
110 COG0068 HypF Hydrogenase matur  72.7    0.61 1.3E-05   32.1  -1.3   56   30-93    125-181 (750)
111 KOG2593|consensus               72.3     6.8 0.00015   25.6   3.2   38   54-94    125-162 (436)
112 PF07282 OrfB_Zn_ribbon:  Putat  72.3       3 6.5E-05   19.5   1.4   11   84-94     45-55  (69)
113 KOG4167|consensus               72.2       2 4.4E-05   29.9   1.0   23    3-25    795-817 (907)
114 COG3677 Transposase and inacti  71.6       2 4.4E-05   23.1   0.8   15   83-97     51-65  (129)
115 PF09963 DUF2197:  Uncharacteri  71.5     1.5 3.2E-05   20.0   0.2   36   30-65      4-39  (56)
116 smart00614 ZnF_BED BED zinc fi  70.6     4.8  0.0001   17.6   1.8    8   71-78     37-44  (50)
117 PF04423 Rad50_zn_hook:  Rad50   70.5     1.9 4.1E-05   19.3   0.4   10   87-96     22-31  (54)
118 PF01215 COX5B:  Cytochrome c o  70.2     1.6 3.4E-05   23.8   0.2   17   79-96    107-123 (136)
119 PF10013 DUF2256:  Uncharacteri  69.6     2.3 4.9E-05   18.2   0.5   11   87-97     10-20  (42)
120 PF12013 DUF3505:  Protein of u  69.2     4.8  0.0001   20.8   1.8   25   58-82     81-109 (109)
121 PF03604 DNA_RNApol_7kD:  DNA d  68.8     3.6 7.8E-05   16.4   1.0   11   86-96      1-11  (32)
122 PRK12380 hydrogenase nickel in  68.2     2.7 5.9E-05   22.0   0.8   25   57-93     70-94  (113)
123 KOG1842|consensus               67.9     4.6 9.9E-05   26.5   1.8   29   27-55     14-42  (505)
124 COG3091 SprT Zn-dependent meta  67.8     2.5 5.3E-05   23.5   0.6   35   56-95    116-150 (156)
125 PTZ00043 cytochrome c oxidase   67.6     2.9 6.4E-05   24.8   0.9   16   81-96    177-192 (268)
126 KOG2785|consensus               67.3     7.1 0.00015   25.1   2.5   23   56-78     67-89  (390)
127 PF01363 FYVE:  FYVE zinc finge  66.8     3.7 7.9E-05   19.2   1.0    8   31-38     12-19  (69)
128 TIGR00100 hypA hydrogenase nic  66.7     2.5 5.4E-05   22.2   0.5   26   57-94     70-95  (115)
129 PF04959 ARS2:  Arsenite-resist  66.2     4.7  0.0001   23.8   1.5   29   25-53     74-102 (214)
130 PF10276 zf-CHCC:  Zinc-finger   64.6       3 6.6E-05   17.6   0.5   12   84-95     28-39  (40)
131 PF13824 zf-Mss51:  Zinc-finger  63.4     6.1 0.00013   18.0   1.3   15   53-67     10-24  (55)
132 KOG4167|consensus               62.6     1.9 4.2E-05   29.9  -0.5   25   57-81    792-816 (907)
133 COG1571 Predicted DNA-binding   62.5       6 0.00013   25.8   1.6   12   57-68    367-378 (421)
134 PF02891 zf-MIZ:  MIZ/SP-RING z  62.1     2.8   6E-05   18.5   0.1    8   86-93     42-49  (50)
135 PF08792 A2L_zn_ribbon:  A2L zi  61.8     4.7  0.0001   16.2   0.8   11   86-96     22-32  (33)
136 KOG2807|consensus               61.7      13 0.00029   23.5   2.9   22   27-48    289-310 (378)
137 PF13878 zf-C2H2_3:  zinc-finge  61.3      11 0.00023   15.9   1.8   22   59-80     15-38  (41)
138 PF10083 DUF2321:  Uncharacteri  61.0     3.9 8.4E-05   22.8   0.6   16   82-97     65-80  (158)
139 COG3357 Predicted transcriptio  60.6     4.2 9.2E-05   20.5   0.6   14   84-97     57-70  (97)
140 COG4338 Uncharacterized protei  60.3     3.3 7.2E-05   18.2   0.2   16   59-74     14-29  (54)
141 smart00064 FYVE Protein presen  59.0     6.4 0.00014   18.3   1.1   11   29-39     11-21  (68)
142 PRK00564 hypA hydrogenase nick  58.9     3.9 8.5E-05   21.6   0.4   12   57-68     71-82  (117)
143 PRK14873 primosome assembly pr  58.8       7 0.00015   27.1   1.6   10   85-94    422-431 (665)
144 cd00065 FYVE FYVE domain; Zinc  58.4     8.6 0.00019   17.0   1.4   10   30-39      4-13  (57)
145 COG1198 PriA Primosomal protei  58.1     3.1 6.7E-05   29.1  -0.1   15   80-94    470-484 (730)
146 PRK00432 30S ribosomal protein  57.7     6.3 0.00014   17.5   0.9   12   84-95     36-47  (50)
147 PF02176 zf-TRAF:  TRAF-type zi  56.7     6.9 0.00015   17.5   0.9    6   43-48     25-30  (60)
148 PF01155 HypA:  Hydrogenase exp  56.5     3.8 8.3E-05   21.5   0.1   13   58-70     71-83  (113)
149 PF01096 TFIIS_C:  Transcriptio  56.4     5.3 0.00011   16.6   0.5   10   86-95     29-38  (39)
150 COG4391 Uncharacterized protei  56.2       5 0.00011   18.7   0.4   43   50-96     17-59  (62)
151 PRK03681 hypA hydrogenase nick  54.5       4 8.6E-05   21.5  -0.0   11   57-67     70-80  (114)
152 KOG2482|consensus               54.3     7.2 0.00016   24.8   1.0   21   29-49    196-216 (423)
153 PF14369 zf-RING_3:  zinc-finge  53.7     6.5 0.00014   16.0   0.5    9   87-95     23-31  (35)
154 smart00440 ZnF_C2C2 C2C2 Zinc   53.4       8 0.00017   16.2   0.8   11   86-96     29-39  (40)
155 PF04606 Ogr_Delta:  Ogr/Delta-  53.3     2.2 4.7E-05   18.6  -1.0   13   84-96     24-38  (47)
156 PF01927 Mut7-C:  Mut7-C RNAse   52.3     7.4 0.00016   21.3   0.8   39   58-96     92-135 (147)
157 KOG3352|consensus               52.3       7 0.00015   21.7   0.6   14   83-96    131-144 (153)
158 PF13240 zinc_ribbon_2:  zinc-r  51.1      11 0.00025   13.6   1.0    7   87-93     15-21  (23)
159 PF14311 DUF4379:  Domain of un  50.5      12 0.00026   16.7   1.2   10   58-67     29-38  (55)
160 PF11672 DUF3268:  Protein of u  50.5     7.8 0.00017   20.1   0.6    9   28-36      2-10  (102)
161 PF08271 TF_Zn_Ribbon:  TFIIB z  50.4       9 0.00019   16.1   0.7    7   87-93      2-8   (43)
162 COG1675 TFA1 Transcription ini  50.0      28 0.00061   20.0   2.8   49    8-66     93-141 (176)
163 TIGR00244 transcriptional regu  49.7     7.6 0.00016   21.5   0.5   12   86-97     29-40  (147)
164 PF08209 Sgf11:  Sgf11 (transcr  49.5     8.3 0.00018   15.5   0.5   12   85-96      4-15  (33)
165 PF06220 zf-U1:  U1 zinc finger  49.0      11 0.00025   15.6   0.9   13   85-97      3-15  (38)
166 PF00301 Rubredoxin:  Rubredoxi  49.0     9.6 0.00021   16.7   0.7   10   86-95      2-11  (47)
167 KOG3507|consensus               48.6     9.3  0.0002   17.6   0.6   26   29-66     21-46  (62)
168 PF14787 zf-CCHC_5:  GAG-polypr  48.5     9.3  0.0002   15.8   0.6   11   87-97      4-14  (36)
169 COG0675 Transposase and inacti  48.3      11 0.00024   23.2   1.2   11   84-94    321-331 (364)
170 COG4530 Uncharacterized protei  48.2     9.6 0.00021   20.0   0.7   27   59-96     11-37  (129)
171 PF10263 SprT-like:  SprT-like   48.1       5 0.00011   22.0  -0.3   32   57-96    123-154 (157)
172 KOG4727|consensus               48.0      10 0.00022   21.7   0.8   20   29-48     76-95  (193)
173 PF06397 Desulfoferrod_N:  Desu  47.9     9.5 0.00021   15.7   0.6   11   84-94      5-15  (36)
174 TIGR03831 YgiT_finger YgiT-typ  47.6     9.1  0.0002   16.0   0.6   10   86-95     33-42  (46)
175 COG1326 Uncharacterized archae  47.3      23 0.00051   20.7   2.2   11   57-67     30-40  (201)
176 COG5112 UFD2 U1-like Zn-finger  47.3      11 0.00023   19.7   0.8   25   54-78     52-76  (126)
177 COG1327 Predicted transcriptio  47.3     8.5 0.00019   21.5   0.5   12   86-97     29-40  (156)
178 PRK00420 hypothetical protein;  46.7      17 0.00037   19.2   1.6    9   58-66     41-49  (112)
179 KOG1280|consensus               46.3      21 0.00046   22.8   2.1   38   27-64     78-116 (381)
180 PRK01343 zinc-binding protein;  44.7      13 0.00029   17.1   0.8   11   86-96     10-20  (57)
181 PRK00762 hypA hydrogenase nick  44.1     7.8 0.00017   20.7   0.1   12   57-69     70-81  (124)
182 PF14690 zf-ISL3:  zinc-finger   43.7      12 0.00027   15.8   0.7   10   85-94      2-11  (47)
183 PRK05978 hypothetical protein;  43.4     7.4 0.00016   21.6  -0.1   12   86-97     53-64  (148)
184 KOG2231|consensus               43.3      43 0.00094   23.6   3.3   19   30-48    184-202 (669)
185 KOG2231|consensus               43.2      40 0.00086   23.8   3.1   23   59-81    184-206 (669)
186 PF03966 Trm112p:  Trm112p-like  42.3      11 0.00024   17.7   0.4   17   80-96     48-64  (68)
187 TIGR00627 tfb4 transcription f  42.2      20 0.00042   22.2   1.5    9   87-95    271-279 (279)
188 PF04438 zf-HIT:  HIT zinc fing  42.0      15 0.00032   14.3   0.7   11   85-95     13-23  (30)
189 PF12773 DZR:  Double zinc ribb  41.4      25 0.00054   15.1   1.5    9   86-94     30-38  (50)
190 COG4896 Uncharacterized protei  41.3      13 0.00029   17.3   0.6   13   53-65     27-39  (68)
191 PF05495 zf-CHY:  CHY zinc fing  41.1     9.6 0.00021   18.2   0.1   31   57-95     41-71  (71)
192 PF14446 Prok-RING_1:  Prokaryo  40.5      14 0.00029   16.8   0.5   10   87-96      7-16  (54)
193 PF01780 Ribosomal_L37ae:  Ribo  40.2      12 0.00027   18.9   0.4   30   57-96     35-64  (90)
194 PF02591 DUF164:  Putative zinc  39.6      39 0.00084   15.1   2.0   31   59-93     24-54  (56)
195 PRK04023 DNA polymerase II lar  39.5      23  0.0005   26.2   1.7   11   27-37    625-635 (1121)
196 PF07975 C1_4:  TFIIH C1-like d  39.4     8.2 0.00018   17.3  -0.3   26   26-52     19-44  (51)
197 PF03811 Zn_Tnp_IS1:  InsA N-te  39.3     6.1 0.00013   16.2  -0.6   16   76-91     20-35  (36)
198 KOG2907|consensus               38.9      18  0.0004   19.1   0.9   39   58-98     75-115 (116)
199 PF13248 zf-ribbon_3:  zinc-rib  38.7      11 0.00024   14.0   0.1    6   88-93     19-24  (26)
200 COG5151 SSL1 RNA polymerase II  38.6      45 0.00097   21.2   2.6   22   57-78    388-409 (421)
201 PF11789 zf-Nse:  Zinc-finger o  38.4      16 0.00035   16.6   0.6   30   57-90     24-53  (57)
202 PF04810 zf-Sec23_Sec24:  Sec23  38.2      15 0.00032   15.3   0.5   12   54-65     21-32  (40)
203 KOG1088|consensus               38.0      19 0.00041   19.2   0.9   19   79-97     92-110 (124)
204 KOG2071|consensus               38.0      19 0.00041   24.7   1.1   28   25-53    415-442 (579)
205 COG4957 Predicted transcriptio  37.9      17 0.00038   19.9   0.8   24   59-85     78-101 (148)
206 KOG2636|consensus               37.0      21 0.00046   23.7   1.2   27   22-48    395-422 (497)
207 cd00974 DSRD Desulforedoxin (D  36.9      20 0.00043   14.2   0.7   12   84-95      3-14  (34)
208 COG1656 Uncharacterized conser  36.7      18  0.0004   20.5   0.8   37   58-96     98-141 (165)
209 PRK04351 hypothetical protein;  35.8      12 0.00025   20.8  -0.1   31   58-96    113-143 (149)
210 TIGR00595 priA primosomal prot  35.4     9.8 0.00021   25.5  -0.5   11   83-93    251-261 (505)
211 TIGR00319 desulf_FeS4 desulfof  35.4      22 0.00047   14.1   0.7   12   84-95      6-17  (34)
212 PF07295 DUF1451:  Protein of u  35.2      22 0.00047   19.7   0.9    9   57-65    112-120 (146)
213 PF10537 WAC_Acf1_DNA_bd:  ATP-  35.2      39 0.00085   17.5   1.8   36   28-65      3-38  (102)
214 TIGR00280 L37a ribosomal prote  34.8      20 0.00044   18.2   0.7   30   57-96     35-64  (91)
215 COG4888 Uncharacterized Zn rib  34.6      21 0.00046   18.5   0.8   12   83-94     20-31  (104)
216 COG5236 Uncharacterized conser  34.2      55  0.0012   21.2   2.6   19   31-49    223-241 (493)
217 PF02748 PyrI_C:  Aspartate car  34.1      20 0.00044   16.0   0.6   15   82-96     32-46  (52)
218 PF14447 Prok-RING_4:  Prokaryo  34.1      27 0.00059   15.9   1.0   10   87-96     41-50  (55)
219 COG5432 RAD18 RING-finger-cont  34.0      23  0.0005   22.2   0.9   13   52-65     55-67  (391)
220 PF11931 DUF3449:  Domain of un  33.7      14  0.0003   21.6   0.0   26   23-48     96-122 (196)
221 PRK05580 primosome assembly pr  33.7      11 0.00025   26.1  -0.4   13   81-93    417-429 (679)
222 COG2093 DNA-directed RNA polym  32.8      24 0.00052   16.6   0.7    8   87-94     20-27  (64)
223 COG2879 Uncharacterized small   32.8      61  0.0013   15.3   2.0   19   38-57     22-40  (65)
224 PF10164 DUF2367:  Uncharacteri  32.5      25 0.00054   18.1   0.8   12   84-95     87-98  (98)
225 KOG1409|consensus               32.3      15 0.00032   23.6  -0.0   39   58-97    283-321 (404)
226 smart00731 SprT SprT homologue  31.8      21 0.00045   19.5   0.5   33   57-96    112-144 (146)
227 PTZ00255 60S ribosomal protein  31.2      26 0.00055   17.8   0.7   30   57-96     36-65  (90)
228 KOG0782|consensus               31.1     5.9 0.00013   27.1  -1.9   27   43-70    240-266 (1004)
229 PRK08222 hydrogenase 4 subunit  30.8      18 0.00038   20.7   0.1   16   83-98    112-127 (181)
230 KOG0717|consensus               30.5      32 0.00069   23.1   1.2   21   58-78    293-313 (508)
231 PRK03976 rpl37ae 50S ribosomal  30.2      27 0.00058   17.7   0.7   30   57-96     36-65  (90)
232 TIGR00143 hypF [NiFe] hydrogen  29.8     5.6 0.00012   27.8  -2.3    9   84-92    139-147 (711)
233 KOG1994|consensus               29.7      31 0.00066   20.8   1.0   25   54-78    236-260 (268)
234 COG1885 Uncharacterized protei  29.7      27 0.00058   18.2   0.6   11   86-96     50-60  (115)
235 COG1579 Zn-ribbon protein, pos  29.6      56  0.0012   19.8   2.0   14   82-95    218-231 (239)
236 COG1545 Predicted nucleic-acid  29.5      25 0.00055   19.2   0.6   10   86-95     30-39  (140)
237 COG4306 Uncharacterized protei  29.4      26 0.00057   18.9   0.6   15   83-97     66-80  (160)
238 PF05741 zf-nanos:  Nanos RNA b  29.4      19 0.00041   16.4   0.1    8   86-93     34-41  (55)
239 PF05290 Baculo_IE-1:  Baculovi  29.2      32  0.0007   18.9   0.9   13   87-99    123-135 (140)
240 smart00661 RPOL9 RNA polymeras  29.2      36 0.00078   14.6   1.0   11   85-95     20-30  (52)
241 cd01410 SIRT7 SIRT7: Eukaryoti  29.1      91   0.002   18.3   2.8   12   57-68     95-106 (206)
242 COG1773 Rubredoxin [Energy pro  28.8      20 0.00044   16.3   0.1   12   28-39      3-14  (55)
243 cd04476 RPA1_DBD_C RPA1_DBD_C:  28.5      31 0.00067   19.2   0.8   12   84-95     50-61  (166)
244 PF05129 Elf1:  Transcription e  28.3      27 0.00059   17.2   0.5   10   83-92     20-29  (81)
245 PF02146 SIR2:  Sir2 family;  I  28.0      55  0.0012   18.5   1.8   12   58-69    106-117 (178)
246 PF15269 zf-C2H2_7:  Zinc-finge  27.9      38 0.00083   14.7   0.9   21   29-49     21-41  (54)
247 smart00132 LIM Zinc-binding do  27.8      30 0.00064   13.4   0.5    9   86-94     28-36  (39)
248 PRK07218 replication factor A;  27.6      36 0.00078   22.5   1.1   10   58-67    298-307 (423)
249 PF10058 DUF2296:  Predicted in  27.4      34 0.00073   15.4   0.7   11   83-93     42-52  (54)
250 PLN02748 tRNA dimethylallyltra  27.3      48   0.001   22.3   1.6   24   56-79    417-441 (468)
251 PF12591 DUF3762:  Protein of u  27.3      34 0.00074   16.3   0.7   11   89-99     70-80  (80)
252 PF11023 DUF2614:  Protein of u  26.9      33 0.00071   18.2   0.7   13   83-95     67-79  (114)
253 KOG2857|consensus               26.8      32 0.00069   19.1   0.6   23   56-78     16-38  (157)
254 COG3364 Zn-ribbon containing p  26.4      36 0.00079   17.7   0.8   14   28-41      2-15  (112)
255 COG3024 Uncharacterized protei  26.4      32 0.00069   16.2   0.5   12   86-97      8-19  (65)
256 PF11494 Ta0938:  Ta0938;  Inte  26.4      25 0.00055   18.0   0.2   38   25-69     11-49  (105)
257 PF14952 zf-tcix:  Putative tre  26.3      31 0.00067   14.9   0.4    8   87-94     13-20  (44)
258 PF03119 DNA_ligase_ZBD:  NAD-d  26.3      31 0.00067   13.2   0.4    8   87-94      1-8   (28)
259 TIGR00686 phnA alkylphosphonat  25.8      36 0.00077   17.9   0.7   12   85-96     19-30  (109)
260 PRK08270 anaerobic ribonucleos  25.6      43 0.00093   23.5   1.2   10   85-94    639-648 (656)
261 PHA02942 putative transposase;  25.4      55  0.0012   21.3   1.6   13   83-95    340-352 (383)
262 COG0846 SIR2 NAD-dependent pro  25.0      40 0.00086   20.6   0.9   12   57-68    122-133 (250)
263 PHA02998 RNA polymerase subuni  24.9      42 0.00092   19.4   0.9   12   86-97    172-183 (195)
264 cd00730 rubredoxin Rubredoxin;  24.6      24 0.00051   15.7  -0.1   11   29-39      2-12  (50)
265 cd01413 SIR2_Af2 SIR2_Af2: Arc  24.3      79  0.0017   18.7   2.0   13   57-69    113-125 (222)
266 KOG0978|consensus               24.3      37 0.00081   24.0   0.7   13   85-97    678-690 (698)
267 PF10609 ParA:  ParA/MinD ATPas  24.0      37 0.00081   16.8   0.6   10   86-95     66-75  (81)
268 PRK03922 hypothetical protein;  23.7      43 0.00094   17.7   0.8   10   87-96     51-60  (113)
269 COG1655 Uncharacterized protei  23.5      35 0.00076   20.7   0.5   12   85-96     19-30  (267)
270 COG3880 Modulator of heat shoc  23.4      17 0.00036   20.8  -0.8   30   29-69     75-104 (176)
271 KOG4118|consensus               23.3      70  0.0015   15.2   1.3   23   58-80     39-61  (74)
272 PF15227 zf-C3HC4_4:  zinc fing  23.0      78  0.0017   13.2   1.8    6   86-91     37-42  (42)
273 COG1594 RPB9 DNA-directed RNA   22.5      42 0.00092   17.7   0.6   12   85-96    100-111 (113)
274 cd01675 RNR_III Class III ribo  22.2      65  0.0014   22.1   1.5    9   85-93    532-540 (555)
275 PRK10220 hypothetical protein;  22.0      53  0.0011   17.4   0.9   12   85-96     20-31  (111)
276 PRK06260 threonine synthase; V  22.0      54  0.0012   21.3   1.1   31   29-72      4-34  (397)
277 TIGR03830 CxxCG_CxxCG_HTH puta  21.6      47   0.001   17.3   0.7   11   86-96     32-42  (127)
278 PTZ00303 phosphatidylinositol   21.5      69  0.0015   23.5   1.6   11   30-40    462-472 (1374)
279 PRK14138 NAD-dependent deacety  21.4      92   0.002   18.8   1.9   13   57-69    119-131 (244)
280 COG5188 PRP9 Splicing factor 3  21.4      54  0.0012   21.3   1.0   22   57-78    238-259 (470)
281 PF05265 DUF723:  Protein of un  21.2 1.1E+02  0.0024   14.3   1.7   28   58-92     33-60  (60)
282 PTZ00409 Sir2 (Silent Informat  20.9 1.4E+02  0.0029   18.5   2.6   13   57-69    137-149 (271)
283 PF11793 FANCL_C:  FANCL C-term  20.9 1.2E+02  0.0025   14.4   2.0   39   58-97     21-67  (70)
284 KOG3456|consensus               20.9      46   0.001   17.5   0.5   14   84-97    103-116 (120)
285 PRK12496 hypothetical protein;  20.9      53  0.0011   18.5   0.8   12   85-96    127-138 (164)
286 PF12677 DUF3797:  Domain of un  20.7      45 0.00098   14.8   0.4    9   86-94     14-22  (49)
287 TIGR00515 accD acetyl-CoA carb  20.6      51  0.0011   20.5   0.8   12   58-69     46-57  (285)
288 PF13005 zf-IS66:  zinc-finger   20.4      52  0.0011   13.9   0.6   10   87-96      4-13  (47)
289 PF13901 DUF4206:  Domain of un  20.4      39 0.00084   19.7   0.2    9   56-64    151-159 (202)
290 PF10367 Vps39_2:  Vacuolar sor  20.4      56  0.0012   16.3   0.8   11   87-97     80-90  (109)
291 PF13408 Zn_ribbon_recom:  Reco  20.2      49  0.0011   14.4   0.5   11   86-96      6-16  (58)
292 PTZ00448 hypothetical protein;  20.2      91   0.002   20.4   1.8   23   57-79    314-336 (373)
293 COG5152 Uncharacterized conser  20.1      45 0.00098   19.7   0.5   16   83-98    194-209 (259)

