BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy14245
(181 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In
Complex With Amp
Length = 663
Score = 27.7 bits (60), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 5/51 (9%)
Query: 129 ALLCLTYTHDTSLEMVAF----LTFLTGLVQLTCGLLSLGKCKSYLYYGTP 175
ALL + YT DT E V F + ++TG + G L G C + ++ GTP
Sbjct: 291 ALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYG-CATLVFEGTP 340
>pdb|3P24|A Chain A, Structure Of Profragilysin-3 From Bacteroides Fragilis
pdb|3P24|B Chain B, Structure Of Profragilysin-3 From Bacteroides Fragilis
pdb|3P24|C Chain C, Structure Of Profragilysin-3 From Bacteroides Fragilis
pdb|3P24|D Chain D, Structure Of Profragilysin-3 From Bacteroides Fragilis
Length = 397
Score = 26.6 bits (57), Expect = 9.0, Method: Compositional matrix adjust.
Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 9/72 (12%)
Query: 57 LAWLPKYNVNAAVSDVLAGITVGLTLIPQAIAY--ASLAGLN----PKYGLYSSIFGGVM 110
++WL YNVN A +G++ + P +A+ + G N PK +YS G
Sbjct: 316 ISWLNSYNVNTASDFKASGMSTTQLMYPGVMAHELGHILGANHADDPKDLMYSKYTG--- 372
Query: 111 YIFLGTTKQLSV 122
Y+F + K + +
Sbjct: 373 YLFHLSEKNMDI 384
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.139 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,608,096
Number of Sequences: 62578
Number of extensions: 148981
Number of successful extensions: 304
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 304
Number of HSP's gapped (non-prelim): 3
length of query: 181
length of database: 14,973,337
effective HSP length: 93
effective length of query: 88
effective length of database: 9,153,583
effective search space: 805515304
effective search space used: 805515304
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)