Diaphorina citri psyllid: psy14233


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MSGDGLVKAFLNEWCQKNSKQPEFDVRAAGPKHRQRFLCELRIAGIGYVGAGNSTNKKDAQTNAAKDFVQYLVRSGQVNERDVPVENIPMTPTGPSVTVNTSKRFSFIRRSSIGLPRSYEQQ
ccccHHHHHHHHHHHHccccccEEEEEccccccccEEEEEEEEccCEEEEECccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEccccccccccccccc
*****LVKAFLNEWCQKNSKQPEFDVRAAGPKHRQRFLCELRIAGIGYVGAG**********NAAKDFVQYLVRSGQ*********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGDGLVKAFLNEWCQKNSKQPEFDVRAAGPKHRQRFLCELRIAGIGYVGAGNSTNKKDAQTNAAKDFVQYLVRSGQVNERDVPVENIPMTPTGPSVTVNTSKRFSFIRRSSIGLPRSYEQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent RNA helicase A Component of the CRD-mediated complex that promotes MYC mRNA stability. Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.confidentQ28141
Probable ATP-dependent RNA helicase A Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Generates multiple secondary structures that influence RNA-binding proteins (By similarity). Transcriptional regulator that controls germline mitosis and development via histone modification.confidentQ22307
Dosage compensation regulator Required in males for dosage compensation of X chromosome linked genes. Mle, msl-1 and msl-3 are colocalized on X chromosome. Each of the msl proteins requires all the other msls for wild-type X-chromosome binding. Probably unwinds double-stranded DNA and RNA in a 3' to 5' direction.confidentP24785

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005665 [CC]DNA-directed RNA polymerase II, core complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0000805 [CC]X chromosomeprobableGO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WHQ, chain A
Confidence level:very confident
Coverage over the Query: 2-87
View the alignment between query and template
View the model in PyMOL