No 1  
>KOG2462|consensus
Probab=99.94  E-value=2.3e-28  Score=139.59  Aligned_cols=93  Identities=25%  Similarity=0.473  Sum_probs=86.2

Q ss_pred             cchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCC
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      ++.||+.+.+-.+|+.|+++|.  -+.+|.+||+.|.+..-|+.|++ .|+|++||.|+.|+++|..+++|..|+++|.+
T Consensus       164 C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiR-THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  164 CKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIR-THTGEKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             CCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccc-cccCCCCccCCcccchhcchHHHHHHHHhhcC
Confidence            6778899999999999999986  46899999999999999999995 99999999999999999999999999999999


Q ss_pred             CCCeecCCCccccCCC
Q psy14147         83 TPRFKCKLCPKMFTNT   98 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~~   98 (100)
                      .++|+|+.|+|.|+.+
T Consensus       241 ~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  241 VKKHQCPRCGKSFALK  256 (279)
T ss_pred             CccccCcchhhHHHHH
Confidence            9999999999999754


No 2  
>KOG2462|consensus
Probab=99.91  E-value=6.1e-26  Score=129.76  Aligned_cols=95  Identities=22%  Similarity=0.378  Sum_probs=87.6

Q ss_pred             cchHHHHHHHHHHHHhccccccC---CCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHh
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYC---VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQR   79 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~---~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~   79 (100)
                      +.+||+++.+.++|.+|..+|..   .+.+.|..|++.|.....|..|++ +|+  .+.+|.+||+.|..++-|+.|+|+
T Consensus       133 c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  133 CPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             ccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-ccC--CCcccccccccccchHHhhccccc
Confidence            56789999999999999999874   677999999999999999999995 665  689999999999999999999999


Q ss_pred             cCCCCCeecCCCccccCCCCC
Q psy14147         80 HDNTPRFKCKLCPKMFTNTVS  100 (100)
Q Consensus        80 ~~~~~~~~C~~C~~~f~~~~s  100 (100)
                      |||||||.|+.|+|+|++.|+
T Consensus       210 HTGEKPF~C~hC~kAFADRSN  230 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSN  230 (279)
T ss_pred             ccCCCCccCCcccchhcchHH
Confidence            999999999999999998764


No 3  
>KOG3623|consensus
Probab=99.76  E-value=3.1e-19  Score=113.55  Aligned_cols=74  Identities=38%  Similarity=0.694  Sum_probs=69.6

Q ss_pred             CCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccccCCCCC
Q psy14147         26 VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTVS  100 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~s  100 (100)
                      ..+|.|+.|++.|.-.+.|.+|. ..|+|.+||+|.+|.++|...-.|..|.|.|.||+||+|..|+|.|+..+|
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHK-YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGS  965 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHK-YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGS  965 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhh-hhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccc
Confidence            46799999999999999999999 599999999999999999999999999999999999999999999997654


No 4  
>KOG3576|consensus
Probab=99.75  E-value=3.4e-19  Score=98.75  Aligned_cols=92  Identities=26%  Similarity=0.410  Sum_probs=84.0

Q ss_pred             ccchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcC
Q psy14147          2 VVRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus         2 ~~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                      +++.|++.|..+..|.+|++.|...+.+-|..||+.|....+|..|++ .|+|.+||.|..|+++|.+.-.|..|++.-+
T Consensus       119 tCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~r-thtgvrpykc~~c~kaftqrcsleshl~kvh  197 (267)
T KOG3576|consen  119 TCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTR-THTGVRPYKCSLCEKAFTQRCSLESHLKKVH  197 (267)
T ss_pred             eeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhc-cccCccccchhhhhHHHHhhccHHHHHHHHc
Confidence            488999999999999999999999999999999999999999999995 9999999999999999999999999987433


Q ss_pred             -----------CCCCeecCCCccc
Q psy14147         82 -----------NTPRFKCKLCPKM   94 (100)
Q Consensus        82 -----------~~~~~~C~~C~~~   94 (100)
                                 .++.|.|.+||..
T Consensus       198 gv~~~yaykerr~kl~vcedcg~t  221 (267)
T KOG3576|consen  198 GVQHQYAYKERRAKLYVCEDCGYT  221 (267)
T ss_pred             CchHHHHHHHhhhheeeecccCCC
Confidence                       2467899999854


No 5  
>KOG1074|consensus
Probab=99.72  E-value=1.4e-18  Score=111.64  Aligned_cols=46  Identities=22%  Similarity=0.290  Sum_probs=43.7

Q ss_pred             cchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHH
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~   48 (100)
                      +|-|.++|-..+.|+.|.++|.+++||+|++||..|.++.+|..|.
T Consensus       356 Cr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~  401 (958)
T KOG1074|consen  356 CRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHF  401 (958)
T ss_pred             hhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeee
Confidence            6789999999999999999999999999999999999999998876


No 6  
>KOG3623|consensus
Probab=99.69  E-value=3.2e-17  Score=104.57  Aligned_cols=97  Identities=20%  Similarity=0.314  Sum_probs=82.0

Q ss_pred             cchHHHHHHHHHHHHhcccccc--CCCceeCchhhhhccChhHHHHHHhhhcCC-------------CCCccCccccccc
Q psy14147          3 VRSREVMEIQKDVVQSFPIILY--CVKPYACEECGKAFRKKFSLTMHQRHVHLN-------------DRRYQCDLCLARF   67 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~--~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~-------------~~~~~c~~c~~~~   67 (100)
                      +.-|+..+.....|+.|++..+  .+..|.|..|..+|.++..|..|+ ..|..             -+.|.|.+|+++|
T Consensus       213 cpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm-~~hkpg~dqa~sltqsa~lRKFKCtECgKAF  291 (1007)
T KOG3623|consen  213 CPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHM-QLHKPGGDQAISLTQSALLRKFKCTECGKAF  291 (1007)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHH-HhhcCCCcccccccchhhhccccccccchhh
Confidence            4456777778889999986543  244589999999999999999999 57753             2458999999999


Q ss_pred             cChhHHHHHHHhcCCCCCeecCCCccccCCCCC
Q psy14147         68 VTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTVS  100 (100)
Q Consensus        68 ~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~s  100 (100)
                      ...-.|..|+|.|.||+||.|+.|+|.|+..+|
T Consensus       292 KfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGS  324 (1007)
T KOG3623|consen  292 KFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGS  324 (1007)
T ss_pred             hhHHHHHhhheeecCCCCcCCcccccccccCCc
Confidence            999999999999999999999999999987654


No 7  
>KOG3576|consensus
Probab=99.63  E-value=4e-17  Score=90.61  Aligned_cols=73  Identities=30%  Similarity=0.617  Sum_probs=67.8

Q ss_pred             CCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccccCCCC
Q psy14147         26 VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTV   99 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~   99 (100)
                      ...|.|.+|++.|....-|..|++ .|...+.+.|..||++|...-+|.+|.++|+|.+||+|..|+|+|+...
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~k-ch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrc  187 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLK-CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRC  187 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhh-hccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhc
Confidence            455999999999999999999994 8998899999999999999999999999999999999999999998653


No 8  
>KOG3608|consensus
Probab=99.35  E-value=5.5e-13  Score=79.72  Aligned_cols=92  Identities=24%  Similarity=0.373  Sum_probs=51.3

Q ss_pred             cchHHHHHHHHHHHHhccccc--cCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHH-h
Q psy14147          3 VRSREVMEIQKDVVQSFPIIL--YCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQ-R   79 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~--~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~-~   79 (100)
                      +..+|.+|..+.-|..|.+.-  -...+|.|..|-+.|.+...|..|+. .|.  .-|.|+.|..+...++.|..|++ .
T Consensus       210 Cp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~-rHv--n~ykCplCdmtc~~~ssL~~H~r~r  286 (467)
T KOG3608|consen  210 CPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVV-RHV--NCYKCPLCDMTCSSASSLTTHIRYR  286 (467)
T ss_pred             cchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHH-Hhh--hcccccccccCCCChHHHHHHHHhh
Confidence            344444444444444443321  12334555555555555544555542 332  24667777777777777777777 3


Q ss_pred             cCCCCCeecCCCccccCC
Q psy14147         80 HDNTPRFKCKLCPKMFTN   97 (100)
Q Consensus        80 ~~~~~~~~C~~C~~~f~~   97 (100)
                      |...+||+|..|.+.|.+
T Consensus       287 Hs~dkpfKCd~Cd~~c~~  304 (467)
T KOG3608|consen  287 HSKDKPFKCDECDTRCVR  304 (467)
T ss_pred             hccCCCccccchhhhhcc
Confidence            556778888887776654


No 9  
>PHA02768 hypothetical protein; Provisional
Probab=99.33  E-value=1.4e-12  Score=58.53  Aligned_cols=41  Identities=24%  Similarity=0.598  Sum_probs=29.9

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccCCCC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTV   99 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~   99 (100)
                      .|.|+.||+.|.....|..|++.|+  +|++|..|++.|...+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s   45 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTG   45 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccc
Confidence            4677777777777777777777777  5777777777776554


No 10 
>PHA00733 hypothetical protein
Probab=99.31  E-value=1.1e-12  Score=69.39  Aligned_cols=83  Identities=20%  Similarity=0.244  Sum_probs=56.0

Q ss_pred             HHHHhccccccCCCceeCchhhhhccChhHHHHHH--h--hhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecC
Q psy14147         14 DVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQ--R--HVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCK   89 (100)
Q Consensus        14 ~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~--~--~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~   89 (100)
                      +.|.++-.....++++.|.+|.+.|.....|..+.  .  ..+.+..||.|..|++.|.....|..|.+.+  +.+|.|+
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            33444333334467788888888777666555541  0  1233467888888888888888888888865  3568888


Q ss_pred             CCccccCCC
Q psy14147         90 LCPKMFTNT   98 (100)
Q Consensus        90 ~C~~~f~~~   98 (100)
                      .|++.|.+.
T Consensus       104 ~CgK~F~~~  112 (128)
T PHA00733        104 VCGKEFRNT  112 (128)
T ss_pred             CCCCccCCH
Confidence            888888764


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.26  E-value=6.2e-12  Score=48.83  Aligned_cols=26  Identities=35%  Similarity=0.698  Sum_probs=23.0

Q ss_pred             HHHHHHHhcCCCCCeecCCCccccCC
Q psy14147         72 SLIVHKQRHDNTPRFKCKLCPKMFTN   97 (100)
Q Consensus        72 ~l~~h~~~~~~~~~~~C~~C~~~f~~   97 (100)
                      +|..|++.|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47889999999999999999999874


No 12 
>KOG3608|consensus
Probab=99.26  E-value=9.7e-12  Score=74.51  Aligned_cols=85  Identities=26%  Similarity=0.399  Sum_probs=60.5

Q ss_pred             cchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCC
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      +.-+-+.|.++..|..|++.|-  .-|.|+.|+.+.+..++|..|++..|...+||.|..|...+...++|+.|...|. 
T Consensus       240 C~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-  316 (467)
T KOG3608|consen  240 CAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-  316 (467)
T ss_pred             HHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-
Confidence            3456778888888888887764  3477777777777777777777766777777777777777777777777776665 


Q ss_pred             CCCeecCC
Q psy14147         83 TPRFKCKL   90 (100)
Q Consensus        83 ~~~~~C~~   90 (100)
                      +-.|.|..
T Consensus       317 ~~~y~C~h  324 (467)
T KOG3608|consen  317 KTVYQCEH  324 (467)
T ss_pred             ccceecCC
Confidence            34455543


No 13 
>KOG1074|consensus
Probab=99.22  E-value=2e-12  Score=84.08  Aligned_cols=90  Identities=24%  Similarity=0.448  Sum_probs=70.3

Q ss_pred             HHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCC----CccCc---cccccccChhHHHHHHHh
Q psy14147          7 EVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDR----RYQCD---LCLARFVTNSSLIVHKQR   79 (100)
Q Consensus         7 ~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~----~~~c~---~c~~~~~~~~~l~~h~~~   79 (100)
                      -++..=++.|+.|.++|.+++||+|.+||++|.++.+|..|+ ..|....    .+.|+   +|.+.|...-.|..|.+.
T Consensus       612 ~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIri  690 (958)
T KOG1074|consen  612 LRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRI  690 (958)
T ss_pred             eecccchhhhhhhhhcccCcCccccccccchhccccchhhcc-cccccCccccccccCCchhhhcccccccccccceEEe
Confidence            344455688999999999999999999999999999999999 5776543    36788   888889888889999998


Q ss_pred             cCCC-CC------------eecCCCccccCC
Q psy14147         80 HDNT-PR------------FKCKLCPKMFTN   97 (100)
Q Consensus        80 ~~~~-~~------------~~C~~C~~~f~~   97 (100)
                      |.+. .+            -+|..|.+.|.+
T Consensus       691 H~~~~~s~g~~a~e~~~~adq~~~~qk~~~~  721 (958)
T KOG1074|consen  691 HLGGQISNGGTAAEGILAADQCSSCQKTFSD  721 (958)
T ss_pred             ecCCCCCCCcccccccchhcccchhhhcccc
Confidence            8732 11            357777777643


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.17  E-value=1.9e-11  Score=77.73  Aligned_cols=88  Identities=15%  Similarity=0.253  Sum_probs=70.4

Q ss_pred             cchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccC----------hhH
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVT----------NSS   72 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~----------~~~   72 (100)
                      +..|+..|. ...|..|+..++  +++.|+ |+..+ ....|..|+ ..|.+.+++.|+.|+..+..          ...
T Consensus       456 C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~-~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~  529 (567)
T PLN03086        456 CEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQ-ASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRG  529 (567)
T ss_pred             CCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhh-hccCCCCceeCCCCCCccccCccccchhhhhhh
Confidence            455677775 577899998874  789999 99755 568899998 48888999999999988742          347


Q ss_pred             HHHHHHhcCCCCCeecCCCccccCC
Q psy14147         73 LIVHKQRHDNTPRFKCKLCPKMFTN   97 (100)
Q Consensus        73 l~~h~~~~~~~~~~~C~~C~~~f~~   97 (100)
                      |..|.... |.+++.|..||+.+..
T Consensus       530 Lt~HE~~C-G~rt~~C~~Cgk~Vrl  553 (567)
T PLN03086        530 MSEHESIC-GSRTAPCDSCGRSVML  553 (567)
T ss_pred             HHHHHHhc-CCcceEccccCCeeee
Confidence            88888875 8899999999998764


No 15 
>PHA00733 hypothetical protein
Probab=99.13  E-value=1.5e-10  Score=61.37  Aligned_cols=65  Identities=25%  Similarity=0.433  Sum_probs=53.5

Q ss_pred             HHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCC
Q psy14147         14 DVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus        14 ~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      +.|.+|+..+ +.+||.|+.|++.|.....|..|++ .+  ..++.|..|+++|.....|..|....++
T Consensus        60 ~~l~~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r-~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         60 SYLYKLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIR-YT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHhhcccC-CCCCccCCCCCCcCCCHHHHHHHHh-cC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3455565554 4889999999999999999999984 54  3579999999999999999999886554


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.04  E-value=9.8e-11  Score=52.65  Aligned_cols=42  Identities=24%  Similarity=0.461  Sum_probs=36.9

Q ss_pred             eeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHH
Q psy14147         29 YACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSL   73 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l   73 (100)
                      |.|+.||+.|.....|..|++ .|.  +++.|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r-~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLR-KHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHH-hcC--CcccCCcccceeccccee
Confidence            789999999999999999995 787  688999999999876554


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.95  E-value=1.3e-10  Score=45.05  Aligned_cols=24  Identities=33%  Similarity=0.634  Sum_probs=13.6

Q ss_pred             HHhccccccCCCceeCchhhhhcc
Q psy14147         16 VQSFPIILYCVKPYACEECGKAFR   39 (100)
Q Consensus        16 l~~h~~~~~~~~~~~c~~C~~~f~   39 (100)
                      |..|+++|.+++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            455555555555555555555553


No 18 
>PHA00616 hypothetical protein
Probab=98.83  E-value=2.2e-09  Score=46.12  Aligned_cols=33  Identities=21%  Similarity=0.348  Sum_probs=17.6

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCK   89 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~   89 (100)
                      ||+|+.||+.|...+.+..|++.|++++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            345555555555555555555555555555443


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.81  E-value=8.8e-09  Score=65.96  Aligned_cols=65  Identities=23%  Similarity=0.544  Sum_probs=55.0

Q ss_pred             CCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         26 VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      ++.+.|..|++.|. ...|..|+. .+.  .++.|+ |+..+ ....|..|+..|..++|+.|+.|++.|.
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~-~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~  515 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMK-VFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQ  515 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHH-hcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccc
Confidence            35578999999996 577999995 553  689999 99755 6689999999999999999999999884


No 20 
>PHA00732 hypothetical protein
Probab=98.61  E-value=4e-08  Score=47.91  Aligned_cols=49  Identities=24%  Similarity=0.453  Sum_probs=37.8

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCC
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      ||.|..|++.|.....|..|++..|.   ++.|+.|++.|..   +..|.++..+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhcccCC
Confidence            57899999999999999999842354   3579999999874   6678765443


No 21 
>PHA00732 hypothetical protein
Probab=98.56  E-value=4.5e-08  Score=47.71  Aligned_cols=33  Identities=12%  Similarity=0.162  Sum_probs=17.9

Q ss_pred             chHHHHHHHHHHHHhcccc-ccCCCceeCchhhhhcc
Q psy14147          4 RSREVMEIQKDVVQSFPII-LYCVKPYACEECGKAFR   39 (100)
Q Consensus         4 ~~~~~~~~~~~~l~~h~~~-~~~~~~~~c~~C~~~f~   39 (100)
                      ..++..|.....|..|++. |.   ++.|+.|++.|.
T Consensus         5 ~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~   38 (79)
T PHA00732          5 PICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR   38 (79)
T ss_pred             CCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC
Confidence            4455556666666666553 32   235666666655


No 22 
>PHA00616 hypothetical protein
Probab=98.54  E-value=6e-08  Score=41.72  Aligned_cols=36  Identities=25%  Similarity=0.437  Sum_probs=31.2

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCCCCccCcccc
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCL   64 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~   64 (100)
                      ||+|..||+.|.....|..|++ .|++..++.++.--
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r-~~hg~~~~~~~~~y   36 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLL-SVHKQNKLTLEYFY   36 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHH-HhcCCCccceeEEE
Confidence            6899999999999999999995 88888998886543


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.30  E-value=1.6e-06  Score=39.36  Aligned_cols=51  Identities=27%  Similarity=0.541  Sum_probs=39.2

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCC-CCccCccccccccChhHHHHHHHhcC
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLND-RRYQCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~~~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                      .|.|+.|++ ..+...|..|....|..+ +.+.|++|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            488999999 566778999987677764 4688999987643  48888887654


No 24 
>KOG3993|consensus
Probab=98.17  E-value=2.6e-07  Score=57.09  Aligned_cols=69  Identities=26%  Similarity=0.632  Sum_probs=37.2

Q ss_pred             eeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcC---------------------------
Q psy14147         29 YACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHD---------------------------   81 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~---------------------------   81 (100)
                      |.|..|...|.+.-.|..|.. ...--.-|.|++|++.|.-..+|.+|.|.|.                           
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC-~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRC-PRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccC-CeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            455555555555555544441 2222223455555555555555555555431                           


Q ss_pred             ------CCCCeecCCCccccCCC
Q psy14147         82 ------NTPRFKCKLCPKMFTNT   98 (100)
Q Consensus        82 ------~~~~~~C~~C~~~f~~~   98 (100)
                            .+..|.|..|+|.|..+
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRq  369 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQ  369 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHH
Confidence                  12358999999999753


No 25 
>KOG3993|consensus
Probab=98.13  E-value=2.1e-06  Score=53.20  Aligned_cols=79  Identities=20%  Similarity=0.317  Sum_probs=63.2

Q ss_pred             ccchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCC---------------------------
Q psy14147          2 VVRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLN---------------------------   54 (100)
Q Consensus         2 ~~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~---------------------------   54 (100)
                      +++-|...|...-.|-+|.-..-..-.|+|..|++.|...++|..|.+. |..                           
T Consensus       269 iCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRW-HKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  269 ICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRW-HKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcc-cCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            3667888899999999997543344569999999999999999999862 311                           


Q ss_pred             ------CCCccCccccccccChhHHHHHHHhcC
Q psy14147         55 ------DRRYQCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus        55 ------~~~~~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                            +..|.|..|++.|.....|..|+.+|.
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                  124789999999999999999987765


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.99  E-value=4.5e-06  Score=31.04  Aligned_cols=21  Identities=48%  Similarity=0.926  Sum_probs=14.0

Q ss_pred             eeCchhhhhccChhHHHHHHh
Q psy14147         29 YACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      |.|+.|++.|.....|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            456677777777777766663


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.98  E-value=4.4e-06  Score=31.06  Aligned_cols=23  Identities=39%  Similarity=0.833  Sum_probs=20.7

Q ss_pred             ccCccccccccChhHHHHHHHhc
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRH   80 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~   80 (100)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57999999999999999998864


