BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy14245
         (181 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In
           Complex With Amp
          Length = 663

 Score = 27.7 bits (60), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 129 ALLCLTYTHDTSLEMVAF----LTFLTGLVQLTCGLLSLGKCKSYLYYGTP 175
           ALL + YT DT  E V F    + ++TG   +  G L  G C + ++ GTP
Sbjct: 291 ALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYG-CATLVFEGTP 340


>pdb|3P24|A Chain A, Structure Of Profragilysin-3 From Bacteroides Fragilis
 pdb|3P24|B Chain B, Structure Of Profragilysin-3 From Bacteroides Fragilis
 pdb|3P24|C Chain C, Structure Of Profragilysin-3 From Bacteroides Fragilis
 pdb|3P24|D Chain D, Structure Of Profragilysin-3 From Bacteroides Fragilis
          Length = 397

 Score = 26.6 bits (57), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 57  LAWLPKYNVNAAVSDVLAGITVGLTLIPQAIAY--ASLAGLN----PKYGLYSSIFGGVM 110
           ++WL  YNVN A     +G++    + P  +A+    + G N    PK  +YS   G   
Sbjct: 316 ISWLNSYNVNTASDFKASGMSTTQLMYPGVMAHELGHILGANHADDPKDLMYSKYTG--- 372

Query: 111 YIFLGTTKQLSV 122
           Y+F  + K + +
Sbjct: 373 YLFHLSEKNMDI 384


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.139    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,608,096
Number of Sequences: 62578
Number of extensions: 148981
Number of successful extensions: 304
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 304
Number of HSP's gapped (non-prelim): 3
length of query: 181
length of database: 14,973,337
effective HSP length: 93
effective length of query: 88
effective length of database: 9,153,583
effective search space: 805515304
effective search space used: 805515304
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)