Diaphorina citri psyllid: psy14232


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MVEEVQKKLENELNLFKQCQKEYQKVLNQRQLLSAQLNENESVQKYCNIVHLDLGWESSRDGLKFCTARMGRLLDKMSASAFDLFHDRQERERGSLSWYSKKSLDFPKSKDS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
*********ENELNLFKQCQKEYQKVLNQRQLLSAQLNENESVQKYCNIVHLDLGWESSRDGLKFCTARMGRLLDKMSASAFDLFHDRQER******WYSK****F******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxxxxxxxxRQLLSAQLNENESVQKYCNIVHLDLGWESSRDGLKFCTARMGRLLDKMSASAFDLFHDRQERERGSLSWYSKKSLDFPKSKDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016272 [CC]prefoldin complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051131 [BP]chaperone-mediated protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZQM, chain A
Confidence level:confident
Coverage over the Query: 4-81
View the alignment between query and template
View the model in PyMOL