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.84  E-value=1.1e-05  Score=31.14  Aligned_cols=21  Identities=43%  Similarity=1.028  Sum_probs=14.7

Q ss_pred             ceeCchhhhhccChhHHHHHH
Q psy14147         28 PYACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~   48 (100)
                      ||.|..|++.|.....|..|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCccCCccCChhHHHHHh
Confidence            466777777777777777776


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.84  E-value=1.6e-05  Score=29.53  Aligned_cols=21  Identities=48%  Similarity=0.959  Sum_probs=12.0

Q ss_pred             eeCchhhhhccChhHHHHHHh
Q psy14147         29 YACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      |.|++|+..|.+...|..|+.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMR   21 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHH
Confidence            456666666666666666663


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.81  E-value=1.3e-05  Score=30.97  Aligned_cols=26  Identities=35%  Similarity=0.609  Sum_probs=22.9

Q ss_pred             CccCccccccccChhHHHHHHHhcCC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      +|.|..|++.|.....|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57899999999999999999987753


No 31 
>PRK04860 hypothetical protein; Provisional
Probab=97.81  E-value=1.5e-05  Score=43.92  Aligned_cols=37  Identities=16%  Similarity=0.535  Sum_probs=32.0

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccCC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTN   97 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   97 (100)
                      +|.|. |+.   ....+..|.++++++++|.|..|++.|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            58897 887   56678899999999999999999998864


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.78  E-value=7.1e-06  Score=49.38  Aligned_cols=63  Identities=25%  Similarity=0.493  Sum_probs=36.4

Q ss_pred             CCceeCch--hhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccccCCC
Q psy14147         26 VKPYACEE--CGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNT   98 (100)
Q Consensus        26 ~~~~~c~~--C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   98 (100)
                      +|||+|++  |.+.++....|..|+..-|-..+...-+          .-..+.-.-...+||.|+.|+|.|.+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p----------~p~~~~~F~~~~KPYrCevC~KRYKNl  411 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP----------SPEKMNIFSAKDKPYRCEVCDKRYKNL  411 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC----------CccccccccccCCceeccccchhhccC
Confidence            48899987  8888988888888874222111111111          000011112346788888888887653


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.77  E-value=2.3e-05  Score=29.11  Aligned_cols=24  Identities=33%  Similarity=0.695  Sum_probs=19.2

Q ss_pred             ccCccccccccChhHHHHHHHhcC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                      |.|+.|++.|.....|..|+..++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            579999999999999999998753


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.71  E-value=3e-05  Score=39.15  Aligned_cols=71  Identities=13%  Similarity=0.021  Sum_probs=21.3

Q ss_pred             chHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhc
Q psy14147          4 RSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRH   80 (100)
Q Consensus         4 ~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~   80 (100)
                      ..|+..|.....|..|+...++...   . ....+.....+..+.. .. -...+.|..|+..|.....|..|++.+
T Consensus         3 ~~C~~~f~~~~~l~~H~~~~H~~~~---~-~~~~l~~~~~~~~~~~-~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    3 LFCDESFSSVDDLLQHMKKKHGFDI---P-DQKYLVDPNRLLNYLR-KK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccc---c-cccccccccccccccc-cc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3467778888888888754333211   1 1111222223333331 11 122689999999999999999999964


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.68  E-value=2.6e-05  Score=47.03  Aligned_cols=25  Identities=20%  Similarity=0.620  Sum_probs=21.0

Q ss_pred             CCCCccCcc--ccccccChhHHHHHHH
Q psy14147         54 NDRRYQCDL--CLARFVTNSSLIVHKQ   78 (100)
Q Consensus        54 ~~~~~~c~~--c~~~~~~~~~l~~h~~   78 (100)
                      +++||.|++  |.+.+...-.|..|+.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~l  372 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHML  372 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhh
Confidence            358999977  8899998888988876


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.60  E-value=8.2e-05  Score=32.90  Aligned_cols=32  Identities=16%  Similarity=0.241  Sum_probs=16.4

Q ss_pred             CCCCccCccccccccChhHHHHHHHhcCCCCC
Q psy14147         54 NDRRYQCDLCLARFVTNSSLIVHKQRHDNTPR   85 (100)
Q Consensus        54 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   85 (100)
                      .+.|..|++|+..+.+..+|..|+...++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            34456666666666666666666666555544


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.31  E-value=0.00032  Score=26.22  Aligned_cols=19  Identities=47%  Similarity=0.943  Sum_probs=10.8

Q ss_pred             eCchhhhhccChhHHHHHH
Q psy14147         30 ACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        30 ~c~~C~~~f~~~~~l~~h~   48 (100)
                      .|..|++.|.....+..|+
T Consensus         2 ~C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        2 RCPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCCcchhCCHHHHHHHH
Confidence            4555555555555555555


No 38 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.21  E-value=0.00053  Score=30.99  Aligned_cols=39  Identities=28%  Similarity=0.665  Sum_probs=29.4

Q ss_pred             CccCccccccccChhHHHHHHHh-cCC-CCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQR-HDN-TPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~-~~~-~~~~~C~~C~~~f~   96 (100)
                      .|.|+.|++.| ....|..|... |.. .+.+.||.|...+.
T Consensus         2 ~f~CP~C~~~~-~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~   42 (54)
T PF05605_consen    2 SFTCPYCGKGF-SESSLVEHCEDEHRSESKNVVCPICSSRVT   42 (54)
T ss_pred             CcCCCCCCCcc-CHHHHHHHHHhHCcCCCCCccCCCchhhhh
Confidence            47899999954 56789999774 444 35789999987654


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.06  E-value=0.00054  Score=25.55  Aligned_cols=24  Identities=33%  Similarity=0.629  Sum_probs=20.8

Q ss_pred             ccCccccccccChhHHHHHHHhcC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                      +.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            478999999999999999988664


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.00  E-value=0.0012  Score=29.27  Aligned_cols=33  Identities=21%  Similarity=0.435  Sum_probs=22.1

Q ss_pred             cCCCceeCchhhhhccChhHHHHHHhhhcCCCCC
Q psy14147         24 YCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRR   57 (100)
Q Consensus        24 ~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~   57 (100)
                      ..+.|..|++|+..+....+|..|+. ...+.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle-~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLE-IRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHH-HHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHH-HHhcccC
Confidence            45788999999999999999999995 5555543


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.95  E-value=0.00046  Score=25.93  Aligned_cols=20  Identities=35%  Similarity=0.750  Sum_probs=10.4

Q ss_pred             eeCchhhhhccChhHHHHHH
Q psy14147         29 YACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~   48 (100)
                      |.|.+|+..|.+...+..|+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCCcCCHHHHHHHH
Confidence            34555555555555555554


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.82  E-value=0.00082  Score=25.21  Aligned_cols=23  Identities=30%  Similarity=0.691  Sum_probs=20.4

Q ss_pred             ccCccccccccChhHHHHHHHhc
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRH   80 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~   80 (100)
                      |.|.+|+..|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999998754


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.75  E-value=0.0012  Score=36.64  Aligned_cols=38  Identities=29%  Similarity=0.746  Sum_probs=31.6

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccCh
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTN   70 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~   70 (100)
                      +|.|. |+.   ...++..|.+ ++.+..+|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~r-i~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNR-VVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHH-HhcCCccEECCCCCceeEEe
Confidence            59998 987   5667889994 99999999999999887543


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.34  E-value=0.0026  Score=23.61  Aligned_cols=19  Identities=32%  Similarity=0.621  Sum_probs=8.0

Q ss_pred             eeCchhhhhccChhHHHHHH
Q psy14147         29 YACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~   48 (100)
                      |.|..|+.... ...|..|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~   19 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHL   19 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHH
Confidence            34555554444 44455554


No 45 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.25  E-value=0.0051  Score=30.87  Aligned_cols=23  Identities=35%  Similarity=0.775  Sum_probs=20.3

Q ss_pred             CceeCchhhhhccChhHHHHHHh
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      ..+.|..|+..|.....|..|++
T Consensus        49 ~~~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             SSEEBSSSS-EESSHHHHHHHHH
T ss_pred             CCCCCCccCCCCcCHHHHHHHHc
Confidence            36999999999999999999995


No 46 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.11  E-value=0.0019  Score=24.79  Aligned_cols=20  Identities=30%  Similarity=0.717  Sum_probs=14.4

Q ss_pred             eeCchhhhhccChhHHHHHH
Q psy14147         29 YACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~   48 (100)
                      |.|..|++.|.+...+..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            56777777777777776666


No 47 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.89  E-value=0.0048  Score=24.94  Aligned_cols=8  Identities=25%  Similarity=0.982  Sum_probs=3.7

Q ss_pred             CeecCCCc
Q psy14147         85 RFKCKLCP   92 (100)
Q Consensus        85 ~~~C~~C~   92 (100)
                      ++.|+.||
T Consensus        17 ~~~CP~Cg   24 (33)
T cd00350          17 PWVCPVCG   24 (33)
T ss_pred             CCcCcCCC
Confidence            44444444


No 48 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.33  E-value=0.015  Score=23.45  Aligned_cols=21  Identities=24%  Similarity=0.621  Sum_probs=13.2

Q ss_pred             ceeCchhhhhccChhHHHHHH
Q psy14147         28 PYACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~   48 (100)
                      +|.|..|+..|.....+..|+
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHHHHHHHH
Confidence            456666666666666665555


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.20  E-value=0.023  Score=21.40  Aligned_cols=18  Identities=28%  Similarity=0.672  Sum_probs=8.8

Q ss_pred             cCccccccccChhHHHHHH
Q psy14147         59 QCDLCLARFVTNSSLIVHK   77 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~   77 (100)
                      .|+.|++.| ....|..|.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            355555555 333444444


No 50 
>KOG1146|consensus
Probab=94.87  E-value=0.027  Score=40.43  Aligned_cols=71  Identities=23%  Similarity=0.409  Sum_probs=48.7

Q ss_pred             HHHHHHHHHhcc-ccccCCCceeCchhhhhccChhHHHHHHhhhcC------------------------CCCCccCccc
Q psy14147          9 MEIQKDVVQSFP-IILYCVKPYACEECGKAFRKKFSLTMHQRHVHL------------------------NDRRYQCDLC   63 (100)
Q Consensus         9 ~~~~~~~l~~h~-~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~------------------------~~~~~~c~~c   63 (100)
                      .+..+..+--|. ..+...+.+.|+.|+..|+....|.-|++..|.                        +.++|.|..|
T Consensus       445 ~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C  524 (1406)
T KOG1146|consen  445 LLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRAC  524 (1406)
T ss_pred             hhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceee
Confidence            333444444443 334455778899999999988888888864332                        2456788888


Q ss_pred             cccccChhHHHHHHHh
Q psy14147         64 LARFVTNSSLIVHKQR   79 (100)
Q Consensus        64 ~~~~~~~~~l~~h~~~   79 (100)
                      ...+.....|..|+..
T Consensus       525 ~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  525 NYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             eeeeecchHHHHHHHH
Confidence            8888888888888763


No 51 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.27  E-value=0.044  Score=24.79  Aligned_cols=29  Identities=21%  Similarity=0.308  Sum_probs=23.4

Q ss_pred             ccccCCCceeCchhhhhccChhHHHHHHh
Q psy14147         21 IILYCVKPYACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        21 ~~~~~~~~~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      ++..++..+.|+.|+..|....++..|.-
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhh
Confidence            34557778899999999998888888874


No 52 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.41  E-value=0.082  Score=27.49  Aligned_cols=13  Identities=23%  Similarity=0.488  Sum_probs=7.1

Q ss_pred             CccCccccccccC
Q psy14147         57 RYQCDLCLARFVT   69 (100)
Q Consensus        57 ~~~c~~c~~~~~~   69 (100)
                      |..|+.||..|..
T Consensus        26 PivCP~CG~~~~~   38 (108)
T PF09538_consen   26 PIVCPKCGTEFPP   38 (108)
T ss_pred             CccCCCCCCccCc
Confidence            4456666655543


No 53 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.25  E-value=0.053  Score=24.89  Aligned_cols=33  Identities=12%  Similarity=0.356  Sum_probs=19.4

Q ss_pred             CCCccCccccccccChhHHHHHHHhcCCCCCeecCCCc
Q psy14147         55 DRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCP   92 (100)
Q Consensus        55 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~   92 (100)
                      ...|.|+.||...-.+     -.+-..-..+|.|+.||
T Consensus        25 ~v~F~CPnCGe~~I~R-----c~~CRk~g~~Y~Cp~CG   57 (61)
T COG2888          25 AVKFPCPNCGEVEIYR-----CAKCRKLGNPYRCPKCG   57 (61)
T ss_pred             eeEeeCCCCCceeeeh-----hhhHHHcCCceECCCcC
Confidence            3457888888553222     11222234579999887


No 54 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.24  E-value=0.095  Score=21.69  Aligned_cols=32  Identities=22%  Similarity=0.603  Sum_probs=15.4

Q ss_pred             cCccccccccChhHHHHHHHhcCCCCCeecCCCcccc
Q psy14147         59 QCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMF   95 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   95 (100)
                      .|+.|+..|.-...     +...+.....|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            45556555544322     112233445666666555


No 55 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.05  E-value=0.056  Score=21.98  Aligned_cols=8  Identities=38%  Similarity=1.219  Sum_probs=4.2

Q ss_pred             eeCchhhh
Q psy14147         29 YACEECGK   36 (100)
Q Consensus        29 ~~c~~C~~   36 (100)
                      |.|..||.
T Consensus         3 ~~C~~CG~   10 (34)
T cd00729           3 WVCPVCGY   10 (34)
T ss_pred             EECCCCCC
Confidence            45555553


No 56 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.55  E-value=0.022  Score=35.70  Aligned_cols=63  Identities=29%  Similarity=0.469  Sum_probs=46.1

Q ss_pred             CceeCchhhhhccChhHHHHHHhh-hcCCC--CCccCc--cccccccChhHHHHHHHhcCCCCCeecC
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRH-VHLND--RRYQCD--LCLARFVTNSSLIVHKQRHDNTPRFKCK   89 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~-~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~C~   89 (100)
                      .++.|..|...|.....+..|.+. .|.++  .++.|+  .|++.|.....+..|...|.+..++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            356777788888888888888732 57777  788887  6888888877777777777776665553


No 57 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=92.39  E-value=0.15  Score=20.97  Aligned_cols=32  Identities=19%  Similarity=0.572  Sum_probs=15.7

Q ss_pred             cCccccccccChhHHHHHHHhcCCCCCeecCCCcccc
Q psy14147         59 QCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMF   95 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   95 (100)
                      .|+.|+..|.-....     ........+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            455566555443221     22333445666666655


No 58 
>KOG2893|consensus
Probab=92.38  E-value=0.03  Score=33.08  Aligned_cols=42  Identities=24%  Similarity=0.674  Sum_probs=28.0

Q ss_pred             eCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHH
Q psy14147         30 ACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVH   76 (100)
Q Consensus        30 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h   76 (100)
                      .|..|.+.|....-|+.|++     .+-|.|-+|.+.+.+-..|..|
T Consensus        12 wcwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            47788888888888887774     3456788887654443334444


No 59 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=92.23  E-value=0.13  Score=21.23  Aligned_cols=11  Identities=18%  Similarity=0.893  Sum_probs=6.4

Q ss_pred             CeecCCCcccc
Q psy14147         85 RFKCKLCPKMF   95 (100)
Q Consensus        85 ~~~C~~C~~~f   95 (100)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~~   35 (38)
T TIGR02098        25 KVRCGKCGHVW   35 (38)
T ss_pred             EEECCCCCCEE
Confidence            35566666555


No 60 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.23  E-value=0.14  Score=26.77  Aligned_cols=66  Identities=21%  Similarity=0.444  Sum_probs=36.0

Q ss_pred             CceeCchhhhhccChhHHHHHHhhhcC-CCCCc------------cCccccccccChhHHHHHHHhcCCCCCeecCCCcc
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRHVHL-NDRRY------------QCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPK   93 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~~~~-~~~~~------------~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   93 (100)
                      -|..|++|+-+......|.+..  .|. .-++|            .|-.|...|........  ..-.....|.|+.|..
T Consensus        14 LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~   89 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSY--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKN   89 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhh--hccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCC
Confidence            4677888888877777776554  121 11112            26667766654321110  0012234688888887


Q ss_pred             ccC
Q psy14147         94 MFT   96 (100)
Q Consensus        94 ~f~   96 (100)
                      .|-
T Consensus        90 ~FC   92 (112)
T TIGR00622        90 VFC   92 (112)
T ss_pred             ccc
Confidence            763


No 61 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.13  E-value=0.09  Score=29.44  Aligned_cols=10  Identities=20%  Similarity=0.591  Sum_probs=4.7

Q ss_pred             CCCccCcccc
Q psy14147         55 DRRYQCDLCL   64 (100)
Q Consensus        55 ~~~~~c~~c~   64 (100)
                      +.|..||+|+
T Consensus       147 e~P~~CPiCg  156 (166)
T COG1592         147 EAPEVCPICG  156 (166)
T ss_pred             CCCCcCCCCC
Confidence            3444455554


No 62 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=91.92  E-value=0.025  Score=31.24  Aligned_cols=11  Identities=36%  Similarity=0.745  Sum_probs=5.4

Q ss_pred             ccCcccccccc
Q psy14147         58 YQCDLCLARFV   68 (100)
Q Consensus        58 ~~c~~c~~~~~   68 (100)
                      ++|+.||++|.
T Consensus        29 ~~c~~c~~~f~   39 (154)
T PRK00464         29 RECLACGKRFT   39 (154)
T ss_pred             eeccccCCcce
Confidence            44555555443


No 63 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=91.30  E-value=0.099  Score=19.54  Aligned_cols=10  Identities=30%  Similarity=0.607  Sum_probs=6.7

Q ss_pred             CCeecCCCcc
Q psy14147         84 PRFKCKLCPK   93 (100)
Q Consensus        84 ~~~~C~~C~~   93 (100)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4577777763


No 64 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.48  E-value=0.028  Score=32.72  Aligned_cols=22  Identities=32%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             CCceeCchhhhhccChhHHHHH
Q psy14147         26 VKPYACEECGKAFRKKFSLTMH   47 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h   47 (100)
                      .+...|++|++.|.........
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~   24 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGK   24 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCC
Confidence            3567899999999877544333


No 65 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.08  E-value=0.24  Score=21.37  Aligned_cols=10  Identities=50%  Similarity=1.298  Sum_probs=5.6

Q ss_pred             eeCchhhhhc
Q psy14147         29 YACEECGKAF   38 (100)
Q Consensus        29 ~~c~~C~~~f   38 (100)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            5566666554


No 66 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=89.95  E-value=0.54  Score=26.15  Aligned_cols=12  Identities=25%  Similarity=0.478  Sum_probs=5.4

Q ss_pred             CccCcccccccc
Q psy14147         57 RYQCDLCLARFV   68 (100)
Q Consensus        57 ~~~c~~c~~~~~   68 (100)
                      -|.|+.|+..|+
T Consensus       109 ~Y~Cp~c~~r~t  120 (158)
T TIGR00373       109 FFICPNMCVRFT  120 (158)
T ss_pred             eEECCCCCcEee
Confidence            344544444443


No 67 
>KOG2186|consensus
Probab=89.50  E-value=0.26  Score=29.44  Aligned_cols=52  Identities=21%  Similarity=0.395  Sum_probs=37.4

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCCC
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNT   83 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~   83 (100)
                      .|.|..||.+..-. .+..|+. ..++ .-|.|..|+..|.. .....|..--++.
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~s-rCrn-~~fSCIDC~k~F~~-~sYknH~kCITEa   54 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMS-RCRN-AYFSCIDCGKTFER-VSYKNHTKCITEA   54 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHH-hccC-CeeEEeeccccccc-chhhhhhhhcchH
Confidence            47899999877644 4667884 5555 57899999999987 4566676644433


No 68 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=89.39  E-value=0.38  Score=28.75  Aligned_cols=57  Identities=23%  Similarity=0.562  Sum_probs=30.7

Q ss_pred             CCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         26 VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      ...|.|..|...+        ..+ .-.......|..|.+.|.-...   ....  |---|.|+.|+..|.
T Consensus       110 drqFaC~~Cd~~W--------wRr-vp~rKeVSRCr~C~~rYDPVP~---dkmw--G~aef~C~~C~h~F~  166 (278)
T PF15135_consen  110 DRQFACSSCDHMW--------WRR-VPQRKEVSRCRKCRKRYDPVPC---DKMW--GIAEFHCPKCRHNFR  166 (278)
T ss_pred             ceeeeccccchHH--------Hhc-cCcccccccccccccccCCCcc---cccc--ceeeeecccccccch
Confidence            3679999996543        121 2222234467777766644321   1111  122378888888775


No 69 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=89.37  E-value=0.76  Score=25.21  Aligned_cols=13  Identities=23%  Similarity=0.858  Sum_probs=7.5

Q ss_pred             CCccCcccccccc
Q psy14147         56 RRYQCDLCLARFV   68 (100)
Q Consensus        56 ~~~~c~~c~~~~~   68 (100)
                      .-|.|+.|+..|.
T Consensus        98 ~~Y~Cp~C~~~y~  110 (147)
T smart00531       98 AYYKCPNCQSKYT  110 (147)
T ss_pred             cEEECcCCCCEee
Confidence            3456666665554


No 70 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.00  E-value=0.18  Score=31.60  Aligned_cols=44  Identities=27%  Similarity=0.532  Sum_probs=38.6

Q ss_pred             CCccCccccccccChhHHHHHHH--hcCCC--CCeecC--CCccccCCCC
Q psy14147         56 RRYQCDLCLARFVTNSSLIVHKQ--RHDNT--PRFKCK--LCPKMFTNTV   99 (100)
Q Consensus        56 ~~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~f~~~~   99 (100)
                      .++.|..|...|.....+..|.+  .|+++  +|+.|+  .|++.|....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~  337 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRND  337 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccc
Confidence            35788889999999999999999  79999  999999  7999998653


No 71 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=88.91  E-value=0.084  Score=25.38  Aligned_cols=9  Identities=33%  Similarity=0.689  Sum_probs=4.3

Q ss_pred             eCchhhhhc
Q psy14147         30 ACEECGKAF   38 (100)
Q Consensus        30 ~c~~C~~~f   38 (100)
                      .|+.|+...
T Consensus         3 ~CP~Cg~~a   11 (72)
T PRK09678          3 HCPLCQHAA   11 (72)
T ss_pred             cCCCCCCcc
Confidence            455555433


