Query         psy14251
Match_columns 76
No_of_seqs    6 out of 8
Neff          1.7 
Searched_HMMs 46136
Date          Fri Aug 16 23:13:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14251.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14251hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04272 ZnMc_salivary_gland_MP  92.2    0.19 4.2E-06   34.7   3.3   50    8-59     58-107 (220)
  2 PF01328 Peroxidase_2:  Peroxid  74.0     1.8 3.9E-05   33.5   1.3   14   32-45    228-241 (317)
  3 cd04898 ACT_ACR-like_4 ACT dom  70.7    0.92   2E-05   30.0  -0.8   14   46-59     14-27  (77)
  4 PF14331 ImcF-related_N:  ImcF-  69.2     2.4 5.3E-05   30.8   1.0   26   30-58     47-81  (266)
  5 cd04273 ZnMc_ADAMTS_like Zinc-  64.2     8.9 0.00019   26.2   2.9   35   25-59     67-106 (207)
  6 PF07056 DUF1335:  Protein of u  61.7       3 6.6E-05   30.0   0.3   31   21-51     39-73  (131)
  7 PRK14022 UDP-N-acetylmuramoyla  54.3     9.8 0.00021   29.1   2.0   28   26-55     90-119 (481)
  8 PRK00139 murE UDP-N-acetylmura  51.2      12 0.00026   28.5   2.0   28   26-55     75-104 (460)
  9 PF00009 GTP_EFTU:  Elongation   46.8      12 0.00026   24.4   1.3   18   39-59    118-135 (188)
 10 TIGR01143 murF UDP-N-acetylmur  46.3      20 0.00043   26.8   2.5   28   26-55     56-83  (417)
 11 cd04269 ZnMc_adamalysin_II_lik  45.4      26 0.00057   23.3   2.8   33   26-58     65-98  (194)
 12 PF14698 ASL_C2:  Argininosucci  45.3      12 0.00027   22.6   1.1   16   31-47      4-19  (70)
 13 PF09439 SRPRB:  Signal recogni  44.8      23 0.00049   25.3   2.5   38   23-60     81-126 (181)
 14 PRK11235 bifunctional antitoxi  44.6      21 0.00045   23.0   2.1   24   24-47     24-47  (80)
 15 cd04105 SR_beta Signal recogni  44.3      23  0.0005   24.0   2.4   32   29-60     87-123 (203)
 16 TIGR02384 RelB_DinJ addiction   39.3      28 0.00062   21.8   2.1   23   25-47     26-48  (83)
 17 cd01828 sialate_O-acetylestera  38.4      19 0.00041   22.6   1.2   41   28-72    113-154 (169)
 18 PRK14093 UDP-N-acetylmuramoyla  38.1      30 0.00066   26.6   2.5   27   26-54     90-116 (479)
 19 TIGR00231 small_GTP small GTP-  37.7      19 0.00041   20.4   1.0   15   43-60    108-122 (161)
 20 PRK11930 putative bifunctional  35.7      35 0.00076   28.2   2.6   28   26-55     89-116 (822)
 21 cd00882 Ras_like_GTPase Ras-li  35.4      59  0.0013   17.8   2.8   22   42-63     98-119 (157)
 22 PF04221 RelB:  RelB antitoxin;  35.3      35 0.00075   20.9   2.0   23   25-47     25-47  (83)
 23 cd04127 Rab27A Rab27a subfamil  35.2      51  0.0011   20.5   2.7   17   45-61    119-135 (180)
 24 cd00880 Era_like Era (E. coli   35.0      22 0.00048   20.1   1.0   13   49-61    107-119 (163)
 25 PF09865 DUF2092:  Predicted pe  33.5      26 0.00056   25.6   1.4   20   26-45      1-20  (214)
 26 KOG0463|consensus               31.8      23  0.0005   30.7   1.0   15   44-61    274-288 (641)
 27 PF11502 BCL9:  B-cell lymphoma  30.9      32  0.0007   20.4   1.3   16   28-43     14-29  (40)
 28 cd01834 SGNH_hydrolase_like_2   30.5      23 0.00051   21.9   0.6   35   38-72    142-178 (191)
 29 cd01879 FeoB Ferrous iron tran  30.0      26 0.00056   20.9   0.7   13   49-61    104-116 (158)
 30 PF00674 DUP:  DUP family;  Int  28.8      62  0.0013   20.6   2.4   29   20-48     55-87  (108)
 31 smart00177 ARF ARF-like small   28.2      56  0.0012   20.9   2.2   14   48-61    116-129 (175)
 32 COG3077 RelB DNA-damage-induci  26.8      57  0.0012   21.7   2.0   22   25-46     28-49  (88)
 33 TIGR03348 VI_IcmF type VI secr  26.7      31 0.00068   30.3   1.0   16   41-59    241-256 (1169)
 34 PF08477 Miro:  Miro-like prote  26.0      61  0.0013   18.8   1.9   12   43-57    108-119 (119)
 35 COG4917 EutP Ethanolamine util  25.4      34 0.00074   25.1   0.8   21   40-60     77-104 (148)
 36 cd04175 Rap1 Rap1 subgroup.  T  24.3 1.1E+02  0.0024   18.7   2.9   13   49-61    109-121 (164)
 37 smart00174 RHO Rho (Ras homolo  24.0      78  0.0017   19.5   2.2   33   28-60     82-116 (174)
 38 cd01829 SGNH_hydrolase_peri2 S  23.9      79  0.0017   20.1   2.2   35   38-72    138-184 (200)
 39 PF13472 Lipase_GDSL_2:  GDSL-l  23.4      30 0.00066   20.3   0.2   37   36-72    136-173 (179)
 40 cd04154 Arl2 Arl2 subfamily.    23.2      91   0.002   19.5   2.4   14   48-61    117-130 (173)
 41 PF01584 CheW:  CheW-like domai  22.4     9.7 0.00021   22.8  -2.1   20   34-53     39-58  (138)
 42 PF13688 Reprolysin_5:  Metallo  21.8      64  0.0014   21.2   1.6   40   21-60     67-106 (196)
 43 cd01865 Rab3 Rab3 subfamily.    21.8 1.2E+02  0.0025   18.8   2.6   17   46-62    106-122 (165)
 44 KOG3944|consensus               21.2      41 0.00089   27.0   0.6   22   30-51      5-26  (291)
 45 cd04161 Arl2l1_Arl13_like Arl2  21.1 1.2E+02  0.0026   19.2   2.6   22   40-61     94-115 (167)
 46 PRK11929 putative bifunctional  20.9      88  0.0019   26.1   2.5   28   26-55    585-612 (958)
 47 TIGR03598 GTPase_YsxC ribosome  20.8      72  0.0016   20.4   1.6   17   40-59    126-142 (179)
 48 cd01870 RhoA_like RhoA-like su  20.3      81  0.0018   19.4   1.7   37   25-61     82-120 (175)
 49 cd04176 Rap2 Rap2 subgroup.  T  20.2 1.4E+02  0.0031   18.0   2.8   13   49-61    109-121 (163)
 50 cd04129 Rho2 Rho2 subfamily.    20.0      94   0.002   20.0   2.0   36   25-60     82-119 (187)
 51 cd04145 M_R_Ras_like M-Ras/R-R  20.0      65  0.0014   19.4   1.2   15   48-62    109-123 (164)

