Diaphorina citri psyllid: psy14196


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MSIGIPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGTYYLPALVPIAGMWNGTSGLRWATQE
cccccHHHHHHHHcccEEEEEEccccEEEEEEccccccccEEEEEEEEEccccccccccEEEEEccccccccEEEEEcc
*SIGIPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGTYYLPALVPIAGMWNGTSGLRWA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIGIPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGTYYLPALVPIAGMWNGTSGLRWATQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small nuclear ribonucleoprotein Sm D3 Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.confidentP62318
Small nuclear ribonucleoprotein Sm D3 Required for pre-mRNA splicing. Required for snRNP biogenesis.confidentO44437
Small nuclear ribonucleoprotein Sm D3 Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing (By similarity). Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.confidentP62320

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071208 [MF]histone pre-mRNA DCP bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005689 [CC]U12-type spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005683 [CC]U7 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005682 [CC]U5 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0034660 [BP]ncRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0000387 [BP]spliceosomal snRNP assemblyprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0046540 [CC]U4/U6 x U5 tri-snRNP complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0048542 [BP]lymph gland developmentprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0048534, GO:0044699, GO:0002520
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0008334 [BP]histone mRNA metabolic processprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0071004 [CC]U2-type prespliceosomeprobableGO:0005575, GO:0005622, GO:0032991, GO:0043231, GO:0071010, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005684, GO:0043227, GO:0043226, GO:0005681
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0005685 [CC]U1 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0045451 [BP]pole plasm oskar mRNA localizationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D3B, chain A
Confidence level:very confident
Coverage over the Query: 4-77
View the alignment between query and template
View the model in PyMOL