No 72 
>KOG4173|consensus
Probab=88.44  E-value=0.63  Score=27.12  Aligned_cols=70  Identities=23%  Similarity=0.240  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhc---------CCCCCccCcc--ccccccChhHHH
Q psy14147          6 REVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVH---------LNDRRYQCDL--CLARFVTNSSLI   74 (100)
Q Consensus         6 ~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~---------~~~~~~~c~~--c~~~~~~~~~l~   74 (100)
                      +-.+|...+....|..+.++   ..|..|.+.|++..-|..|+...|         .|...|+|-+  |+-.|.....-.
T Consensus        87 c~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~Rk  163 (253)
T KOG4173|consen   87 CCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRK  163 (253)
T ss_pred             hHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhh
Confidence            34556666666667654443   248888888888888877774222         2344567743  776676666555


Q ss_pred             HHHH
Q psy14147         75 VHKQ   78 (100)
Q Consensus        75 ~h~~   78 (100)
                      .|+-
T Consensus       164 dH~I  167 (253)
T KOG4173|consen  164 DHMI  167 (253)
T ss_pred             hHHH
Confidence            5543


No 73 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=88.32  E-value=0.88  Score=25.88  Aligned_cols=16  Identities=19%  Similarity=0.390  Sum_probs=9.1

Q ss_pred             CCceeCchhhhhccCh
Q psy14147         26 VKPYACEECGKAFRKK   41 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~   41 (100)
                      ..-|.|+.|+..|+..
T Consensus       115 ~~~Y~Cp~C~~rytf~  130 (178)
T PRK06266        115 NMFFFCPNCHIRFTFD  130 (178)
T ss_pred             CCEEECCCCCcEEeHH
Confidence            3456666666655543


No 74 
>KOG2186|consensus
Probab=88.26  E-value=0.36  Score=28.88  Aligned_cols=43  Identities=23%  Similarity=0.455  Sum_probs=27.5

Q ss_pred             HHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCc
Q psy14147         13 KDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRY   58 (100)
Q Consensus        13 ~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~   58 (100)
                      +-.+..|+-...+ .-|.|..|++.|.. .++..|.. .-+....|
T Consensus        15 Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k-CITEaQKY   57 (276)
T KOG2186|consen   15 KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK-CITEAQKY   57 (276)
T ss_pred             ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhh-hcchHHHh
Confidence            3456667655444 66899999999988 55667763 44433333


No 75 
>KOG2893|consensus
Probab=88.15  E-value=0.08  Score=31.34  Aligned_cols=44  Identities=18%  Similarity=0.239  Sum_probs=32.6

Q ss_pred             HHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcC
Q psy14147          6 REVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHL   53 (100)
Q Consensus         6 ~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~   53 (100)
                      |+..|..+..|.+|++.    |-|+|.+|.+..-+--.|..|-.++|.
T Consensus        16 cnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   16 CNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             cccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            56678899999999864    558999999877666666666545554


No 76 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.81  E-value=0.47  Score=25.40  Aligned_cols=30  Identities=23%  Similarity=0.341  Sum_probs=18.0

Q ss_pred             eeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccCh
Q psy14147         29 YACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTN   70 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~   70 (100)
                      ..|..||+.|-.            .+..|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD------------Lnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD------------LNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc------------cCCCCccCCCcCCccCcc
Confidence            567777776621            122466777787766444


No 77 
>PF14353 CpXC:  CpXC protein
Probab=87.28  E-value=0.72  Score=24.54  Aligned_cols=8  Identities=50%  Similarity=1.543  Sum_probs=4.1

Q ss_pred             Cchhhhhc
Q psy14147         31 CEECGKAF   38 (100)
Q Consensus        31 c~~C~~~f   38 (100)
                      |+.|+..|
T Consensus         4 CP~C~~~~   11 (128)
T PF14353_consen    4 CPHCGHEF   11 (128)
T ss_pred             CCCCCCee
Confidence            55555444


No 78 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.08  E-value=0.24  Score=22.76  Aligned_cols=34  Identities=12%  Similarity=0.343  Sum_probs=19.1

Q ss_pred             CCCccCccccccccChhHHHHHHHhcCCCCCeecCCCcc
Q psy14147         55 DRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPK   93 (100)
Q Consensus        55 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   93 (100)
                      ...|.|+.||...-.+-  ..   -..-..+|.|+.||-
T Consensus        23 ~~~F~CPnCG~~~I~RC--~~---CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         23 AVKFLCPNCGEVIIYRC--EK---CRKQSNPYTCPKCGF   56 (59)
T ss_pred             cCEeeCCCCCCeeEeec--hh---HHhcCCceECCCCCC
Confidence            34678888886522221  11   112245789998883


No 79 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=86.84  E-value=0.35  Score=18.38  Aligned_cols=10  Identities=30%  Similarity=0.580  Sum_probs=6.3

Q ss_pred             ecCCCccccC
Q psy14147         87 KCKLCPKMFT   96 (100)
Q Consensus        87 ~C~~C~~~f~   96 (100)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4666776664


No 80 
>KOG1146|consensus
Probab=86.80  E-value=0.59  Score=34.26  Aligned_cols=48  Identities=15%  Similarity=0.143  Sum_probs=40.4

Q ss_pred             ccchHHHHHHHHHHHHhccccc-------------------------cCCCceeCchhhhhccChhHHHHHHh
Q psy14147          2 VVRSREVMEIQKDVVQSFPIIL-------------------------YCVKPYACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus         2 ~~~~~~~~~~~~~~l~~h~~~~-------------------------~~~~~~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      +++.++.+|.....|..|+|.-                         .+.++|.|..|..++....+|..|+.
T Consensus       467 ~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  467 KCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            4788999999999999999871                         11377999999999999899988884


No 81 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.48  E-value=0.36  Score=20.05  Aligned_cols=11  Identities=27%  Similarity=1.008  Sum_probs=8.6

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      |.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            67888888774


No 82 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=85.66  E-value=0.62  Score=20.65  Aligned_cols=36  Identities=19%  Similarity=0.425  Sum_probs=21.0

Q ss_pred             CceeCchhhhhccChhHHHHHHhhhcCC--CCCccCcccc
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRHVHLN--DRRYQCDLCL   64 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~~~~~--~~~~~c~~c~   64 (100)
                      +.+.|..||..|...+.-+.... . .|  ..|-.|+.|.
T Consensus         3 k~l~C~dCg~~FvfTa~EQ~fy~-e-Kgf~n~p~RC~~CR   40 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAGEQKFYA-E-KGFDNEPKRCPSCR   40 (49)
T ss_pred             eeEEcccCCCeEEEehhHHHHHH-h-cCCcCCCccCHHHH
Confidence            56778888888776665444442 2 22  2355666664


No 83 
>PHA00626 hypothetical protein
Probab=85.40  E-value=0.58  Score=21.29  Aligned_cols=15  Identities=13%  Similarity=0.268  Sum_probs=10.9

Q ss_pred             CCCeecCCCccccCC
Q psy14147         83 TPRFKCKLCPKMFTN   97 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~   97 (100)
                      ...|.|+.||..|+.
T Consensus        21 snrYkCkdCGY~ft~   35 (59)
T PHA00626         21 SDDYVCCDCGYNDSK   35 (59)
T ss_pred             CcceEcCCCCCeech
Confidence            346888888877763


No 84 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.97  E-value=0.46  Score=20.18  Aligned_cols=11  Identities=27%  Similarity=1.002  Sum_probs=8.5

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            77888887774


No 85 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=84.93  E-value=0.4  Score=23.87  Aligned_cols=12  Identities=33%  Similarity=0.894  Sum_probs=6.7

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      .+.|..||..|.
T Consensus        53 IW~C~kCg~~fA   64 (89)
T COG1997          53 IWKCRKCGAKFA   64 (89)
T ss_pred             eEEcCCCCCeec
Confidence            356666665553


No 86 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=83.58  E-value=0.64  Score=26.19  Aligned_cols=14  Identities=29%  Similarity=0.923  Sum_probs=12.2

Q ss_pred             CCCeecCCCccccC
Q psy14147         83 TPRFKCKLCPKMFT   96 (100)
Q Consensus        83 ~~~~~C~~C~~~f~   96 (100)
                      .+|..|++||..|.
T Consensus       139 Gkp~RCpeCG~~fk  152 (174)
T PLN02294        139 GKSFECPVCTQYFE  152 (174)
T ss_pred             CCceeCCCCCCEEE
Confidence            47999999999986


No 87 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=83.15  E-value=1.3  Score=16.74  Aligned_cols=19  Identities=21%  Similarity=0.567  Sum_probs=11.4

Q ss_pred             cCccccccccChhHHHHHHH
Q psy14147         59 QCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~   78 (100)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            477777766 4455666654


No 88 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=83.08  E-value=1.2  Score=19.28  Aligned_cols=29  Identities=28%  Similarity=0.706  Sum_probs=15.7

Q ss_pred             CCccCccccccccChhHHHHHHHhcCCCCCeecCCCcc
Q psy14147         56 RRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPK   93 (100)
Q Consensus        56 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   93 (100)
                      ..+.|+.|+..  ....+       .+...|.|..|++
T Consensus        17 ~g~~CP~Cg~~--~~~~~-------~~~~~~~C~~C~~   45 (46)
T PF12760_consen   17 DGFVCPHCGST--KHYRL-------KTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCCe--eeEEe-------CCCCeEECCCCCC
Confidence            34668888753  11111       1145678887765


No 89 
>KOG3408|consensus
Probab=82.94  E-value=0.92  Score=24.08  Aligned_cols=27  Identities=19%  Similarity=0.394  Sum_probs=21.5

Q ss_pred             CCCCCccCccccccccChhHHHHHHHh
Q psy14147         53 LNDRRYQCDLCLARFVTNSSLIVHKQR   79 (100)
Q Consensus        53 ~~~~~~~c~~c~~~~~~~~~l~~h~~~   79 (100)
                      .|...|.|..|.+-|.....|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            455568888899989888888888774


No 90 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=82.76  E-value=0.75  Score=19.25  Aligned_cols=12  Identities=42%  Similarity=1.151  Sum_probs=9.6

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      |+.|..|++.|=
T Consensus        12 ~f~C~~C~~~FC   23 (39)
T smart00154       12 GFKCRHCGNLFC   23 (39)
T ss_pred             CeECCccCCccc
Confidence            788888888773


No 91 
>PF12907 zf-met2:  Zinc-binding
Probab=82.60  E-value=0.65  Score=19.65  Aligned_cols=24  Identities=25%  Similarity=0.531  Sum_probs=12.5

Q ss_pred             eeCchhhhhccCh---hHHHHHHhhhc
Q psy14147         29 YACEECGKAFRKK---FSLTMHQRHVH   52 (100)
Q Consensus        29 ~~c~~C~~~f~~~---~~l~~h~~~~~   52 (100)
                      +.|.+|..+|...   ..|..|....|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKH   28 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKH   28 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccC
Confidence            3566676555433   33666654333


No 92 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=82.22  E-value=0.43  Score=25.85  Aligned_cols=13  Identities=15%  Similarity=0.416  Sum_probs=7.8

Q ss_pred             CccCccccccccC
Q psy14147         57 RYQCDLCLARFVT   69 (100)
Q Consensus        57 ~~~c~~c~~~~~~   69 (100)
                      .+.|..|+..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            4567777765543


No 93 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=81.52  E-value=0.86  Score=23.30  Aligned_cols=17  Identities=18%  Similarity=0.477  Sum_probs=13.7

Q ss_pred             hcCCCCCeecCCCccccC
Q psy14147         79 RHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        79 ~~~~~~~~~C~~C~~~f~   96 (100)
                      .+.+ +|..|++||..|.
T Consensus        74 l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          74 LEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EeCC-CceeCCCCCcEEE
Confidence            4555 7999999999885


No 94 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=81.52  E-value=0.86  Score=20.20  Aligned_cols=11  Identities=36%  Similarity=1.201  Sum_probs=7.1

Q ss_pred             ceeCchhhhhc
Q psy14147         28 PYACEECGKAF   38 (100)
Q Consensus        28 ~~~c~~C~~~f   38 (100)
                      .|.|..||+.+
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            36677777665


No 95 
>KOG2785|consensus
Probab=81.36  E-value=2.3  Score=27.19  Aligned_cols=51  Identities=18%  Similarity=0.249  Sum_probs=38.8

Q ss_pred             CceeCchhhhhccChhHHHHHHhhhcCC-----------------------CCCccCcccc---ccccChhHHHHHHH
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRHVHLN-----------------------DRRYQCDLCL---ARFVTNSSLIVHKQ   78 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~~~~~-----------------------~~~~~c~~c~---~~~~~~~~l~~h~~   78 (100)
                      .|-.|..|++.+........||. .+.|                       ...+.|..|+   +.|.+......|+.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~-~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMF-KEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHh-hccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            45679999999998888889995 4433                       2346788888   88888888888876


No 96 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=81.07  E-value=0.8  Score=20.20  Aligned_cols=11  Identities=27%  Similarity=1.026  Sum_probs=8.0

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            67888887664


No 97 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=79.40  E-value=0.68  Score=19.73  Aligned_cols=12  Identities=58%  Similarity=1.068  Sum_probs=7.8

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      .|+.|+.|++.|
T Consensus        12 ~~~~C~~C~~~F   23 (43)
T PF01428_consen   12 LPFKCKHCGKSF   23 (43)
T ss_dssp             SHEE-TTTS-EE
T ss_pred             CCeECCCCCccc
Confidence            478888888877


No 98 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=79.16  E-value=0.5  Score=19.45  Aligned_cols=8  Identities=38%  Similarity=1.551  Sum_probs=3.6

Q ss_pred             Cchhhhhc
Q psy14147         31 CEECGKAF   38 (100)
Q Consensus        31 c~~C~~~f   38 (100)
                      |..||..|
T Consensus         4 C~~Cg~~Y   11 (36)
T PF05191_consen    4 CPKCGRIY   11 (36)
T ss_dssp             ETTTTEEE
T ss_pred             cCCCCCcc
Confidence            44444443


No 99 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=77.23  E-value=3  Score=25.39  Aligned_cols=72  Identities=17%  Similarity=0.207  Sum_probs=39.3

Q ss_pred             ccCCCceeCchhhhhccChhHHHHHHhhh-cCCCCCccCccccccccCh------hHHHHHHHh----cCCCCCeecCCC
Q psy14147         23 LYCVKPYACEECGKAFRKKFSLTMHQRHV-HLNDRRYQCDLCLARFVTN------SSLIVHKQR----HDNTPRFKCKLC   91 (100)
Q Consensus        23 ~~~~~~~~c~~C~~~f~~~~~l~~h~~~~-~~~~~~~~c~~c~~~~~~~------~~l~~h~~~----~~~~~~~~C~~C   91 (100)
                      .++.+.|.|..|.. |.-...-..|+... ......|.|..|++.=...      ..-..|.+.    ....+++.||.|
T Consensus       137 ~hGGrif~CsfC~~-flCEDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKC  215 (314)
T PF06524_consen  137 DHGGRIFKCSFCDN-FLCEDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKC  215 (314)
T ss_pred             cCCCeEEEeecCCC-eeeccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCC
Confidence            34567799999975 44444444555311 1234467787777632111      111234442    234578999999


Q ss_pred             cccc
Q psy14147         92 PKMF   95 (100)
Q Consensus        92 ~~~f   95 (100)
                      |..-
T Consensus       216 g~et  219 (314)
T PF06524_consen  216 GYET  219 (314)
T ss_pred             CCcc
Confidence            8543


No 100
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=77.14  E-value=1.2  Score=17.61  Aligned_cols=12  Identities=17%  Similarity=0.365  Sum_probs=6.4

Q ss_pred             CCCeecCCCccc
Q psy14147         83 TPRFKCKLCPKM   94 (100)
Q Consensus        83 ~~~~~C~~C~~~   94 (100)
                      ...+.|+.|+..
T Consensus        17 ~~~~vCp~C~~e   28 (30)
T PF08274_consen   17 GELLVCPECGHE   28 (30)
T ss_dssp             SSSEEETTTTEE
T ss_pred             CCEEeCCccccc
Confidence            344566666543


No 101
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=76.69  E-value=2  Score=20.93  Aligned_cols=32  Identities=34%  Similarity=0.805  Sum_probs=19.8

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccc
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARF   67 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~   67 (100)
                      .|.|..|+..|    .+..++.    ...--.|+.|+..+
T Consensus        12 ~Y~c~~cg~~~----dvvq~~~----ddplt~ce~c~a~~   43 (82)
T COG2331          12 SYECTECGNRF----DVVQAMT----DDPLTTCEECGARL   43 (82)
T ss_pred             EEeecccchHH----HHHHhcc----cCccccChhhChHH
Confidence            38899999887    3444442    12223688887643


No 102
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=75.88  E-value=1.4  Score=23.74  Aligned_cols=15  Identities=33%  Similarity=0.948  Sum_probs=11.4

Q ss_pred             ceeCchhhhhccChh
Q psy14147         28 PYACEECGKAFRKKF   42 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~   42 (100)
                      |++|..||+.|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567888888887654


No 103
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=75.72  E-value=1.7  Score=23.53  Aligned_cols=25  Identities=28%  Similarity=0.389  Sum_probs=14.9

Q ss_pred             ccCccccccccChhHHHHHHHhcCCCCC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHDNTPR   85 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~   85 (100)
                      ..|-+||+.|..   |..|++.|+|-.|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eEEccCCcccch---HHHHHHHccCCCH
Confidence            468889998865   4789888876544


No 104
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=75.69  E-value=1.5  Score=18.86  Aligned_cols=11  Identities=27%  Similarity=0.857  Sum_probs=6.7

Q ss_pred             CeecCCCcccc
Q psy14147         85 RFKCKLCPKMF   95 (100)
Q Consensus        85 ~~~C~~C~~~f   95 (100)
                      .|.|+.||..|
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            36666666655


No 105
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=75.67  E-value=1.5  Score=17.82  Aligned_cols=13  Identities=38%  Similarity=0.754  Sum_probs=6.3

Q ss_pred             eecCCCccccCCC
Q psy14147         86 FKCKLCPKMFTNT   98 (100)
Q Consensus        86 ~~C~~C~~~f~~~   98 (100)
                      -.|.+|++.|..+
T Consensus         4 ~~C~eC~~~f~dS   16 (34)
T PF01286_consen    4 PKCDECGKPFMDS   16 (34)
T ss_dssp             EE-TTT--EES-S
T ss_pred             chHhHhCCHHHHH
Confidence            4688888888653


No 106
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=74.79  E-value=2  Score=19.46  Aligned_cols=10  Identities=30%  Similarity=1.248  Sum_probs=4.8

Q ss_pred             eeCchhhhhc
Q psy14147         29 YACEECGKAF   38 (100)
Q Consensus        29 ~~c~~C~~~f   38 (100)
                      +.|+.|+..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            3455555443


No 107
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=74.66  E-value=3.3  Score=17.47  Aligned_cols=23  Identities=30%  Similarity=0.527  Sum_probs=10.1

Q ss_pred             CCceeCchhhhhccC----hhHHHHHH
Q psy14147         26 VKPYACEECGKAFRK----KFSLTMHQ   48 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~----~~~l~~h~   48 (100)
                      .....|..|++.+..    .+.|..|+
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            344566666655543    24455554


No 108
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=73.53  E-value=2.8  Score=27.66  Aligned_cols=29  Identities=24%  Similarity=0.432  Sum_probs=25.1

Q ss_pred             CceeCchhhhhccChhHHHHHHhhhcCCC
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRHVHLND   55 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~~~~~~   55 (100)
                      +-+.|+.|.+.|.....+..|+...|.+.
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            45889999999999999999998778764


No 109
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=73.14  E-value=1.8  Score=16.79  Aligned_cols=11  Identities=45%  Similarity=0.957  Sum_probs=8.9

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      |.|..|++.|.
T Consensus         1 ~sCiDC~~~F~   11 (28)
T PF08790_consen    1 FSCIDCSKDFD   11 (28)
T ss_dssp             EEETTTTEEEE
T ss_pred             CeeecCCCCcC
Confidence            46888999985


No 110
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=72.70  E-value=0.61  Score=32.06  Aligned_cols=56  Identities=18%  Similarity=0.441  Sum_probs=30.5

Q ss_pred             eCchhhhhccChhHHHHHHhhhcCCCCCc-cCccccccccChhHHHHHHHhcCCCCCeecCCCcc
Q psy14147         30 ACEECGKAFRKKFSLTMHQRHVHLNDRRY-QCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPK   93 (100)
Q Consensus        30 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   93 (100)
                      .|..||.+|+....|-. . ..++....| .|+.|.+-+..+.+-..|      -+|.-|+.||=
T Consensus       125 ~CT~CGPRfTIi~alPY-D-R~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPY-D-RENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCC-C-cccCccccCcCCHHHHHHhcCccccccc------cccccCcccCC
Confidence            36667777765544321 1 133333333 477777766666543332      24677888874


No 111
>KOG2593|consensus
Probab=72.29  E-value=6.8  Score=25.60  Aligned_cols=38  Identities=24%  Similarity=0.537  Sum_probs=24.5

Q ss_pred             CCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccc
Q psy14147         54 NDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKM   94 (100)
Q Consensus        54 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   94 (100)
                      ....|.|+.|.+.|.....+   +..-...-.|.|..|+..
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~---~L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEAL---QLLDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccCCccccchhhhHHH---HhhcccCceEEEecCCCc
Confidence            45578999999888664433   223333345889988754


No 112
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=72.27  E-value=3  Score=19.50  Aligned_cols=11  Identities=27%  Similarity=0.507  Sum_probs=5.8

Q ss_pred             CCeecCCCccc
Q psy14147         84 PRFKCKLCPKM   94 (100)
Q Consensus        84 ~~~~C~~C~~~   94 (100)
                      +.|.|+.||..
T Consensus        45 r~~~C~~Cg~~   55 (69)
T PF07282_consen   45 RVFTCPNCGFE   55 (69)
T ss_pred             ceEEcCCCCCE
Confidence            34555555543


No 113
>KOG4167|consensus
Probab=72.22  E-value=2  Score=29.89  Aligned_cols=23  Identities=4%  Similarity=-0.195  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHHHHHhccccccC
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYC   25 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~   25 (100)
                      ||.||+.|.....+..||++|.-
T Consensus       795 CreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  795 CRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             hHHHHHHHHHHhhhhHHHHHHHH
Confidence            89999999999999999999874


No 114
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=71.59  E-value=2  Score=23.12  Aligned_cols=15  Identities=47%  Similarity=0.928  Sum_probs=12.0

Q ss_pred             CCCeecCCCccccCC
Q psy14147         83 TPRFKCKLCPKMFTN   97 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~   97 (100)
                      ...|.|+.|++.|..
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            556889999988864