No 1  
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=92.17  E-value=0.19  Score=34.70  Aligned_cols=50  Identities=26%  Similarity=0.356  Sum_probs=36.6

Q ss_pred             CCCCCchhhhcccccchhchhHHHHHhhhhhhhhcCCcceeeeeeeeecccc
Q psy14251          8 GRDATPYLERNRVGRDAIDSAAALTDMGKYLFRERRLPVYDIAVAVTKKERS   59 (76)
Q Consensus         8 ~~dAtpylE~nrv~~~~iDa~~AL~~Mg~YlyRE~RlP~YDiAia~T~lDmc   59 (76)
                      ..|..|+....  ....+|+...|....+|..+..-..-+|+|+-+|++|++
T Consensus        58 ~~~~~~~~~~~--~~~~~~~~~tL~~F~~~~~~~~~~~~~D~~~LlT~~~~~  107 (220)
T cd04272          58 DPDFEPYIHPI--NYGYIDAAETLENFNEYVKKKRDYFNPDVVFLVTGLDMS  107 (220)
T ss_pred             CcccceeeccC--CcccccHHHHHHHHHHHHhccCCCCcccEEEEEecccee
Confidence            44555544322  335578999999999997766544489999999999984


No 2  
>PF01328 Peroxidase_2:  Peroxidase, family 2;  InterPro: IPR000028 Chloroperoxidase (CPO), also known as Heme haloperoxidase, is a ~250 residue heme-containing glycoprotein that is secreted by various fungi. Chloroperoxidase was first identified in Caldariomyces fumago where it catalyzes the hydrogen peroxide-dependent chlorination of cyclopentanedione during the biosynthesis of the antibiotic caldarioymcin. Additionally, heme haloperoxidase catalyzes the iodination and bromination of a wide range of substrates. Besides performing H2O2-dependent halogenation reactions, the enzyme catalyzes dehydrogenation reactions. Chloroperoxidase also functions as a catalase, facilitating the decomposition of hydrogen peroxide to oxygen and water. Furthermore, chloroperoxidase catalyzes P450-like oxygen insertion reactions. The capability of chloroperoxidase to perform these diverse reactions makes it one of the most versatile of all known heme proteins [, ]. Despite functional similarities with other heme enzymes, chloroperoxidase folds into a novel tertiary structure dominated by eight helical segments []. Structurally, chloroperoxidase is unique, but it shares features with both peroxidases and P450 enzymes. As in cytochrome P450 enzymes, the proximal heme ligand is a cysteine, but similar to peroxidases, the distal side of the heme is polar. However, unlike other peroxidases, the normally conserved distal arginine is lacking and the catalytic acid base is a glutamic acid and not a histidine [].; GO: 0004601 peroxidase activity; PDB: 2J5M_A 2J19_A 2CIW_A 2CJ0_A 2CIV_A 2CPO_A 1CPO_A 2CJ2_A 2J18_A 2CIZ_A ....
Probab=74.04  E-value=1.8  Score=33.49  Aligned_cols=14  Identities=43%  Similarity=0.738  Sum_probs=10.3

