Diaphorina citri psyllid: psy14208

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MLKDKGTQTFEDKWPSMRPIVLKLLQQEPVSQNEWQNLFYAVHVVCLWDEKGPSKIVDALKEDIMNFIRHAQQRVLAHEEDQALLKAYIQEWSKFLAQCSYLPTPFRQLETSLVNKSVSTSLTNNNNKQKISAEESTVRVLMLDSWNQSIFNDIKQRLQDSAMKLVQSERNGEAFDSQLVIGVRESYVNLCSNPEDKLQIYREHFEKAYIAATESFYTVKAAEFLQNNGVESYMKYADAKLHEEELRACKYLESSSSVQLLTDCCVTVLVSSFKNTILAECPKMIKMNETLKLELMMKLLDRIKDGITPMLQDLEAHIVNAGLADMIASADIITQDSEKYVERLLELFNQFSKLVKDAFKDDPRFLTARDKAYKNVVNDTTVFKLELPTKQCTGIKTLPESKCPELLANYCDMLLRKTPLSKRLTADEIESKLRNVLLVLKYVQNKDVFMRFHKAHLTRRLILDTSADSEKEENMVEWLRDVGMPADYVNKLARMFQDIKVSQDLNYQFKQSYRGSKGSIGDSINIKILNAGAWARGSERVTVSLPLELEDYIPEVEDFYKKKHSGRKLQWYHHMSNGTITFSNEVGKYDLDVTTFQMAVLFAWNERPLDRLSFENLLLATELPDPELRRTLWSLVAFPKIKRQILLYSEEVQSPKDFTEHTSFWINQEFALVKMGKILKRGKINLIGRLQLSTEKSKEEDNESIVQLRILRVQEAIIKILKMRKRISNAQLQTELVDILKNMFLPSKKMIKEQIEWLIEQKYMRRDDDDINVFVYLA
cccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHcccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEccccccEEEEEEECccCEEEEEcHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHccccccHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccEEEcc
*****GT**FEDKWPSMRPIVLKLLQQEPVSQNEWQNLFYAVHVVCLWDEKGPSKIVDALKEDIMNFIRHAQQRVLAHEEDQALLKAYIQEWSKFLAQCSYLPTPFRQLETSLVNKS************KISAEESTVRVLMLDSWNQSIFNDIKQRLQDSAMKLVQSERNGEAFDSQLVIGVRESYVNLCSNPEDKLQIYREHFEKAYIAATESFYTVKAAEFLQNNGVESYMKYADAKLHEEELRACKYLESSSSVQLLTDCCVTVLVSSFKNTILAECPKMIKMNETLKLELMMKLLDRIKDGITPMLQDLEAHIVNAGLADMIASADIITQDSEKYVERLLELFNQFSKLVKDAFKDDPRFLTARDKAYKNVVNDTTVFKLELPT*********PESKCPELLANYCDMLLRKTPLSKRLTADEIESKLRNVLLVLKYVQNKDVFMRFHKAHLTRRLILDTSADSEKEENMVEWLRDVGMPADYVNKLARMFQDIKVSQDLNYQFKQSYRGSKGSIGDSINIKILNAGAWARGSERVTVSLPLELEDYIPEVEDFYKKKHSGRKLQWYHHMSNGTITFSNEVGKYDLDVTTFQMAVLFAWNERPLDRLSFENLLLATELPDPELRRTLWSLVAFPKIKRQILLYSEEVQSPKDFTEHTSFWINQEFALVKMGKILKRGKINLIGRLQL***********SIVQLRILRVQEAIIKILKMRKRISNAQLQTELVDILKNMFLPSKKMIKEQIEWLIEQKYMRRDDDDINVFVYLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKDKGTQTFEDKWPSMRPIVLKLLQQEPVSQNEWQNLFYAVHVVCLWDEKGPSKIVDALKEDIMNFIRHAQQRVLAHEEDQALLKAYIQEWSKFLAQCSYLPTPFRQLETSLVNKSVSTSLTNNNNKQKISAEESTVRVLMLDSWNQSIFNDIKQRLQDSAMKLVQSERNGEAFDSQLVIGVRESYVNLCSNPEDKLQIYREHFEKAYIAATESFYTVKAAEFLQNNGVESYMKYADAKLHEEELRACKYLESSSSVQLLTDCCVTVLVSSFKNTILAECPKMIKMNETLKLELMMKLLDRIKDGITPMLQDLEAHIVNAGLADMIASADIITQDSEKYVERLLELFNQFSKLVKDAFKDDPRFLTARDKAYKNVVNDTTVFKLELPTKQCTGIKTLPESKCPELLANYCDMLLRKTPLSKRLTADEIESKLRNVLLVLKYVQNKDVFMRFHKAHLTRRLILDTSADSEKEENMVEWLRDVGMPADYVNKLARMFQDIKVSQDLNYQFKQSYRGSKGSIGDSINIKILNAGAWARGSERVTVSLPLELEDYIPEVEDFYKKKHSGRKLQWYHHMSNGTITFSNEVGKYDLDVTTFQMAVLFAWNERPLDRLSFENLLLATELPDPELRRTLWSLVAFPKIKRQILLYSEEVQSPKDFTEHTSFWINQEFALVKMGKILKRGKINLIGRLQLSTEKSKEEDNESIVQLRILRVQEAIIKILKMRKRISNAQLQTELVDILKNMFLPSKKMIKEQIEWLIEQKYMRRDDDDINVFVYLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-5 Core component of multiple SCF-like ECS (Elongin BC-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAk2. Seems to be involved poteosomal degradation of p53/TP53 stimulated by adenovirus E1B-55 kDa protein. May form a cell surface vasopressin receptor.very confidentQ9JJ31
Cullin-5 Core component of multiple SCF-like ECS (Elongin BC-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAk2. Seems to be involved poteosomal degradation of p53/TP53 stimulated by adenovirus E1B-55 kDa protein. May form a cell surface vasopressin receptor.very confidentQ9D5V5
Cullin-5 Core component of multiple SCF-like ECS (Elongin BC-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAk2. Seems to be involved poteosomal degradation of p53/TP53 stimulated by adenovirus E1B-55 kDa protein. May form a cell surface vasopressin receptor.very confidentQ29425

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031466 [CC]Cul5-RING ubiquitin ligase complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0031625 [MF]ubiquitin protein ligase bindingconfidentGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000003 [BP]reproductionconfidentGO:0008150