No 115
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=71.49  E-value=1.5  Score=20.05  Aligned_cols=36  Identities=22%  Similarity=0.317  Sum_probs=18.0

Q ss_pred             eCchhhhhccChhHHHHHHhhhcCCCCCccCccccc
Q psy14147         30 ACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLA   65 (100)
Q Consensus        30 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~   65 (100)
                      .|-.|++.+........-.+........|.|..|..
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~   39 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKE   39 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHH
Confidence            466777665433221111112233455678887754


No 116
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=70.62  E-value=4.8  Score=17.60  Aligned_cols=8  Identities=38%  Similarity=0.339  Sum_probs=4.2

Q ss_pred             hHHHHHHH
Q psy14147         71 SSLIVHKQ   78 (100)
Q Consensus        71 ~~l~~h~~   78 (100)
                      +.|..|++
T Consensus        37 s~L~rHl~   44 (50)
T smart00614       37 SNLRRHLR   44 (50)
T ss_pred             HHHHHHHH
Confidence            45555555


No 117
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=70.50  E-value=1.9  Score=19.28  Aligned_cols=10  Identities=30%  Similarity=0.809  Sum_probs=3.9

Q ss_pred             ecCCCccccC
Q psy14147         87 KCKLCPKMFT   96 (100)
Q Consensus        87 ~C~~C~~~f~   96 (100)
                      .||.|++.|.
T Consensus        22 ~CPlC~r~l~   31 (54)
T PF04423_consen   22 CCPLCGRPLD   31 (54)
T ss_dssp             E-TTT--EE-
T ss_pred             cCCCCCCCCC
Confidence            5666666654


No 118
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=70.21  E-value=1.6  Score=23.81  Aligned_cols=17  Identities=24%  Similarity=0.618  Sum_probs=13.3

Q ss_pred             hcCCCCCeecCCCccccC
Q psy14147         79 RHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        79 ~~~~~~~~~C~~C~~~f~   96 (100)
                      .+.+ +|..|++||..|.
T Consensus       107 l~~g-~~~RCpeCG~~fk  123 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFK  123 (136)
T ss_dssp             EETT-SEEEETTTEEEEE
T ss_pred             EeCC-CccCCCCCCeEEE
Confidence            4444 5899999999885


No 119
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=69.56  E-value=2.3  Score=18.19  Aligned_cols=11  Identities=36%  Similarity=0.809  Sum_probs=7.5

Q ss_pred             ecCCCccccCC
Q psy14147         87 KCKLCPKMFTN   97 (100)
Q Consensus        87 ~C~~C~~~f~~   97 (100)
                      .|+.||+.|+.
T Consensus        10 ~C~~C~rpf~W   20 (42)
T PF10013_consen   10 ICPVCGRPFTW   20 (42)
T ss_pred             cCcccCCcchH
Confidence            47777777764


No 120
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=69.20  E-value=4.8  Score=20.76  Aligned_cols=25  Identities=16%  Similarity=0.361  Sum_probs=21.4

Q ss_pred             ccC----ccccccccChhHHHHHHHhcCC
Q psy14147         58 YQC----DLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus        58 ~~c----~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      |.|    ..|+........+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999987654


No 121
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=68.81  E-value=3.6  Score=16.45  Aligned_cols=11  Identities=18%  Similarity=0.549  Sum_probs=5.2

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      |.|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            34555555543


No 122
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=68.20  E-value=2.7  Score=22.03  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=14.8

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCcc
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPK   93 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   93 (100)
                      .+.|..|+..|....            ..+.||.||.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------cCccCcCCCC
Confidence            356777876554321            2345888874


No 123
>KOG1842|consensus
Probab=67.92  E-value=4.6  Score=26.53  Aligned_cols=29  Identities=17%  Similarity=0.322  Sum_probs=24.8

Q ss_pred             CceeCchhhhhccChhHHHHHHhhhcCCC
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRHVHLND   55 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~~~~~~   55 (100)
                      +-|.|++|...|.....|..|....|.++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            45899999999999999999997667653


No 124
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=67.78  E-value=2.5  Score=23.51  Aligned_cols=35  Identities=17%  Similarity=0.550  Sum_probs=22.8

Q ss_pred             CCccCccccccccChhHHHHHHHhcCCCCCeecCCCcccc
Q psy14147         56 RRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMF   95 (100)
Q Consensus        56 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   95 (100)
                      -+|.|. |+..+...   ..|-..-.|+ .|.|..|+...
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gkL  150 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGKL  150 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCceE
Confidence            357888 88765443   3454555566 89999997543


No 125
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=67.65  E-value=2.9  Score=24.83  Aligned_cols=16  Identities=19%  Similarity=0.627  Sum_probs=12.8

Q ss_pred             CCCCCeecCCCccccC
Q psy14147         81 DNTPRFKCKLCPKMFT   96 (100)
Q Consensus        81 ~~~~~~~C~~C~~~f~   96 (100)
                      +..++..|++||..|.
T Consensus       177 rEGkpqRCpECGqVFK  192 (268)
T PTZ00043        177 REGFLYRCGECDQIFM  192 (268)
T ss_pred             cCCCCccCCCCCcEEE
Confidence            3456899999999885


No 126
>KOG2785|consensus
Probab=67.29  E-value=7.1  Score=25.10  Aligned_cols=23  Identities=17%  Similarity=0.340  Sum_probs=12.8

Q ss_pred             CCccCccccccccChhHHHHHHH
Q psy14147         56 RRYQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        56 ~~~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      .++.|.+|.+.|........|+.
T Consensus        67 ~~~~c~~c~k~~~s~~a~~~hl~   89 (390)
T KOG2785|consen   67 SVVYCEACNKSFASPKAHENHLK   89 (390)
T ss_pred             cceehHHhhccccChhhHHHHHH
Confidence            34556666666665555555544


No 127
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=66.75  E-value=3.7  Score=19.17  Aligned_cols=8  Identities=63%  Similarity=1.443  Sum_probs=2.0

Q ss_pred             Cchhhhhc
Q psy14147         31 CEECGKAF   38 (100)
Q Consensus        31 c~~C~~~f   38 (100)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            44455544


No 128
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=66.67  E-value=2.5  Score=22.24  Aligned_cols=26  Identities=15%  Similarity=0.598  Sum_probs=15.7

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccc
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKM   94 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   94 (100)
                      ...|..|+..|.....            .+.||.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------LYRCPKCHGI   95 (115)
T ss_pred             EEEcccCCCEEecCCc------------CccCcCCcCC
Confidence            3567788766644321            3568888753


No 129
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=66.19  E-value=4.7  Score=23.80  Aligned_cols=29  Identities=24%  Similarity=0.371  Sum_probs=21.0

Q ss_pred             CCCceeCchhhhhccChhHHHHHHhhhcC
Q psy14147         25 CVKPYACEECGKAFRKKFSLTMHQRHVHL   53 (100)
Q Consensus        25 ~~~~~~c~~C~~~f~~~~~l~~h~~~~~~   53 (100)
                      .+..|.|..|++.|.-..-+..|+...|.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            45569999999999999888899864443


No 130
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=64.65  E-value=3  Score=17.61  Aligned_cols=12  Identities=17%  Similarity=0.562  Sum_probs=8.1

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      .+-.|+.||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356777777766


No 131
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=63.39  E-value=6.1  Score=18.01  Aligned_cols=15  Identities=13%  Similarity=0.288  Sum_probs=10.1

Q ss_pred             CCCCCccCccccccc
Q psy14147         53 LNDRRYQCDLCLARF   67 (100)
Q Consensus        53 ~~~~~~~c~~c~~~~   67 (100)
                      .+...|.|+.||-..
T Consensus        10 ~~~v~~~Cp~cGipt   24 (55)
T PF13824_consen   10 PAHVNFECPDCGIPT   24 (55)
T ss_pred             ccccCCcCCCCCCcC
Confidence            345578888888654


No 132
>KOG4167|consensus
Probab=62.64  E-value=1.9  Score=29.95  Aligned_cols=25  Identities=24%  Similarity=0.388  Sum_probs=21.9

Q ss_pred             CccCccccccccChhHHHHHHHhcC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                      .|-|.+|++.|.....++.|+++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4789999999999999999998875


No 133
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=62.52  E-value=6  Score=25.81  Aligned_cols=12  Identities=25%  Similarity=0.656  Sum_probs=5.7

Q ss_pred             CccCcccccccc
Q psy14147         57 RYQCDLCLARFV   68 (100)
Q Consensus        57 ~~~c~~c~~~~~   68 (100)
                      .|.|+.|+..+.
T Consensus       367 g~rC~kCg~~~~  378 (421)
T COG1571         367 GFRCKKCGTRAR  378 (421)
T ss_pred             CcccccccccCC
Confidence            445555554443


No 134
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=62.13  E-value=2.8  Score=18.55  Aligned_cols=8  Identities=50%  Similarity=1.427  Sum_probs=3.1

Q ss_pred             eecCCCcc
Q psy14147         86 FKCKLCPK   93 (100)
Q Consensus        86 ~~C~~C~~   93 (100)
                      |.|+.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            77777765


No 135
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=61.80  E-value=4.7  Score=16.19  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=7.1

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      +.|..||..|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            56777776654


No 136
>KOG2807|consensus
Probab=61.69  E-value=13  Score=23.53  Aligned_cols=22  Identities=18%  Similarity=0.315  Sum_probs=14.3

Q ss_pred             CceeCchhhhhccChhHHHHHH
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~   48 (100)
                      -|-.|++|+-+......|.+..
T Consensus       289 LP~eCpiC~ltLVss~hLARSy  310 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSY  310 (378)
T ss_pred             CCccCCccceeEecchHHHHHH
Confidence            3466777777776666665544


No 137
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=61.32  E-value=11  Score=15.92  Aligned_cols=22  Identities=23%  Similarity=0.448  Sum_probs=9.5

Q ss_pred             cCccccccccC--hhHHHHHHHhc
Q psy14147         59 QCDLCLARFVT--NSSLIVHKQRH   80 (100)
Q Consensus        59 ~c~~c~~~~~~--~~~l~~h~~~~   80 (100)
                      .|+.|+..|..  +.+-..|.+.|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            45555544322  33344444433


No 138
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=60.96  E-value=3.9  Score=22.82  Aligned_cols=16  Identities=19%  Similarity=0.301  Sum_probs=13.5

Q ss_pred             CCCCeecCCCccccCC
Q psy14147         82 NTPRFKCKLCPKMFTN   97 (100)
Q Consensus        82 ~~~~~~C~~C~~~f~~   97 (100)
                      -+.|..|..||+.|.+
T Consensus        65 ~~~PsYC~~CGkpyPW   80 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPW   80 (158)
T ss_pred             CCCChhHHhCCCCCch
Confidence            3478899999999986


No 139
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=60.57  E-value=4.2  Score=20.53  Aligned_cols=14  Identities=29%  Similarity=0.591  Sum_probs=10.0

Q ss_pred             CCeecCCCccccCC
Q psy14147         84 PRFKCKLCPKMFTN   97 (100)
Q Consensus        84 ~~~~C~~C~~~f~~   97 (100)
                      +|-.|..||-.|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            56678888877765


No 140
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.31  E-value=3.3  Score=18.23  Aligned_cols=16  Identities=19%  Similarity=0.430  Sum_probs=11.9

Q ss_pred             cCccccccccChhHHH
Q psy14147         59 QCDLCLARFVTNSSLI   74 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~   74 (100)
                      .|++|++.|.....+.
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            6899999887765443


No 141
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=58.93  E-value=3.9  Score=21.60  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=7.3

Q ss_pred             CccCcccccccc
Q psy14147         57 RYQCDLCLARFV   68 (100)
Q Consensus        57 ~~~c~~c~~~~~   68 (100)
                      .+.|..|+..|.
T Consensus        71 ~~~C~~Cg~~~~   82 (117)
T PRK00564         71 ELECKDCSHVFK   82 (117)
T ss_pred             EEEhhhCCCccc
Confidence            356777775553


No 143
>PRK14873 primosome assembly protein PriA; Provisional
Probab=58.80  E-value=7  Score=27.13  Aligned_cols=10  Identities=20%  Similarity=0.723  Sum_probs=6.8

Q ss_pred             CeecCCCccc
Q psy14147         85 RFKCKLCPKM   94 (100)
Q Consensus        85 ~~~C~~C~~~   94 (100)
                      |+.|+.||..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            5678888753


No 144
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=58.39  E-value=8.6  Score=17.03  Aligned_cols=10  Identities=50%  Similarity=1.272  Sum_probs=5.8

Q ss_pred             eCchhhhhcc
Q psy14147         30 ACEECGKAFR   39 (100)
Q Consensus        30 ~c~~C~~~f~   39 (100)
                      .|..|++.|.
T Consensus         4 ~C~~C~~~F~   13 (57)
T cd00065           4 SCMGCGKPFT   13 (57)
T ss_pred             cCcccCcccc
Confidence            3566666654


No 145
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=58.07  E-value=3.1  Score=29.09  Aligned_cols=15  Identities=13%  Similarity=0.220  Sum_probs=10.2

Q ss_pred             cCCCCCeecCCCccc
Q psy14147         80 HDNTPRFKCKLCPKM   94 (100)
Q Consensus        80 ~~~~~~~~C~~C~~~   94 (100)
                      +....|..|+.||..
T Consensus       470 ~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            344567888888754


No 146
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=57.66  E-value=6.3  Score=17.48  Aligned_cols=12  Identities=25%  Similarity=0.551  Sum_probs=7.4

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            356677777544


No 147
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=56.69  E-value=6.9  Score=17.55  Aligned_cols=6  Identities=33%  Similarity=0.313  Sum_probs=3.2

Q ss_pred             HHHHHH
Q psy14147         43 SLTMHQ   48 (100)
Q Consensus        43 ~l~~h~   48 (100)
                      .|..|.
T Consensus        25 ~l~~H~   30 (60)
T PF02176_consen   25 ELDDHL   30 (60)
T ss_dssp             CHHHHH
T ss_pred             HHHHHH
Confidence            455555


No 148
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.55  E-value=3.8  Score=21.45  Aligned_cols=13  Identities=23%  Similarity=0.529  Sum_probs=7.7

Q ss_pred             ccCccccccccCh
Q psy14147         58 YQCDLCLARFVTN   70 (100)
Q Consensus        58 ~~c~~c~~~~~~~   70 (100)
                      +.|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            5677777766543


No 149
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=56.40  E-value=5.3  Score=16.60  Aligned_cols=10  Identities=20%  Similarity=0.717  Sum_probs=6.5

Q ss_pred             eecCCCcccc
Q psy14147         86 FKCKLCPKMF   95 (100)
Q Consensus        86 ~~C~~C~~~f   95 (100)
                      |.|..||..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5677777655


No 150
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.21  E-value=5  Score=18.67  Aligned_cols=43  Identities=9%  Similarity=0.189  Sum_probs=24.3

Q ss_pred             hhcCCCCCccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         50 HVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        50 ~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      ..+.+..++.|+.-+..+..+.-+..   . ..+.--.|+.|+..|.
T Consensus        17 ~I~~~~~~l~C~g~~~p~~HPrV~L~---m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          17 TIEIGDLPLMCPGPEPPNDHPRVFLD---M-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEEeCCeeEEcCCCCCCCCCCEEEEE---c-CCCCcEecCccccEEE
Confidence            45667778888755444433322111   1 2233457999998886


No 151
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=54.55  E-value=4  Score=21.46  Aligned_cols=11  Identities=18%  Similarity=0.549  Sum_probs=6.9

Q ss_pred             CccCccccccc
Q psy14147         57 RYQCDLCLARF   67 (100)
Q Consensus        57 ~~~c~~c~~~~   67 (100)
                      .+.|..|+..|
T Consensus        70 ~~~C~~Cg~~~   80 (114)
T PRK03681         70 ECWCETCQQYV   80 (114)
T ss_pred             EEEcccCCCee
Confidence            35677777544


No 152
>KOG2482|consensus
Probab=54.35  E-value=7.2  Score=24.83  Aligned_cols=21  Identities=43%  Similarity=0.700  Sum_probs=19.9

Q ss_pred             eeCchhhhhccChhHHHHHHh
Q psy14147         29 YACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      +.|-.|.+.|..+..|..||+
T Consensus       196 ~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             heeeeeccccCCcHHHHHHHH
Confidence            789999999999999999996


No 153
>PF14369 zf-RING_3:  zinc-finger
Probab=53.71  E-value=6.5  Score=15.97  Aligned_cols=9  Identities=33%  Similarity=0.781  Sum_probs=5.4

Q ss_pred             ecCCCcccc
Q psy14147         87 KCKLCPKMF   95 (100)
Q Consensus        87 ~C~~C~~~f   95 (100)
                      .|+.|+..|
T Consensus        23 ~CP~C~~gF   31 (35)
T PF14369_consen   23 ACPRCHGGF   31 (35)
T ss_pred             CCcCCCCcE
Confidence            366666655


No 154
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=53.42  E-value=8  Score=16.17  Aligned_cols=11  Identities=18%  Similarity=0.760  Sum_probs=7.9

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      |.|..|+..|.
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            67877877664


No 155
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=53.31  E-value=2.2  Score=18.55  Aligned_cols=13  Identities=23%  Similarity=0.567  Sum_probs=7.2

Q ss_pred             CCeecCC--CccccC
Q psy14147         84 PRFKCKL--CPKMFT   96 (100)
Q Consensus        84 ~~~~C~~--C~~~f~   96 (100)
                      .-+.|..  ||..|.
T Consensus        24 ~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   24 LYCQCTNPECGHTFV   38 (47)
T ss_pred             EEEEECCCcCCCEEE
Confidence            3455644  766664


No 156
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=52.31  E-value=7.4  Score=21.34  Aligned_cols=39  Identities=18%  Similarity=0.347  Sum_probs=21.9

Q ss_pred             ccCccccccccChhHHHHHHHh-----cCCCCCeecCCCccccC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQR-----HDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~-----~~~~~~~~C~~C~~~f~   96 (100)
                      -.|..|+..+.....-......     ...+.-+.|+.||+.|.
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW  135 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYW  135 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEec
Confidence            4789998765443211110011     11234678999999985


No 157
>KOG3352|consensus
Probab=52.28  E-value=7  Score=21.73  Aligned_cols=14  Identities=21%  Similarity=0.567  Sum_probs=11.0

Q ss_pred             CCCeecCCCccccC
Q psy14147         83 TPRFKCKLCPKMFT   96 (100)
Q Consensus        83 ~~~~~C~~C~~~f~   96 (100)
                      .+...|++||..|.
T Consensus       131 ge~~rc~eCG~~fk  144 (153)
T KOG3352|consen  131 GETQRCPECGHYFK  144 (153)
T ss_pred             CCcccCCcccceEE
Confidence            45667999998885


No 158
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=51.08  E-value=11  Score=13.63  Aligned_cols=7  Identities=29%  Similarity=0.695  Sum_probs=3.5

Q ss_pred             ecCCCcc
Q psy14147         87 KCKLCPK   93 (100)
Q Consensus        87 ~C~~C~~   93 (100)
                      .|+.||.
T Consensus        15 fC~~CG~   21 (23)
T PF13240_consen   15 FCPNCGT   21 (23)
T ss_pred             chhhhCC
Confidence            4555554


No 159
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=50.54  E-value=12  Score=16.66  Aligned_cols=10  Identities=20%  Similarity=0.820  Sum_probs=5.1

Q ss_pred             ccCccccccc
Q psy14147         58 YQCDLCLARF   67 (100)
Q Consensus        58 ~~c~~c~~~~   67 (100)
                      +.|+.|+..+
T Consensus        29 W~C~~Cgh~w   38 (55)
T PF14311_consen   29 WKCPKCGHEW   38 (55)
T ss_pred             EECCCCCCee
Confidence            4555555444


No 160
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=50.47  E-value=7.8  Score=20.07  Aligned_cols=9  Identities=44%  Similarity=1.161  Sum_probs=4.7

Q ss_pred             ceeCchhhh
Q psy14147         28 PYACEECGK   36 (100)
Q Consensus        28 ~~~c~~C~~   36 (100)
                      |-.|+.||.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            445555554


No 161
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=50.37  E-value=9  Score=16.14  Aligned_cols=7  Identities=43%  Similarity=1.004  Sum_probs=3.7

Q ss_pred             ecCCCcc
Q psy14147         87 KCKLCPK   93 (100)
Q Consensus        87 ~C~~C~~   93 (100)
                      .|+.||.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555554


No 162
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=50.04  E-value=28  Score=20.01  Aligned_cols=49  Identities=12%  Similarity=0.154  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCcccccc
Q psy14147          8 VMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLAR   66 (100)
Q Consensus         8 ~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~   66 (100)
                      .+......|+.-...-....-|.|+.|...++...    -+   ..+   |.|+.||..
T Consensus        93 ~~~~~le~Lk~~le~~~~~~~y~C~~~~~r~sfde----A~---~~~---F~Cp~Cg~~  141 (176)
T COG1675          93 KKRKILEKLKRKLEKETENNYYVCPNCHVKYSFDE----AM---ELG---FTCPKCGED  141 (176)
T ss_pred             HHHHHHHHHHHHHHhhccCCceeCCCCCCcccHHH----HH---HhC---CCCCCCCch
Confidence            33444444444444444555677877765554322    11   222   678887754


No 163
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=49.75  E-value=7.6  Score=21.53  Aligned_cols=12  Identities=33%  Similarity=0.681  Sum_probs=8.0

Q ss_pred             eecCCCccccCC
Q psy14147         86 FKCKLCPKMFTN   97 (100)
Q Consensus        86 ~~C~~C~~~f~~   97 (100)
                      -.|..||+.|++
T Consensus        29 ReC~~C~~RFTT   40 (147)
T TIGR00244        29 RECLECHERFTT   40 (147)
T ss_pred             ccCCccCCccce
Confidence            457777777764


No 164
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=49.54  E-value=8.3  Score=15.54  Aligned_cols=12  Identities=17%  Similarity=0.509  Sum_probs=7.1

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      -+.|+.|++...
T Consensus         4 ~~~C~nC~R~v~   15 (33)
T PF08209_consen    4 YVECPNCGRPVA   15 (33)
T ss_dssp             EEE-TTTSSEEE
T ss_pred             eEECCCCcCCcc
Confidence            367888876543


No 165
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=49.04  E-value=11  Score=15.55  Aligned_cols=13  Identities=38%  Similarity=1.007  Sum_probs=4.7

