Diaphorina citri psyllid: psy14198


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MLAHLARVRQISWKKLCTAIQPRCFHRTPQSYAVPMSKFDKDHLPYGKLEKTLQVIRKRLNRPLTLSEKILYSHIDDPEKQDIERGVSYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTNDSIVPLPCRRKSSTLTLMTLRNKT
cHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccHHccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccc
****LARVRQISWKKLCTAIQPRCFHRTPQSYAVPMSKFDKDHLPYGKLEKTLQVIRKRLNRPLTLSEKILYSHIDDPEKQDIERGVSYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTNDSIVPLPCRRKSSTLTLMTLR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAHLARVRQISWKKLCTAIQPRCFHRTPQSYAVPMSKFDKDHLPYGKLEKTLQVIRKRLNRPLTLSEKILYSHIDDPEKQDIERGVSYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTNDSIVPLPCRRKSSTLTLMTLRNKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aconitate hydratase, mitochondrial Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.confidentP20004
Aconitate hydratase, mitochondrial Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.confidentP16276
Aconitate hydratase, mitochondrial Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.confidentQ99798

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008152 [BP]metabolic processconfidentGO:0008150
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051538 [MF]3 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0006101 [BP]citrate metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0072350
GO:0006102 [BP]isocitrate metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0072350
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0044416 [BP]induction by symbiont of host defense responseprobableGO:0050896, GO:0048584, GO:0048583, GO:0031349, GO:0052200, GO:0050789, GO:0031347, GO:0075136, GO:0052031, GO:0052509, GO:0044419, GO:0051817, GO:0048518, GO:0065007, GO:0065008, GO:0052510, GO:0052251, GO:0008150, GO:0052255, GO:0051701, GO:0051707, GO:0044003, GO:0051704, GO:0052173, GO:0009607, GO:0080134, GO:0044403, GO:0035821
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0052632 [MF]citrate hydro-lyase (cis-aconitate-forming) activityprobableGO:0016835, GO:0016836, GO:0003824, GO:0003674, GO:0003994, GO:0016829
GO:0052633 [MF]isocitrate hydro-lyase (cis-aconitate-forming) activityprobableGO:0016835, GO:0016836, GO:0003824, GO:0003674, GO:0003994, GO:0016829
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0042645 [CC]mitochondrial nucleoidprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006099 [BP]tricarboxylic acid cycleprobableGO:0044238, GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0009060, GO:0008150, GO:0008152, GO:0045333, GO:0006091, GO:0055114
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1C96, chain A
Confidence level:very confident
Coverage over the Query: 32-135
View the alignment between query and template
View the model in PyMOL