GO:0007050 [BP]cell cycle arrestconfidentGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0004842 [MF]ubiquitin-protein ligase activityconfidentGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005000 [MF]vasopressin receptor activityconfidentGO:0008528, GO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0008285 [BP]negative regulation of cell proliferationconfidentGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0008283 [BP]cell proliferationconfidentGO:0008150, GO:0044699
GO:0006970 [BP]response to osmotic stressconfidentGO:0009628, GO:0006950, GO:0008150, GO:0050896
GO:0097193 [BP]intrinsic apoptotic signaling pathwayconfidentGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0097190, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007569, GO:0050789, GO:0044699
GO:0005262 [MF]calcium channel activityconfidentGO:0022891, GO:0015085, GO:0022892, GO:0005261, GO:0022890, GO:0005215, GO:0005216, GO:0008324, GO:0072509, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0046873, GO:0022838
GO:0000082 [BP]G1/S transition of mitotic cell cycleconfidentGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006511 [BP]ubiquitin-dependent protein catabolic processconfidentGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0000209 [BP]protein polyubiquitinationconfidentGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0051480 [BP]cytosolic calcium ion homeostasisconfidentGO:0019725, GO:0072507, GO:0072503, GO:0006875, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0070588 [BP]calcium ion transmembrane transportconfidentGO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0055085, GO:0044699
GO:0016032 [BP]viral reproductionconfidentGO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0007528 [BP]neuromuscular junction developmentprobableGO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0019048 [BP]virus-host interactionprobableGO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0016360 [BP]sensory organ precursor cell fate determinationprobableGO:0060582, GO:0032501, GO:0060581, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0010160, GO:0048869, GO:0001709, GO:0048513, GO:0048645, GO:0048646, GO:0032502, GO:0009887, GO:0030154, GO:0009987, GO:0044767, GO:0008052, GO:0008150, GO:0003002, GO:0048731, GO:0045165, GO:0048859, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0051729 [BP]germline cell cycle switching, mitotic to meiotic cell cycleprobableGO:2000243, GO:2000241, GO:0022402, GO:0050789, GO:0044699, GO:0007346, GO:0045786, GO:0045787, GO:0065007, GO:0007049, GO:0048518, GO:0048519, GO:0045930, GO:0060184, GO:0009987, GO:0050794, GO:0044763, GO:0051445, GO:0051446, GO:0051726, GO:0051728, GO:0008150, GO:0048523, GO:0048522
GO:0007293 [BP]germarium-derived egg chamber formationprobableGO:0032502, GO:0007292, GO:0044702, GO:0000003, GO:0032504, GO:0022414, GO:0048856, GO:0019953, GO:0044767, GO:0003006, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0009653, GO:0048477, GO:0048646, GO:0048609
GO:0008582 [BP]regulation of synaptic growth at neuromuscular junctionprobableGO:0048638, GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0040008, GO:0060284, GO:0065007, GO:0048641, GO:0065008, GO:1901861, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0044763
GO:0007295 [BP]growth of a germarium-derived egg chamberprobableGO:0032502, GO:0044767, GO:0044702, GO:0032504, GO:0040007, GO:0048589, GO:0022414, GO:0019953, GO:0007292, GO:0003006, GO:0032501, GO:0008150, GO:0007276, GO:0048609, GO:0048477, GO:0044699, GO:0000003
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0019005 [CC]SCF ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DPL, chain C
Confidence level:very confident
Coverage over the Query: 400-778
View the alignment between query and template
View the model in PyMOL
Template: 2WZK, chain A
Confidence level:very confident
Coverage over the Query: 7-116,133-385
View the alignment between query and template
View the model in PyMOL