Q ss_pred             CeecCCCccccCC
Q psy14147         85 RFKCKLCPKMFTN   97 (100)
Q Consensus        85 ~~~C~~C~~~f~~   97 (100)
                      .|-|+.|...|++
T Consensus         3 ryyCdyC~~~~~~   15 (38)
T PF06220_consen    3 RYYCDYCKKYLTH   15 (38)
T ss_dssp             S-B-TTT--B-S-
T ss_pred             CeecccccceecC
Confidence            3667888777743


No 166
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=48.96  E-value=9.6  Score=16.70  Aligned_cols=10  Identities=20%  Similarity=1.125  Sum_probs=5.6

Q ss_pred             eecCCCcccc
Q psy14147         86 FKCKLCPKMF   95 (100)
Q Consensus        86 ~~C~~C~~~f   95 (100)
                      |.|..||..|
T Consensus         2 y~C~~CgyvY   11 (47)
T PF00301_consen    2 YQCPVCGYVY   11 (47)
T ss_dssp             EEETTTSBEE
T ss_pred             cCCCCCCEEE
Confidence            4566666444


No 167
>KOG3507|consensus
Probab=48.58  E-value=9.3  Score=17.64  Aligned_cols=26  Identities=27%  Similarity=0.639  Sum_probs=14.9

Q ss_pred             eeCchhhhhccChhHHHHHHhhhcCCCCCccCcccccc
Q psy14147         29 YACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLAR   66 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~   66 (100)
                      |.|..|+..-            .....-++.|..||..
T Consensus        21 YiCgdC~~en------------~lk~~D~irCReCG~R   46 (62)
T KOG3507|consen   21 YICGDCGQEN------------TLKRGDVIRCRECGYR   46 (62)
T ss_pred             EEeccccccc------------cccCCCcEehhhcchH
Confidence            7777777432            1122335678778754


No 168
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=48.53  E-value=9.3  Score=15.75  Aligned_cols=11  Identities=36%  Similarity=0.585  Sum_probs=6.8

Q ss_pred             ecCCCccccCC
Q psy14147         87 KCKLCPKMFTN   97 (100)
Q Consensus        87 ~C~~C~~~f~~   97 (100)
                      .|+.|++.|-+
T Consensus         4 ~CprC~kg~Hw   14 (36)
T PF14787_consen    4 LCPRCGKGFHW   14 (36)
T ss_dssp             C-TTTSSSCS-
T ss_pred             cCcccCCCcch
Confidence            57888887744


No 169
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=48.29  E-value=11  Score=23.17  Aligned_cols=11  Identities=36%  Similarity=0.727  Sum_probs=6.4

Q ss_pred             CCeecCCCccc
Q psy14147         84 PRFKCKLCPKM   94 (100)
Q Consensus        84 ~~~~C~~C~~~   94 (100)
                      +.|.|+.||..
T Consensus       321 r~~~C~~cg~~  331 (364)
T COG0675         321 RLFKCPRCGFV  331 (364)
T ss_pred             eeEECCCCCCe
Confidence            44666666654


No 170
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.19  E-value=9.6  Score=20.03  Aligned_cols=27  Identities=15%  Similarity=0.057  Sum_probs=18.2

Q ss_pred             cCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         59 QCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|+.|++.|..   |        ...|..|+.||+.|.
T Consensus        11 idPetg~KFYD---L--------NrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYD---L--------NRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhc---c--------CCCccccCcccccch
Confidence            57777776633   2        235788888888885


No 171
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=48.06  E-value=5  Score=21.97  Aligned_cols=32  Identities=22%  Similarity=0.679  Sum_probs=18.9

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|.|..|+..+..      +.+.  ....|.|+.|+..|.
T Consensus       123 ~~~C~~C~~~~~r------~~~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKR------HRRS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeee------eccc--chhhEECCCCCCEEE
Confidence            3678778765522      2222  223388999987664


No 172
>KOG4727|consensus
Probab=48.04  E-value=10  Score=21.66  Aligned_cols=20  Identities=20%  Similarity=0.566  Sum_probs=18.6

Q ss_pred             eeCchhhhhccChhHHHHHH
Q psy14147         29 YACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~   48 (100)
                      |-|++|+-.+..+.++..|+
T Consensus        76 yyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             eeeeecceeehhhHHHHHHh
Confidence            88999999999999998887


No 173
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=47.92  E-value=9.5  Score=15.73  Aligned_cols=11  Identities=27%  Similarity=0.866  Sum_probs=5.9

Q ss_pred             CCeecCCCccc
Q psy14147         84 PRFKCKLCPKM   94 (100)
Q Consensus        84 ~~~~C~~C~~~   94 (100)
                      +.|+|..||..
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            45889998854


No 174
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=47.62  E-value=9.1  Score=15.98  Aligned_cols=10  Identities=20%  Similarity=0.793  Sum_probs=5.5

Q ss_pred             eecCCCcccc
Q psy14147         86 FKCKLCPKMF   95 (100)
Q Consensus        86 ~~C~~C~~~f   95 (100)
                      +.|+.||..+
T Consensus        33 ~~C~~CGE~~   42 (46)
T TIGR03831        33 LVCPQCGEEY   42 (46)
T ss_pred             cccccCCCEe
Confidence            4566666554


No 175
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=47.34  E-value=23  Score=20.69  Aligned_cols=11  Identities=18%  Similarity=0.461  Sum_probs=5.7

Q ss_pred             CccCccccccc
Q psy14147         57 RYQCDLCLARF   67 (100)
Q Consensus        57 ~~~c~~c~~~~   67 (100)
                      ...|..||.-+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            34566665443


No 176
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=47.32  E-value=11  Score=19.74  Aligned_cols=25  Identities=28%  Similarity=0.478  Sum_probs=17.1

Q ss_pred             CCCCccCccccccccChhHHHHHHH
Q psy14147         54 NDRRYQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        54 ~~~~~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      |...+-|..|.+-|.....|..|.+
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhc
Confidence            3344667778887777777777765


No 177
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=47.29  E-value=8.5  Score=21.46  Aligned_cols=12  Identities=33%  Similarity=0.667  Sum_probs=8.5

Q ss_pred             eecCCCccccCC
Q psy14147         86 FKCKLCPKMFTN   97 (100)
Q Consensus        86 ~~C~~C~~~f~~   97 (100)
                      -.|+.||+.|++
T Consensus        29 ReC~~C~~RFTT   40 (156)
T COG1327          29 RECLECGERFTT   40 (156)
T ss_pred             hcccccccccch
Confidence            457778777765


No 178
>PRK00420 hypothetical protein; Validated
Probab=46.75  E-value=17  Score=19.19  Aligned_cols=9  Identities=11%  Similarity=0.073  Sum_probs=4.7

Q ss_pred             ccCcccccc
Q psy14147         58 YQCDLCLAR   66 (100)
Q Consensus        58 ~~c~~c~~~   66 (100)
                      ..|+.|+..
T Consensus        41 ~~Cp~Cg~~   49 (112)
T PRK00420         41 VVCPVHGKV   49 (112)
T ss_pred             eECCCCCCe
Confidence            355555553


No 179
>KOG1280|consensus
Probab=46.29  E-value=21  Score=22.84  Aligned_cols=38  Identities=21%  Similarity=0.422  Sum_probs=22.3

Q ss_pred             CceeCchhhhhccChhHHHHHHhhhcCCCCC-ccCcccc
Q psy14147         27 KPYACEECGKAFRKKFSLTMHQRHVHLNDRR-YQCDLCL   64 (100)
Q Consensus        27 ~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~-~~c~~c~   64 (100)
                      ..|.|+.|+..-.+...+..|....|....+ ..|++|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3477777877666677777777444433221 2455554


No 180
>PRK01343 zinc-binding protein; Provisional
Probab=44.72  E-value=13  Score=17.05  Aligned_cols=11  Identities=36%  Similarity=0.446  Sum_probs=6.3

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      ..|+.|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            34666666554


No 181
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=44.06  E-value=7.8  Score=20.71  Aligned_cols=12  Identities=25%  Similarity=0.379  Sum_probs=7.1

Q ss_pred             CccCccccccccC
Q psy14147         57 RYQCDLCLARFVT   69 (100)
Q Consensus        57 ~~~c~~c~~~~~~   69 (100)
                      .+.| .|+..|..
T Consensus        70 ~~~C-~Cg~~~~~   81 (124)
T PRK00762         70 EIEC-ECGYEGVV   81 (124)
T ss_pred             eEEe-eCcCcccc
Confidence            3567 77765543


No 182
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=43.72  E-value=12  Score=15.77  Aligned_cols=10  Identities=20%  Similarity=0.487  Sum_probs=6.9

Q ss_pred             CeecCCCccc
Q psy14147         85 RFKCKLCPKM   94 (100)
Q Consensus        85 ~~~C~~C~~~   94 (100)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            5678888743


No 183
>PRK05978 hypothetical protein; Provisional
Probab=43.45  E-value=7.4  Score=21.60  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=8.0

Q ss_pred             eecCCCccccCC
Q psy14147         86 FKCKLCPKMFTN   97 (100)
Q Consensus        86 ~~C~~C~~~f~~   97 (100)
                      -.|+.||..|..
T Consensus        53 ~~C~~CG~~~~~   64 (148)
T PRK05978         53 DHCAACGEDFTH   64 (148)
T ss_pred             CCccccCCcccc
Confidence            357788777653


No 184
>KOG2231|consensus
Probab=43.34  E-value=43  Score=23.59  Aligned_cols=19  Identities=26%  Similarity=0.433  Sum_probs=10.7

Q ss_pred             eCchhhhhccChhHHHHHH
Q psy14147         30 ACEECGKAFRKKFSLTMHQ   48 (100)
Q Consensus        30 ~c~~C~~~f~~~~~l~~h~   48 (100)
                      .|..|...|.....|..|+
T Consensus       184 ~C~~C~~~fld~~el~rH~  202 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHL  202 (669)
T ss_pred             cchhhhhhhccHHHHHHhh
Confidence            3555555555555555555


No 185
>KOG2231|consensus
Probab=43.15  E-value=40  Score=23.77  Aligned_cols=23  Identities=26%  Similarity=0.619  Sum_probs=14.9

Q ss_pred             cCccccccccChhHHHHHHHhcC
Q psy14147         59 QCDLCLARFVTNSSLIVHKQRHD   81 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~~~~   81 (100)
                      .|..|...|.....|..|++.++
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h  206 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH  206 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce
Confidence            56667777766667777666443


No 186
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=42.27  E-value=11  Score=17.68  Aligned_cols=17  Identities=12%  Similarity=0.333  Sum_probs=12.0

Q ss_pred             cCCCCCeecCCCccccC
Q psy14147         80 HDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        80 ~~~~~~~~C~~C~~~f~   96 (100)
                      +-.+....|+.|+..|.
T Consensus        48 ~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   48 EIVEGELICPECGREYP   64 (68)
T ss_dssp             ETTTTEEEETTTTEEEE
T ss_pred             cccCCEEEcCCCCCEEe
Confidence            34455678888888875


No 187
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.16  E-value=20  Score=22.22  Aligned_cols=9  Identities=44%  Similarity=1.058  Sum_probs=5.4

Q ss_pred             ecCCCcccc
Q psy14147         87 KCKLCPKMF   95 (100)
Q Consensus        87 ~C~~C~~~f   95 (100)
                      .|+.||..|
T Consensus       271 ~C~~Cgt~f  279 (279)
T TIGR00627       271 ICKTCKTAF  279 (279)
T ss_pred             CCCCCCCCC
Confidence            566666554


No 188
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=41.96  E-value=15  Score=14.35  Aligned_cols=11  Identities=18%  Similarity=0.972  Sum_probs=4.6

Q ss_pred             CeecCCCcccc
Q psy14147         85 RFKCKLCPKMF   95 (100)
Q Consensus        85 ~~~C~~C~~~f   95 (100)
                      .|.|+.|+..+
T Consensus        13 kY~Cp~C~~~~   23 (30)
T PF04438_consen   13 KYRCPRCGARY   23 (30)
T ss_dssp             SEE-TTT--EE
T ss_pred             EEECCCcCCce
Confidence            46666666543


No 189
>PF12773 DZR:  Double zinc ribbon
Probab=41.41  E-value=25  Score=15.10  Aligned_cols=9  Identities=22%  Similarity=0.371  Sum_probs=4.7

Q ss_pred             eecCCCccc
Q psy14147         86 FKCKLCPKM   94 (100)
Q Consensus        86 ~~C~~C~~~   94 (100)
                      ..|+.||..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            445555544


No 190
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.25  E-value=13  Score=17.29  Aligned_cols=13  Identities=31%  Similarity=0.524  Sum_probs=7.3

Q ss_pred             CCCCCccCccccc
Q psy14147         53 LNDRRYQCDLCLA   65 (100)
Q Consensus        53 ~~~~~~~c~~c~~   65 (100)
                      ..-..|.|++|..
T Consensus        27 ~PIrtymC~eC~~   39 (68)
T COG4896          27 KPIRTYMCPECEH   39 (68)
T ss_pred             CCceeEechhhHh
Confidence            3344566776654


No 191
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=41.06  E-value=9.6  Score=18.17  Aligned_cols=31  Identities=19%  Similarity=0.475  Sum_probs=15.9

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCcccc
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMF   95 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   95 (100)
                      ...|..|+..+.....       ..+ ..+.|+.|+..|
T Consensus        41 ~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~~   71 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEY-------SCG-ADYFCPICGLYF   71 (71)
T ss_dssp             EEEETTT--EEES-SB-------TT---SEEETTTTEEE
T ss_pred             CeECCCCCCccChhhh-------hcC-CCccCcCcCCCC
Confidence            5567777765544332       111 468898888654


No 192
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=40.48  E-value=14  Score=16.82  Aligned_cols=10  Identities=50%  Similarity=1.155  Sum_probs=6.4

Q ss_pred             ecCCCccccC
Q psy14147         87 KCKLCPKMFT   96 (100)
Q Consensus        87 ~C~~C~~~f~   96 (100)
                      .|+.||+.|.
T Consensus         7 ~C~~Cg~~~~   16 (54)
T PF14446_consen    7 KCPVCGKKFK   16 (54)
T ss_pred             cChhhCCccc
Confidence            5666766664


No 193
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.23  E-value=12  Score=18.91  Aligned_cols=30  Identities=33%  Similarity=0.732  Sum_probs=17.8

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|.|+.|++.-..        +...|  .|.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vk--------R~a~G--IW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVK--------RVATG--IWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEE--------EEETT--EEEETTTTEEEE
T ss_pred             CCcCCCCCCceeE--------EeeeE--EeecCCCCCEEe
Confidence            5778888764311        12233  478888887774


No 194
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=39.56  E-value=39  Score=15.07  Aligned_cols=31  Identities=13%  Similarity=0.320  Sum_probs=17.1

Q ss_pred             cCccccccccChhHHHHHHHhcCCCCCeecCCCcc
Q psy14147         59 QCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPK   93 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   93 (100)
                      .|..|+...+..  ....  ...++....|+.||+
T Consensus        24 ~C~gC~~~l~~~--~~~~--i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQ--ELNE--IRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHH--HHHH--HHcCCCeEECcCCCc
Confidence            566666544222  2222  233456778999986


No 195
>PRK04023 DNA polymerase II large subunit; Validated
Probab=39.53  E-value=23  Score=26.20  Aligned_cols=11  Identities=36%  Similarity=0.857  Sum_probs=6.8

Q ss_pred             CceeCchhhhh
Q psy14147         27 KPYACEECGKA   37 (100)
Q Consensus        27 ~~~~c~~C~~~   37 (100)
                      ....|+.||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            33567777754


No 196
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=39.40  E-value=8.2  Score=17.28  Aligned_cols=26  Identities=23%  Similarity=0.618  Sum_probs=14.3

Q ss_pred             CCceeCchhhhhccChhHHHHHHhhhc
Q psy14147         26 VKPYACEECGKAFRKKFSLTMHQRHVH   52 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h~~~~~   52 (100)
                      ...|.|+.|.+.|-..-++-.|. ..|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE-~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHE-TLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTT-TS-
T ss_pred             CCeEECCCCCCccccCcChhhhc-ccc
Confidence            35699999999998887776676 344


No 197
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=39.31  E-value=6.1  Score=16.24  Aligned_cols=16  Identities=25%  Similarity=0.738  Sum_probs=8.2

Q ss_pred             HHHhcCCCCCeecCCC
Q psy14147         76 HKQRHDNTPRFKCKLC   91 (100)
Q Consensus        76 h~~~~~~~~~~~C~~C   91 (100)
                      |=+...|...|.|..|
T Consensus        20 ~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   20 NGKSPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCCCCEeEecCcC
Confidence            3334445555666655


No 198
>KOG2907|consensus
Probab=38.93  E-value=18  Score=19.11  Aligned_cols=39  Identities=18%  Similarity=0.408  Sum_probs=20.7

Q ss_pred             ccCccccccccChhHHHHHHHhcC-CC-CCeecCCCccccCCC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHD-NT-PRFKCKLCPKMFTNT   98 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~-~~-~~~~C~~C~~~f~~~   98 (100)
                      ..|+.||..=..-..  ..+|+.. |+ .-|.|+.|+..|+..
T Consensus        75 ~kCpkCghe~m~Y~T--~QlRSADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHT--LQLRSADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             ccCcccCCchhhhhh--hhcccccCCceEEEEcCccceeeecc
Confidence            468888753111111  1122322 22 238899999988754


No 199
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=38.71  E-value=11  Score=14.00  Aligned_cols=6  Identities=33%  Similarity=0.966  Sum_probs=2.8

Q ss_pred             cCCCcc
Q psy14147         88 CKLCPK   93 (100)
Q Consensus        88 C~~C~~   93 (100)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            444443


No 200
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=38.61  E-value=45  Score=21.22  Aligned_cols=22  Identities=36%  Similarity=1.031  Sum_probs=11.1

Q ss_pred             CccCccccccccChhHHHHHHH
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      .|.|+.|...|..--+.-.|..
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~  409 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHET  409 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHH
Confidence            4555555555555444444443


No 201
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=38.36  E-value=16  Score=16.62  Aligned_cols=30  Identities=10%  Similarity=0.207  Sum_probs=12.0

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKL   90 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~   90 (100)
                      |.....|+..|..... ..++   .......|+.
T Consensus        24 PV~s~~C~H~fek~aI-~~~i---~~~~~~~CPv   53 (57)
T PF11789_consen   24 PVKSKKCGHTFEKEAI-LQYI---QRNGSKRCPV   53 (57)
T ss_dssp             EEEESSS--EEEHHHH-HHHC---TTTS-EE-SC
T ss_pred             CcCcCCCCCeecHHHH-HHHH---HhcCCCCCCC
Confidence            3444456666654433 2333   2334566665


No 202
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=38.19  E-value=15  Score=15.27  Aligned_cols=12  Identities=17%  Similarity=0.794  Sum_probs=5.6

Q ss_pred             CCCCccCccccc
Q psy14147         54 NDRRYQCDLCLA   65 (100)
Q Consensus        54 ~~~~~~c~~c~~   65 (100)
                      +.+.|.|..|+.
T Consensus        21 ~~~~w~C~~C~~   32 (40)
T PF04810_consen   21 GGKTWICNFCGT   32 (40)
T ss_dssp             TTTEEEETTT--
T ss_pred             CCCEEECcCCCC
Confidence            344566666654


No 203
>KOG1088|consensus
Probab=38.01  E-value=19  Score=19.20  Aligned_cols=19  Identities=11%  Similarity=0.106  Sum_probs=14.0

Q ss_pred             hcCCCCCeecCCCccccCC
Q psy14147         79 RHDNTPRFKCKLCPKMFTN   97 (100)
Q Consensus        79 ~~~~~~~~~C~~C~~~f~~   97 (100)
                      .+-.+....|++||..|.-
T Consensus        92 ~~v~EG~l~CpetG~vfpI  110 (124)
T KOG1088|consen   92 IDVIEGELVCPETGRVFPI  110 (124)
T ss_pred             hhhccceEecCCCCcEeec
Confidence            3444566899999999964


No 204
>KOG2071|consensus
Probab=38.01  E-value=19  Score=24.67  Aligned_cols=28  Identities=25%  Similarity=0.477  Sum_probs=22.3

Q ss_pred             CCCceeCchhhhhccChhHHHHHHhhhcC
Q psy14147         25 CVKPYACEECGKAFRKKFSLTMHQRHVHL   53 (100)
Q Consensus        25 ~~~~~~c~~C~~~f~~~~~l~~h~~~~~~   53 (100)
                      ...|..|..||.+|........||. .|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md-~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMD-IHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhh-hhh
Confidence            3567899999999999988877773 553


No 205
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=37.91  E-value=17  Score=19.89  Aligned_cols=24  Identities=21%  Similarity=0.133  Sum_probs=16.1

Q ss_pred             cCccccccccChhHHHHHHHhcCCCCC
Q psy14147         59 QCDLCLARFVTNSSLIVHKQRHDNTPR   85 (100)
Q Consensus        59 ~c~~c~~~~~~~~~l~~h~~~~~~~~~   85 (100)
                      .|-++|+.|.+   |.+|+.+|.+--|
T Consensus        78 icLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          78 ICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEeccCcchHH---HHHHHhcccCCCH
Confidence            56777777643   7778887766444


No 206
>KOG2636|consensus
Probab=37.01  E-value=21  Score=23.69  Aligned_cols=27  Identities=22%  Similarity=0.455  Sum_probs=18.3

Q ss_pred             cccCCCceeCchhh-hhccChhHHHHHH
Q psy14147         22 ILYCVKPYACEECG-KAFRKKFSLTMHQ   48 (100)
Q Consensus        22 ~~~~~~~~~c~~C~-~~f~~~~~l~~h~   48 (100)
                      .|.-...|.|.+|| .++.-...+..|.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHh
Confidence            34545668899998 5666666666665


No 207
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=36.87  E-value=20  Score=14.20  Aligned_cols=12  Identities=25%  Similarity=0.960  Sum_probs=8.4

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      +-|+|..||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            358888887543


No 208
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=36.74  E-value=18  Score=20.49  Aligned_cols=37  Identities=19%  Similarity=0.372  Sum_probs=20.7

Q ss_pred             ccCccccccccChhHHHH-------HHHhcCCCCCeecCCCccccC
Q psy14147         58 YQCDLCLARFVTNSSLIV-------HKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~-------h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      -.|++|+......+.=..       +...  .+.-+.|+.||+.|.
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~--~~~f~~C~~CgkiYW  141 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRN--YEEFYRCPKCGKIYW  141 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhc--ccceeECCCCccccc
Confidence            369999875433221111       1111  123467999999885


No 209
>PRK04351 hypothetical protein; Provisional
Probab=35.82  E-value=12  Score=20.81  Aligned_cols=31  Identities=29%  Similarity=0.821  Sum_probs=18.5

Q ss_pred             ccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      |.|..|+..+...       +.+ ....|.|..|+..+.
T Consensus       113 Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        113 YECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EECCCCCCEeeee-------eec-CCCcEEeCCCCcEee
Confidence            6787787554321       112 235688888886653


No 210
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=35.40  E-value=9.8  Score=25.47  Aligned_cols=11  Identities=18%  Similarity=0.386  Sum_probs=6.4

Q ss_pred             CCCeecCCCcc
Q psy14147         83 TPRFKCKLCPK   93 (100)
Q Consensus        83 ~~~~~C~~C~~   93 (100)
                      ..|..|+.||.
T Consensus       251 ~~~~~Cp~C~s  261 (505)
T TIGR00595       251 PIPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCCC
Confidence            34556666654


No 211
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=35.40  E-value=22  Score=14.06  Aligned_cols=12  Identities=25%  Similarity=0.941  Sum_probs=8.7

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      +-|+|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            468898888544


No 212
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=35.18  E-value=22  Score=19.75  Aligned_cols=9  Identities=22%  Similarity=0.586  Sum_probs=4.5

Q ss_pred             CccCccccc
Q psy14147         57 RYQCDLCLA   65 (100)
Q Consensus        57 ~~~c~~c~~   65 (100)
                      .+.|..||.
T Consensus       112 ~l~C~~Cg~  120 (146)
T PF07295_consen  112 TLVCENCGH  120 (146)
T ss_pred             eEecccCCC
Confidence            345555554


No 213
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=35.17  E-value=39  Score=17.49  Aligned_cols=36  Identities=17%  Similarity=0.227  Sum_probs=22.7

Q ss_pred             ceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccc
Q psy14147         28 PYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLA   65 (100)
Q Consensus        28 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~   65 (100)
                      .|.|+.-+..|.+...+...+.  .-..+.|.|...|+
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~--~y~~~vwtC~~TGk   38 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMI--LYNQRVWTCEITGK   38 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHH--HHhCCeeEEecCCC
Confidence            4666666777777777666653  23345677776665


No 214
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=34.81  E-value=20  Score=18.19  Aligned_cols=30  Identities=27%  Similarity=0.698  Sum_probs=18.3

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|.|+.|++.-..        +..  .-.+.|..|++.|.
T Consensus        35 ~y~CpfCgk~~vk--------R~a--~GIW~C~~C~~~~A   64 (91)
T TIGR00280        35 KYVCPFCGKKTVK--------RGS--TGIWTCRKCGAKFA   64 (91)
T ss_pred             CccCCCCCCCceE--------EEe--eEEEEcCCCCCEEe
Confidence            5778888754211        112  23588888888774


No 215
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=34.61  E-value=21  Score=18.47  Aligned_cols=12  Identities=25%  Similarity=0.656  Sum_probs=7.4

Q ss_pred             CCCeecCCCccc
Q psy14147         83 TPRFKCKLCPKM   94 (100)
Q Consensus        83 ~~~~~C~~C~~~   94 (100)
                      .+.|.|+.||..
T Consensus        20 ~k~FtCp~Cghe   31 (104)
T COG4888          20 PKTFTCPRCGHE   31 (104)
T ss_pred             CceEecCccCCe
Confidence            455677777654


No 216
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=34.22  E-value=55  Score=21.20  Aligned_cols=19  Identities=32%  Similarity=0.410  Sum_probs=10.5

Q ss_pred             CchhhhhccChhHHHHHHh
Q psy14147         31 CEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        31 c~~C~~~f~~~~~l~~h~~   49 (100)
                      |..|...|-....|..|++
T Consensus       223 C~FC~~~FYdDDEL~~HcR  241 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCR  241 (493)
T ss_pred             hhhccceecChHHHHHHHH
Confidence            5555555555555555554


No 217
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=34.12  E-value=20  Score=16.04  Aligned_cols=15  Identities=20%  Similarity=0.835  Sum_probs=8.4

Q ss_pred             CCCCeecCCCccccC
Q psy14147         82 NTPRFKCKLCPKMFT   96 (100)
Q Consensus        82 ~~~~~~C~~C~~~f~   96 (100)
                      +...|.|.+|++.+.
T Consensus        32 ~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   32 EPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTCEEEETTT--EEE
T ss_pred             CCCEEEeeCCCCEec
Confidence            445577888877654


No 218
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=34.10  E-value=27  Score=15.92  Aligned_cols=10  Identities=30%  Similarity=0.876  Sum_probs=5.7

Q ss_pred             ecCCCccccC
Q psy14147         87 KCKLCPKMFT   96 (100)
Q Consensus        87 ~C~~C~~~f~   96 (100)
                      -|+.|++.|.
T Consensus        41 gCPfC~~~~~   50 (55)
T PF14447_consen   41 GCPFCGTPFE   50 (55)
T ss_pred             CCCCCCCccc
Confidence            3566666554


No 219
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=34.02  E-value=23  Score=22.19  Aligned_cols=13  Identities=31%  Similarity=0.777  Sum_probs=5.8

Q ss_pred             cCCCCCccCccccc
Q psy14147         52 HLNDRRYQCDLCLA   65 (100)
Q Consensus        52 ~~~~~~~~c~~c~~   65 (100)
                      |.+..| .|++|..
T Consensus        55 hL~~qp-~CP~Cr~   67 (391)
T COG5432          55 HLGTQP-FCPVCRE   67 (391)
T ss_pred             HhcCCC-CCccccc
Confidence            334434 2555544


No 220
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=33.72  E-value=14  Score=21.61  Aligned_cols=26  Identities=23%  Similarity=0.471  Sum_probs=0.0

Q ss_pred             ccCCCceeCchhhhh-ccChhHHHHHH
Q psy14147         23 LYCVKPYACEECGKA-FRKKFSLTMHQ   48 (100)
Q Consensus        23 ~~~~~~~~c~~C~~~-f~~~~~l~~h~   48 (100)
                      |.-...|.|.+||.. |.-...+..|-
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ---------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHHhc
Confidence            444556899999963 43445555555


No 221
>PRK05580 primosome assembly protein PriA; Validated
Probab=33.70  E-value=11  Score=26.15  Aligned_cols=13  Identities=15%  Similarity=0.330  Sum_probs=7.6

Q ss_pred             CCCCCeecCCCcc
Q psy14147         81 DNTPRFKCKLCPK   93 (100)
Q Consensus        81 ~~~~~~~C~~C~~   93 (100)
                      +...|..|+.||.
T Consensus       417 ~~~~~~~Cp~Cg~  429 (679)
T PRK05580        417 QEPIPKACPECGS  429 (679)
T ss_pred             CCCCCCCCCCCcC
Confidence            3344666777764


No 222
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=32.82  E-value=24  Score=16.56  Aligned_cols=8  Identities=25%  Similarity=0.833  Sum_probs=4.2

Q ss_pred             ecCCCccc
Q psy14147         87 KCKLCPKM   94 (100)
Q Consensus        87 ~C~~C~~~   94 (100)
                      .||.||..
T Consensus        20 ~CP~Cgs~   27 (64)
T COG2093          20 ICPVCGST   27 (64)
T ss_pred             cCCCCCCc
Confidence            35555544


No 223
>COG2879 Uncharacterized small protein [Function unknown]
Probab=32.78  E-value=61  Score=15.27  Aligned_cols=19  Identities=21%  Similarity=0.191  Sum_probs=12.1

Q ss_pred             ccChhHHHHHHhhhcCCCCC
Q psy14147         38 FRKKFSLTMHQRHVHLNDRR   57 (100)
Q Consensus        38 f~~~~~l~~h~~~~~~~~~~   57 (100)
                      .++..++..||+..|+ .+|
T Consensus        22 vpdYdnYVehmr~~hP-d~p   40 (65)
T COG2879          22 VPDYDNYVEHMRKKHP-DKP   40 (65)
T ss_pred             CCcHHHHHHHHHHhCc-CCC
Confidence            3556778899975454 444


No 224
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=32.54  E-value=25  Score=18.10  Aligned_cols=12  Identities=25%  Similarity=0.653  Sum_probs=9.1

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      +..+|..||..|
T Consensus        87 r~~rC~nCG~~f   98 (98)
T PF10164_consen   87 RERRCSNCGATF   98 (98)
T ss_pred             CccccCCCCccC
Confidence            446789998876


No 225
>KOG1409|consensus
Probab=32.29  E-value=15  Score=23.60  Aligned_cols=39  Identities=18%  Similarity=0.369  Sum_probs=23.0

Q ss_pred             ccCccccccccChhHHHHHHHhcCCCCCeecCCCccccCC
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTN   97 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   97 (100)
                      ..|+.|...|.... ...+.+.-.|-+...|+.||+.+..
T Consensus       283 ~~cQ~c~qpffwn~-~~m~~~k~~glr~h~crkcg~avc~  321 (404)
T KOG1409|consen  283 DSCQKCNQPFFWNF-RQMWDRKQLGLRQHHCRKCGKAVCG  321 (404)
T ss_pred             chhhhhCchHHHHH-HHHHhhhhhhhhhhhhhhhhhhcCc
Confidence            35777877664432 2234444455666778887776643


No 226
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=31.78  E-value=21  Score=19.54  Aligned_cols=33  Identities=24%  Similarity=0.707  Sum_probs=17.9

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|.|..|+..+.      .+.+ +..-..|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~------~~rr-~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR-SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCc------eEcc-ccCcceEEcCCCCCEEE
Confidence            467777775542      1222 12224578888876653


No 227
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=31.17  E-value=26  Score=17.80  Aligned_cols=30  Identities=27%  Similarity=0.646  Sum_probs=18.8

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|.|+.|++.-..        +  .+.-.+.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         36 KYFCPFCGKHAVK--------R--QAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CccCCCCCCCcee--------e--eeeEEEEcCCCCCEEe
Confidence            6788888754211        1  1224688888888775


No 228
>KOG0782|consensus
Probab=31.07  E-value=5.9  Score=27.12  Aligned_cols=27  Identities=22%  Similarity=0.471  Sum_probs=13.1

Q ss_pred             HHHHHHhhhcCCCCCccCccccccccCh
Q psy14147         43 SLTMHQRHVHLNDRRYQCDLCLARFVTN   70 (100)
Q Consensus        43 ~l~~h~~~~~~~~~~~~c~~c~~~~~~~   70 (100)
                      .+..|- .+|....--.|..|++.|.+.
T Consensus       240 ~fvrHH-WVHrrRqeGkC~~CgKgFQQK  266 (1004)
T KOG0782|consen  240 GFVRHH-WVHRRRQEGKCNTCGKGFQQK  266 (1004)
T ss_pred             cchHHh-HhhHhhhccccchhhhhhhhh
Confidence            444444 344433333566666665443


No 229
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=30.77  E-value=18  Score=20.71  Aligned_cols=16  Identities=19%  Similarity=0.459  Sum_probs=12.8

Q ss_pred             CCCeecCCCccccCCC
Q psy14147         83 TPRFKCKLCPKMFTNT   98 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~~   98 (100)
                      .....|..||+.|...
T Consensus       112 ~~~~~C~~Cg~~f~~~  127 (181)
T PRK08222        112 FHLQRCSRCERPFAPQ  127 (181)
T ss_pred             cccCcCcccCCccCcH
Confidence            3577899999999753


No 230
>KOG0717|consensus
Probab=30.47  E-value=32  Score=23.10  Aligned_cols=21  Identities=24%  Similarity=0.512  Sum_probs=18.4

Q ss_pred             ccCccccccccChhHHHHHHH
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      +.|.+|.+.|.+...+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999988888865


No 231
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=30.22  E-value=27  Score=17.73  Aligned_cols=30  Identities=23%  Similarity=0.518  Sum_probs=18.1

Q ss_pred             CccCccccccccChhHHHHHHHhcCCCCCeecCCCccccC
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT   96 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   96 (100)
                      .|.|+.|++.-..        +..  .-.+.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vk--------R~a--~GIW~C~~C~~~~A   65 (90)
T PRK03976         36 KHVCPVCGRPKVK--------RVG--TGIWECRKCGAKFA   65 (90)
T ss_pred             CccCCCCCCCceE--------EEE--EEEEEcCCCCCEEe
Confidence            5778888654211        112  23588888888774


No 232
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=29.83  E-value=5.6  Score=27.81  Aligned_cols=9  Identities=22%  Similarity=0.670  Sum_probs=5.8

Q ss_pred             CCeecCCCc
Q psy14147         84 PRFKCKLCP   92 (100)
Q Consensus        84 ~~~~C~~C~   92 (100)
                      .+..|+.||
T Consensus       139 ~~~~C~~Cg  147 (711)
T TIGR00143       139 QPIACPRCG  147 (711)
T ss_pred             CCccCCCCC
Confidence            355677776


No 233
>KOG1994|consensus
Probab=29.75  E-value=31  Score=20.81  Aligned_cols=25  Identities=20%  Similarity=0.471  Sum_probs=20.6

Q ss_pred             CCCCccCccccccccChhHHHHHHH
Q psy14147         54 NDRRYQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        54 ~~~~~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      ....|-|-.||..|....+|..|-.
T Consensus       236 R~eh~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  236 RSEHYYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             hccceEEEEeccccCCHHHHHHhCC
Confidence            3456889999999999999988743


No 234
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=29.70  E-value=27  Score=18.24  Aligned_cols=11  Identities=27%  Similarity=0.676  Sum_probs=7.8

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      ..||.||..|.
T Consensus        50 t~CP~Cg~~~e   60 (115)
T COG1885          50 TSCPKCGEPFE   60 (115)
T ss_pred             ccCCCCCCccc
Confidence            46888887664


No 235
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=29.62  E-value=56  Score=19.84  Aligned_cols=14  Identities=14%  Similarity=0.541  Sum_probs=8.9

Q ss_pred             CCCCeecCCCcccc
Q psy14147         82 NTPRFKCKLCPKMF   95 (100)
Q Consensus        82 ~~~~~~C~~C~~~f   95 (100)
                      +..+-.||+||.-.
T Consensus       218 ~d~iv~CP~CgRIL  231 (239)
T COG1579         218 KDEIVFCPYCGRIL  231 (239)
T ss_pred             CCCCccCCccchHH
Confidence            45556688887643


No 236
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=29.50  E-value=25  Score=19.22  Aligned_cols=10  Identities=40%  Similarity=1.095  Sum_probs=7.4

Q ss_pred             eecCCCcccc
Q psy14147         86 FKCKLCPKMF   95 (100)
Q Consensus        86 ~~C~~C~~~f   95 (100)
                      -+|+.||..|
T Consensus        30 ~kC~~CG~v~   39 (140)
T COG1545          30 TKCKKCGRVY   39 (140)
T ss_pred             EEcCCCCeEE
Confidence            4688888766


No 237
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.43  E-value=26  Score=18.94  Aligned_cols=15  Identities=27%  Similarity=0.476  Sum_probs=11.7

Q ss_pred             CCCeecCCCccccCC
Q psy14147         83 TPRFKCKLCPKMFTN   97 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~   97 (100)
                      +-|-.|..||+.|.+
T Consensus        66 e~psfchncgs~fpw   80 (160)
T COG4306          66 EPPSFCHNCGSRFPW   80 (160)
T ss_pred             CCcchhhcCCCCCCc
Confidence            345679999999976


No 238
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=29.42  E-value=19  Score=16.42  Aligned_cols=8  Identities=25%  Similarity=1.107  Sum_probs=2.1

Q ss_pred             eecCCCcc
Q psy14147         86 FKCKLCPK   93 (100)
Q Consensus        86 ~~C~~C~~   93 (100)
                      |.|+.||.
T Consensus        34 y~Cp~CgA   41 (55)
T PF05741_consen   34 YVCPICGA   41 (55)
T ss_dssp             ---TTT--
T ss_pred             CcCCCCcC
Confidence            56666664


No 239
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=29.22  E-value=32  Score=18.86  Aligned_cols=13  Identities=23%  Similarity=0.746  Sum_probs=11.0

Q ss_pred             ecCCCccccCCCC
Q psy14147         87 KCKLCPKMFTNTV   99 (100)
Q Consensus        87 ~C~~C~~~f~~~~   99 (100)
                      .||.|..+|.+.+
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            6999999998754


No 240
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=29.20  E-value=36  Score=14.64  Aligned_cols=11  Identities=36%  Similarity=0.727  Sum_probs=6.4

Q ss_pred             CeecCCCcccc
Q psy14147         85 RFKCKLCPKMF   95 (100)
Q Consensus        85 ~~~C~~C~~~f   95 (100)
                      .+.|+.||..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45666666544


No 241
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=29.12  E-value=91  Score=18.27  Aligned_cols=12  Identities=25%  Similarity=0.545  Sum_probs=6.5

Q ss_pred             CccCcccccccc
Q psy14147         57 RYQCDLCLARFV   68 (100)
Q Consensus        57 ~~~c~~c~~~~~   68 (100)
                      ...|..|+..+.
T Consensus        95 ~~~C~~C~~~~~  106 (206)
T cd01410          95 IEVCKSCGPEYV  106 (206)
T ss_pred             cccCCCCCCccc
Confidence            345666665443


No 242
>COG1773 Rubredoxin [Energy production and conversion]
Probab=28.80  E-value=20  Score=16.34  Aligned_cols=12  Identities=25%  Similarity=0.924  Sum_probs=7.7

Q ss_pred             ceeCchhhhhcc
Q psy14147         28 PYACEECGKAFR   39 (100)
Q Consensus        28 ~~~c~~C~~~f~   39 (100)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            467777776553


No 243
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=28.51  E-value=31  Score=19.18  Aligned_cols=12  Identities=25%  Similarity=0.808  Sum_probs=7.6

Q ss_pred             CCeecCCCcccc
Q psy14147         84 PRFKCKLCPKMF   95 (100)
Q Consensus        84 ~~~~C~~C~~~f   95 (100)
                      ..|.|..|++.+
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            456777777654


No 244
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=28.29  E-value=27  Score=17.20  Aligned_cols=10  Identities=30%  Similarity=0.949  Sum_probs=3.5

Q ss_pred             CCCeecCCCc
Q psy14147         83 TPRFKCKLCP   92 (100)
Q Consensus        83 ~~~~~C~~C~   92 (100)
                      .+.|.|+.|+
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            3568888887


No 245
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=28.00  E-value=55  Score=18.45  Aligned_cols=12  Identities=17%  Similarity=0.570  Sum_probs=6.9

Q ss_pred             ccCccccccccC
Q psy14147         58 YQCDLCLARFVT   69 (100)
Q Consensus        58 ~~c~~c~~~~~~   69 (100)
                      ..|..|++.+..
T Consensus       106 ~~C~~C~~~~~~  117 (178)
T PF02146_consen  106 LRCSKCGKEYDR  117 (178)
T ss_dssp             EEETTTSBEEEG
T ss_pred             eeecCCCccccc
Confidence            456666665543


No 246
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=27.93  E-value=38  Score=14.72  Aligned_cols=21  Identities=29%  Similarity=0.510  Sum_probs=15.2

Q ss_pred             eeCchhhhhccChhHHHHHHh
Q psy14147         29 YACEECGKAFRKKFSLTMHQR   49 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~   49 (100)
                      |+|-+|..+-..++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            678888777767777777774


No 247
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=27.76  E-value=30  Score=13.39  Aligned_cols=9  Identities=56%  Similarity=1.124  Sum_probs=3.8

Q ss_pred             eecCCCccc
Q psy14147         86 FKCKLCPKM   94 (100)
Q Consensus        86 ~~C~~C~~~   94 (100)
                      |.|..|++.
T Consensus        28 f~C~~C~~~   36 (39)
T smart00132       28 FKCSKCGKP   36 (39)
T ss_pred             CCCcccCCc
Confidence            344444443


No 248
>PRK07218 replication factor A; Provisional
Probab=27.58  E-value=36  Score=22.51  Aligned_cols=10  Identities=20%  Similarity=0.411  Sum_probs=7.1

Q ss_pred             ccCccccccc
Q psy14147         58 YQCDLCLARF   67 (100)
Q Consensus        58 ~~c~~c~~~~   67 (100)
                      ..||.|++..
T Consensus       298 ~rCP~C~r~v  307 (423)
T PRK07218        298 ERCPECGRVI  307 (423)
T ss_pred             ecCcCccccc
Confidence            4688887765


No 249
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=27.37  E-value=34  Score=15.45  Aligned_cols=11  Identities=18%  Similarity=0.818  Sum_probs=7.8

Q ss_pred             CCCeecCCCcc
Q psy14147         83 TPRFKCKLCPK   93 (100)
Q Consensus        83 ~~~~~C~~C~~   93 (100)
                      +-.|.|+.||.
T Consensus        42 ~i~y~C~~Cg~   52 (54)
T PF10058_consen   42 EIQYRCPYCGA   52 (54)
T ss_pred             ceEEEcCCCCC
Confidence            34588888874


No 250
>PLN02748 tRNA dimethylallyltransferase
Probab=27.35  E-value=48  Score=22.28  Aligned_cols=24  Identities=25%  Similarity=0.418  Sum_probs=19.4

Q ss_pred             CCccCccccc-cccChhHHHHHHHh
Q psy14147         56 RRYQCDLCLA-RFVTNSSLIVHKQR   79 (100)
Q Consensus        56 ~~~~c~~c~~-~~~~~~~l~~h~~~   79 (100)
                      ..|.|..|+. .+.....+..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4568999997 78888888888874


No 251
>PF12591 DUF3762:  Protein of unknown function (DUF3762);  InterPro: IPR022239  This domain family is found in viruses, and is approximately 80 amino acids in length. The family is found in association with PF05533 from PFAM. 
Probab=27.28  E-value=34  Score=16.34  Aligned_cols=11  Identities=18%  Similarity=0.628  Sum_probs=7.6

Q ss_pred             CCCccccCCCC
Q psy14147         89 KLCPKMFTNTV   99 (100)
Q Consensus        89 ~~C~~~f~~~~   99 (100)
                      ..||..|.+.|
T Consensus        70 rkcgrvfps~s   80 (80)
T PF12591_consen   70 RKCGRVFPSGS   80 (80)
T ss_pred             ccccccCCCCC
Confidence            45888887653


No 252
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=26.91  E-value=33  Score=18.21  Aligned_cols=13  Identities=23%  Similarity=0.498  Sum_probs=7.5

Q ss_pred             CCCeecCCCcccc
Q psy14147         83 TPRFKCKLCPKMF   95 (100)
Q Consensus        83 ~~~~~C~~C~~~f   95 (100)
                      .....||.|++..
T Consensus        67 av~V~CP~C~K~T   79 (114)
T PF11023_consen   67 AVQVECPNCGKQT   79 (114)
T ss_pred             ceeeECCCCCChH
Confidence            3445677776543


No 253
>KOG2857|consensus
Probab=26.76  E-value=32  Score=19.09  Aligned_cols=23  Identities=22%  Similarity=0.629  Sum_probs=19.0

Q ss_pred             CCccCccccccccChhHHHHHHH
Q psy14147         56 RRYQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        56 ~~~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      ..|.|+.|...+.+...+..|..
T Consensus        16 ~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   16 IKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hhccCCCCCCccccchhhhhccC
Confidence            36889999998888888888865


No 254
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=26.43  E-value=36  Score=17.72  Aligned_cols=14  Identities=36%  Similarity=1.011  Sum_probs=11.1

Q ss_pred             ceeCchhhhhccCh
Q psy14147         28 PYACEECGKAFRKK   41 (100)
Q Consensus        28 ~~~c~~C~~~f~~~   41 (100)
                      |++|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            57788899888764


No 255
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.40  E-value=32  Score=16.25  Aligned_cols=12  Identities=25%  Similarity=0.454  Sum_probs=7.8

Q ss_pred             eecCCCccccCC
Q psy14147         86 FKCKLCPKMFTN   97 (100)
Q Consensus        86 ~~C~~C~~~f~~   97 (100)
                      -.|+.||+.-.+
T Consensus         8 v~CP~Cgkpv~w   19 (65)
T COG3024           8 VPCPTCGKPVVW   19 (65)
T ss_pred             ccCCCCCCcccc
Confidence            358888876543


No 256
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=26.39  E-value=25  Score=18.05  Aligned_cols=38  Identities=24%  Similarity=0.503  Sum_probs=13.6

Q ss_pred             CCCceeCchhhhhccChhHHHHHHhhhcCCCCC-ccCccccccccC
Q psy14147         25 CVKPYACEECGKAFRKKFSLTMHQRHVHLNDRR-YQCDLCLARFVT   69 (100)
Q Consensus        25 ~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~-~~c~~c~~~~~~   69 (100)
                      +.|.-.|..|+.++...     ++  .-.+++- |-|..|.+-|..
T Consensus        11 g~ke~~CalCG~tWg~~-----y~--Ev~G~rLfFCCd~ca~EF~n   49 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDY-----YE--EVDGERLFFCCDDCAKEFKN   49 (105)
T ss_dssp             -SGGGS-SS---S---S-----S---B-TT--BSSS--SSSS-TTS
T ss_pred             ccccccccccCCcHHHH-----HH--hhcCCEEEEEcHHHHHHHHH
Confidence            44566788888887633     22  2334443 556778777655


No 257
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=26.33  E-value=31  Score=14.93  Aligned_cols=8  Identities=38%  Similarity=0.908  Sum_probs=5.2

Q ss_pred             ecCCCccc
Q psy14147         87 KCKLCPKM   94 (100)
Q Consensus        87 ~C~~C~~~   94 (100)
                      +|+.||..
T Consensus        13 kCp~CGt~   20 (44)
T PF14952_consen   13 KCPKCGTY   20 (44)
T ss_pred             cCCcCcCc
Confidence            57777743


No 258
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=26.26  E-value=31  Score=13.15  Aligned_cols=8  Identities=25%  Similarity=0.891  Sum_probs=3.2

Q ss_pred             ecCCCccc
Q psy14147         87 KCKLCPKM   94 (100)
Q Consensus        87 ~C~~C~~~   94 (100)
                      .|+.||..
T Consensus         1 ~CP~C~s~    8 (28)
T PF03119_consen    1 TCPVCGSK    8 (28)
T ss_dssp             B-TTT--B
T ss_pred             CcCCCCCE
Confidence            37778754


No 259
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=25.84  E-value=36  Score=17.93  Aligned_cols=12  Identities=17%  Similarity=0.539  Sum_probs=8.0

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      .|.|++|+..+.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            477777776664


No 260
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=25.63  E-value=43  Score=23.53  Aligned_cols=10  Identities=20%  Similarity=0.378  Sum_probs=7.8

Q ss_pred             CeecCCCccc
Q psy14147         85 RFKCKLCPKM   94 (100)
Q Consensus        85 ~~~C~~C~~~   94 (100)
                      -+.||.||..
T Consensus       639 ~~~CP~CG~~  648 (656)
T PRK08270        639 HEFCPKCGEE  648 (656)
T ss_pred             CCCCcCCcCc
Confidence            4789999854


No 261
>PHA02942 putative transposase; Provisional
Probab=25.43  E-value=55  Score=21.30  Aligned_cols=13  Identities=23%  Similarity=0.414  Sum_probs=9.6

Q ss_pred             CCCeecCCCcccc
Q psy14147         83 TPRFKCKLCPKMF   95 (100)
Q Consensus        83 ~~~~~C~~C~~~f   95 (100)
                      .+.|.|+.||...
T Consensus       340 ~r~f~C~~CG~~~  352 (383)
T PHA02942        340 HRYFHCPSCGYEN  352 (383)
T ss_pred             CCEEECCCCCCEe
Confidence            4578999998653


No 262
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=25.00  E-value=40  Score=20.56  Aligned_cols=12  Identities=25%  Similarity=0.758  Sum_probs=6.8

Q ss_pred             CccCcccccccc
Q psy14147         57 RYQCDLCLARFV   68 (100)
Q Consensus        57 ~~~c~~c~~~~~   68 (100)
                      .+.|..|+..+.
T Consensus       122 ~~~C~~C~~~~~  133 (250)
T COG0846         122 RVRCSKCGNQYY  133 (250)
T ss_pred             eeEeCCCcCccc
Confidence            455666665543


No 263
>PHA02998 RNA polymerase subunit; Provisional
Probab=24.94  E-value=42  Score=19.44  Aligned_cols=12  Identities=33%  Similarity=0.797  Sum_probs=10.1

Q ss_pred             eecCCCccccCC
Q psy14147         86 FKCKLCPKMFTN   97 (100)
Q Consensus        86 ~~C~~C~~~f~~   97 (100)
                      |.|..||..|.-
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            799999998863


No 264
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=24.57  E-value=24  Score=15.68  Aligned_cols=11  Identities=36%  Similarity=1.120  Sum_probs=7.0

Q ss_pred             eeCchhhhhcc
Q psy14147         29 YACEECGKAFR   39 (100)
Q Consensus        29 ~~c~~C~~~f~   39 (100)
                      |+|..||..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56777776554


No 265
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=24.30  E-value=79  Score=18.70  Aligned_cols=13  Identities=15%  Similarity=0.342  Sum_probs=7.6

Q ss_pred             CccCccccccccC
Q psy14147         57 RYQCDLCLARFVT   69 (100)
Q Consensus        57 ~~~c~~c~~~~~~   69 (100)
                      ...|..|+..+..
T Consensus       113 ~~~C~~C~~~~~~  125 (222)
T cd01413         113 TAYCVNCGSKYDL  125 (222)
T ss_pred             cceECCCCCCcch
Confidence            3467777765543


No 266
>KOG0978|consensus
Probab=24.29  E-value=37  Score=24.02  Aligned_cols=13  Identities=31%  Similarity=0.651  Sum_probs=10.5

Q ss_pred             CeecCCCccccCC
Q psy14147         85 RFKCKLCPKMFTN   97 (100)
Q Consensus        85 ~~~C~~C~~~f~~   97 (100)
                      --+||.|+.+|..
T Consensus       678 qRKCP~Cn~aFga  690 (698)
T KOG0978|consen  678 QRKCPKCNAAFGA  690 (698)
T ss_pred             cCCCCCCCCCCCc
Confidence            3579999999974


No 267
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=24.02  E-value=37  Score=16.81  Aligned_cols=10  Identities=30%  Similarity=0.823  Sum_probs=4.8

Q ss_pred             eecCCCcccc
Q psy14147         86 FKCKLCPKMF   95 (100)
Q Consensus        86 ~~C~~C~~~f   95 (100)
                      |.|+.|++..
T Consensus        66 ~~Cp~Cg~~~   75 (81)
T PF10609_consen   66 FVCPHCGERI   75 (81)
T ss_dssp             EE-TTT--EE
T ss_pred             cCCCCCCCee
Confidence            6788887654


No 268
>PRK03922 hypothetical protein; Provisional
Probab=23.72  E-value=43  Score=17.67  Aligned_cols=10  Identities=30%  Similarity=0.746  Sum_probs=6.6

Q ss_pred             ecCCCccccC
Q psy14147         87 KCKLCPKMFT   96 (100)
Q Consensus        87 ~C~~C~~~f~   96 (100)
                      .||.||..|.
T Consensus        51 ~cP~cge~~~   60 (113)
T PRK03922         51 ICPKCGEPFD   60 (113)
T ss_pred             cCCCCCCcCC
Confidence            4777776664


No 269
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.53  E-value=35  Score=20.66  Aligned_cols=12  Identities=25%  Similarity=0.863  Sum_probs=7.3

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      .+.||+|+-.|.
T Consensus        19 ~ieCPvC~tkFk   30 (267)
T COG1655          19 TIECPVCNTKFK   30 (267)
T ss_pred             eeccCcccchhh
Confidence            456666666654


No 270
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=23.44  E-value=17  Score=20.76  Aligned_cols=30  Identities=23%  Similarity=0.747  Sum_probs=18.5

Q ss_pred             eeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccC
Q psy14147         29 YACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVT   69 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~   69 (100)
                      -.|..|+.+|...         .+.  ..|.|..|.++|..
T Consensus        75 l~C~~C~~Tfk~f---------~~~--g~fGCaeCY~tf~~  104 (176)
T COG3880          75 LGCHNCGMTFKEF---------IQS--GLFGCAECYKTFES  104 (176)
T ss_pred             hcCccccccHHHH---------HHh--cccchHHHHHHHHH
Confidence            5677788776421         122  25678888887754


No 271
>KOG4118|consensus
Probab=23.27  E-value=70  Score=15.19  Aligned_cols=23  Identities=13%  Similarity=0.475  Sum_probs=12.2

Q ss_pred             ccCccccccccChhHHHHHHHhc
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRH   80 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~   80 (100)
                      +.|.+|-.....+..+..|...-
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~k   61 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENK   61 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhc
Confidence            34555555555555555555543


No 272
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=22.98  E-value=78  Score=13.18  Aligned_cols=6  Identities=50%  Similarity=1.481  Sum_probs=1.8

Q ss_pred             eecCCC
Q psy14147         86 FKCKLC   91 (100)
Q Consensus        86 ~~C~~C   91 (100)
                      +.|+.|
T Consensus        37 ~~CP~C   42 (42)
T PF15227_consen   37 FSCPEC   42 (42)
T ss_dssp             ---SSS
T ss_pred             CCCcCC
Confidence            667665


No 273
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=22.45  E-value=42  Score=17.69  Aligned_cols=12  Identities=25%  Similarity=0.667  Sum_probs=10.0

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      -|.|..||..|.
T Consensus       100 Fy~C~~Cg~~wr  111 (113)
T COG1594         100 FYKCTRCGYRWR  111 (113)
T ss_pred             EEEecccCCEee
Confidence            389999998875


No 274
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=22.18  E-value=65  Score=22.15  Aligned_cols=9  Identities=44%  Similarity=1.036  Sum_probs=6.6

Q ss_pred             CeecCCCcc
Q psy14147         85 RFKCKLCPK   93 (100)
Q Consensus        85 ~~~C~~C~~   93 (100)
                      -+.||.||.
T Consensus       532 ~~~CP~CGs  540 (555)
T cd01675         532 GFKCPKCGS  540 (555)
T ss_pred             CCCCcCCCC
Confidence            377888884


No 275
>PRK10220 hypothetical protein; Provisional
Probab=22.00  E-value=53  Score=17.36  Aligned_cols=12  Identities=17%  Similarity=0.664  Sum_probs=8.3

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      .|.|++|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            477777776664


No 276
>PRK06260 threonine synthase; Validated
Probab=21.99  E-value=54  Score=21.26  Aligned_cols=31  Identities=26%  Similarity=0.570  Sum_probs=19.8

Q ss_pred             eeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhH
Q psy14147         29 YACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSS   72 (100)
Q Consensus        29 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~   72 (100)
                      +.|..|+..+.             .....+.|+.|+..+....+
T Consensus         4 ~~C~~cg~~~~-------------~~~~~~~Cp~cg~~l~~~y~   34 (397)
T PRK06260          4 LKCIECGKEYD-------------PDEIIYTCPECGGLLEVIYD   34 (397)
T ss_pred             EEECCCCCCCC-------------CCCccccCCCCCCeEEEEec
Confidence            67888887652             12335779889866554444


No 277
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=21.64  E-value=47  Score=17.32  Aligned_cols=11  Identities=18%  Similarity=0.637  Sum_probs=7.1

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      +.|+.||..+.
T Consensus        32 ~~C~~CGe~~~   42 (127)
T TIGR03830        32 WYCPACGEELL   42 (127)
T ss_pred             eECCCCCCEEE
Confidence            56777776654


No 278
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=21.52  E-value=69  Score=23.46  Aligned_cols=11  Identities=45%  Similarity=1.216  Sum_probs=6.7

Q ss_pred             eCchhhhhccC
Q psy14147         30 ACEECGKAFRK   40 (100)
Q Consensus        30 ~c~~C~~~f~~   40 (100)
                      .|..|++.|..
T Consensus       462 tC~~C~kkFfS  472 (1374)
T PTZ00303        462 SCPSCGRAFIS  472 (1374)
T ss_pred             cccCcCCcccc
Confidence            46666666643


No 279
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=21.42  E-value=92  Score=18.80  Aligned_cols=13  Identities=31%  Similarity=0.754  Sum_probs=7.7

Q ss_pred             CccCccccccccC
Q psy14147         57 RYQCDLCLARFVT   69 (100)
Q Consensus        57 ~~~c~~c~~~~~~   69 (100)
                      ...|..|+..+..
T Consensus       119 ~~~C~~C~~~~~~  131 (244)
T PRK14138        119 EYYCVRCGKRYTV  131 (244)
T ss_pred             eeEECCCCCcccH
Confidence            3457777766543


No 280
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=21.37  E-value=54  Score=21.28  Aligned_cols=22  Identities=18%  Similarity=0.348  Sum_probs=18.9

Q ss_pred             CccCccccccccChhHHHHHHH
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQ   78 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~   78 (100)
                      .+-|..|++.|....-+..|+.
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHh
Confidence            4679999999999888988876


No 281
>PF05265 DUF723:  Protein of unknown function (DUF723);  InterPro: IPR007929 This family contains several uncharacterised proteins from Neisseria meningitidis. These proteins may have a role in DNA binding.
Probab=21.19  E-value=1.1e+02  Score=14.29  Aligned_cols=28  Identities=11%  Similarity=0.202  Sum_probs=12.7

Q ss_pred             ccCccccccccChhHHHHHHHhcCCCCCeecCCCc
Q psy14147         58 YQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCP   92 (100)
Q Consensus        58 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~   92 (100)
                      ..|+.-|......  ++...++..|     ||.||
T Consensus        33 I~CP~HG~~~~s~--~~~~~~sk~G-----CP~Cg   60 (60)
T PF05265_consen   33 IRCPKHGNFTCST--FNSFIKSKHG-----CPECG   60 (60)
T ss_pred             EECCCCCcEEecc--HHhhhhhccC-----CCCCC
Confidence            3566555443332  2333333332     77765


No 282
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=20.93  E-value=1.4e+02  Score=18.54  Aligned_cols=13  Identities=15%  Similarity=0.350  Sum_probs=8.1

Q ss_pred             CccCccccccccC
Q psy14147         57 RYQCDLCLARFVT   69 (100)
Q Consensus        57 ~~~c~~c~~~~~~   69 (100)
                      ...|..|+..+..
T Consensus       137 ~~~C~~C~~~~~~  149 (271)
T PTZ00409        137 EARCCTCRKTIQL  149 (271)
T ss_pred             cceeCCCCCCccc
Confidence            3567777766543


No 283
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=20.93  E-value=1.2e+02  Score=14.37  Aligned_cols=39  Identities=18%  Similarity=0.346  Sum_probs=14.9

Q ss_pred             ccCc--cccccccChhHHHHHHHhcCCCC-Ce-----ecCCCccccCC
Q psy14147         58 YQCD--LCLARFVTNSSLIVHKQRHDNTP-RF-----KCKLCPKMFTN   97 (100)
Q Consensus        58 ~~c~--~c~~~~~~~~~l~~h~~~~~~~~-~~-----~C~~C~~~f~~   97 (100)
                      ..|+  .|+..|... -|..+++...+.+ .|     .||.|.+..+.
T Consensus        21 ~~C~n~~C~~~fH~~-CL~~wf~~~~~~~~~~~~~~G~CP~C~~~i~~   67 (70)
T PF11793_consen   21 VVCPNPSCGKKFHLL-CLSEWFLSLEKSRQSFIPIFGECPYCSSPISW   67 (70)
T ss_dssp             B--S-TT----B-SG-GGHHHHHHHHSSS-TTT--EEE-TTT-SEEEG
T ss_pred             eEcCCcccCCHHHHH-HHHHHHHHcccCCeeecccccCCcCCCCeeeE
Confidence            3564  688777554 4445544322221 12     68999876553


No 284
>KOG3456|consensus
Probab=20.92  E-value=46  Score=17.49  Aligned_cols=14  Identities=21%  Similarity=0.465  Sum_probs=10.9

Q ss_pred             CCeecCCCccccCC
Q psy14147         84 PRFKCKLCPKMFTN   97 (100)
Q Consensus        84 ~~~~C~~C~~~f~~   97 (100)
                      .+..|.+||-.|.+
T Consensus       103 ~~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  103 GPHICGYCGLRFVQ  116 (120)
T ss_pred             CCcccccchhhhhh
Confidence            45789999988863


No 285
>PRK12496 hypothetical protein; Provisional
Probab=20.90  E-value=53  Score=18.55  Aligned_cols=12  Identities=42%  Similarity=0.775  Sum_probs=9.4

Q ss_pred             CeecCCCccccC
Q psy14147         85 RFKCKLCPKMFT   96 (100)
Q Consensus        85 ~~~C~~C~~~f~   96 (100)
                      .|.|.-|++.|.
T Consensus       127 ~~~C~gC~~~~~  138 (164)
T PRK12496        127 RKVCKGCKKKYP  138 (164)
T ss_pred             eEECCCCCcccc
Confidence            367888998885


No 286
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=20.73  E-value=45  Score=14.79  Aligned_cols=9  Identities=33%  Similarity=0.700  Sum_probs=5.9

Q ss_pred             eecCCCccc
Q psy14147         86 FKCKLCPKM   94 (100)
Q Consensus        86 ~~C~~C~~~   94 (100)
                      -.||.||-.
T Consensus        14 ~~Cp~CGN~   22 (49)
T PF12677_consen   14 CKCPKCGND   22 (49)
T ss_pred             ccCcccCCc
Confidence            368888744


No 287
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=20.60  E-value=51  Score=20.54  Aligned_cols=12  Identities=17%  Similarity=0.302  Sum_probs=8.3

Q ss_pred             ccCccccccccC
Q psy14147         58 YQCDLCLARFVT   69 (100)
Q Consensus        58 ~~c~~c~~~~~~   69 (100)
                      +.|+.|+..|.-
T Consensus        46 ~vc~~c~~h~rl   57 (285)
T TIGR00515        46 EVCPKCDHHMRM   57 (285)
T ss_pred             CCCCCCCCcCcC
Confidence            468888876643


No 288
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=20.42  E-value=52  Score=13.85  Aligned_cols=10  Identities=20%  Similarity=0.514  Sum_probs=6.0

Q ss_pred             ecCCCccccC
Q psy14147         87 KCKLCPKMFT   96 (100)
Q Consensus        87 ~C~~C~~~f~   96 (100)
                      .|+.||..+.
T Consensus         4 ~C~~Cg~~l~   13 (47)
T PF13005_consen    4 ACPDCGGELK   13 (47)
T ss_pred             cCCCCCceee
Confidence            4666766554


No 289
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=20.41  E-value=39  Score=19.74  Aligned_cols=9  Identities=22%  Similarity=1.125  Sum_probs=5.1

Q ss_pred             CCccCcccc
Q psy14147         56 RRYQCDLCL   64 (100)
Q Consensus        56 ~~~~c~~c~   64 (100)
                      +.|.|..|+
T Consensus       151 kGfiCe~C~  159 (202)
T PF13901_consen  151 KGFICEICN  159 (202)
T ss_pred             CCCCCccCC
Confidence            455666664


No 290
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=20.39  E-value=56  Score=16.35  Aligned_cols=11  Identities=45%  Similarity=0.969  Sum_probs=8.3

Q ss_pred             ecCCCccccCC
Q psy14147         87 KCKLCPKMFTN   97 (100)
Q Consensus        87 ~C~~C~~~f~~   97 (100)
                      .|..|++.+.+
T Consensus        80 ~C~vC~k~l~~   90 (109)
T PF10367_consen   80 KCSVCGKPLGN   90 (109)
T ss_pred             CccCcCCcCCC
Confidence            48888887764


No 291
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=20.21  E-value=49  Score=14.44  Aligned_cols=11  Identities=27%  Similarity=0.785  Sum_probs=7.2

Q ss_pred             eecCCCccccC
Q psy14147         86 FKCKLCPKMFT   96 (100)
Q Consensus        86 ~~C~~C~~~f~   96 (100)
                      ..|..||..+.
T Consensus         6 l~C~~CG~~m~   16 (58)
T PF13408_consen    6 LRCGHCGSKMT   16 (58)
T ss_pred             EEcccCCcEeE
Confidence            45777776654


No 292
>PTZ00448 hypothetical protein; Provisional
Probab=20.15  E-value=91  Score=20.37  Aligned_cols=23  Identities=13%  Similarity=0.369  Sum_probs=17.4

Q ss_pred             CccCccccccccChhHHHHHHHh
Q psy14147         57 RYQCDLCLARFVTNSSLIVHKQR   79 (100)
Q Consensus        57 ~~~c~~c~~~~~~~~~l~~h~~~   79 (100)
                      .|.|..|+-.|........|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57799999888777666677663


No 293
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=20.06  E-value=45  Score=19.70  Aligned_cols=16  Identities=25%  Similarity=0.663  Sum_probs=12.6

Q ss_pred             CCCeecCCCccccCCC
Q psy14147         83 TPRFKCKLCPKMFTNT   98 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~~   98 (100)
                      .-||.|..|.+.|.+.
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            3589999998888654


Done!