Q ss_pred             HHhhhhhhhhcCCc
Q psy14251         32 TDMGKYLFRERRLP   45 (76)
Q Consensus        32 ~~Mg~YlyRE~RlP   45 (76)
                      ++.-|+||+|+|||
T Consensus       228 ~d~vr~fF~eERLP  241 (317)
T PF01328_consen  228 KDWVRSFFEEERLP  241 (317)
T ss_dssp             HHHHHHHHHHSS--
T ss_pred             HHHHHHHHhcccCC
Confidence            36778999999999


No 3  
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana  predicted gene product,  At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=70.71  E-value=0.92  Score=30.04  Aligned_cols=14  Identities=36%  Similarity=0.508  Sum_probs=13.6

Q ss_pred             ceeeeeeeeecccc
Q psy14251         46 VYDIAVAVTKKERS   59 (76)
Q Consensus        46 ~YDiAia~T~lDmc   59 (76)
                      ||||..|+.+|+.|
T Consensus        14 fyDvTlALK~L~i~   27 (77)
T cd04898          14 FYDITLALKKLGIC   27 (77)
T ss_pred             eeehHHHHHHhccE
Confidence            99999999999998


No 4  
>PF14331 ImcF-related_N:  ImcF-related N-terminal domain
Probab=69.21  E-value=2.4  Score=30.77  Aligned_cols=26  Identities=38%  Similarity=0.531  Sum_probs=18.8

Q ss_pred             HHHHhhhhhhh---------hcCCcceeeeeeeeeccc
Q psy14251         30 ALTDMGKYLFR---------ERRLPVYDIAVAVTKKER   58 (76)
Q Consensus        30 AL~~Mg~YlyR---------E~RlP~YDiAia~T~lDm   58 (76)
                      +|..+++-+-+         .-|+|||   |++||+|+
T Consensus        47 ~l~~~a~~lR~rL~el~~~lg~~~PVY---vv~Tk~D~   81 (266)
T PF14331_consen   47 ELEALARALRQRLEELQRTLGVRLPVY---VVFTKCDL   81 (266)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCCCeE---eeeECCCc
Confidence            56666665432         3599999   88999996


No 5  
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=64.16  E-value=8.9  Score=26.22  Aligned_cols=35  Identities=11%  Similarity=0.130  Sum_probs=25.8

Q ss_pred             hchhHHHHHhhhhhhhhcCC-----cceeeeeeeeecccc
Q psy14251         25 IDSAAALTDMGKYLFRERRL-----PVYDIAVAVTKKERS   59 (76)
Q Consensus        25 iDa~~AL~~Mg~YlyRE~Rl-----P~YDiAia~T~lDmc   59 (76)
                      -|+.+.|....+|-.+.-..     .-+|+|+-+|+.|+|
T Consensus        67 ~~~~~~L~~F~~w~~~~~~~~~~~~~~~D~a~llt~~d~~  106 (207)
T cd04273          67 GNAQKSLKSFCRWQKKLNPPNDSDPEHHDHAILLTRQDIC  106 (207)
T ss_pred             CCHHHHHHHHHHHHHHcCCcccccccccceEEEEeeeccc
Confidence            36778898888884332221     269999999999997


No 6  
>PF07056 DUF1335:  Protein of unknown function (DUF1335);  InterPro: IPR009766 This family represents a conserved region approximately 130 residues long within a number of proteins of unknown function that seem to be specific to the white spot syndrome virus (WSSV).
Probab=61.69  E-value=3  Score=30.01  Aligned_cols=31  Identities=26%  Similarity=0.290  Sum_probs=25.9

Q ss_pred             ccchhchhHHHHHhhhhh----hhhcCCcceeeee
Q psy14251         21 GRDAIDSAAALTDMGKYL----FRERRLPVYDIAV   51 (76)
Q Consensus        21 ~~~~iDa~~AL~~Mg~Yl----yRE~RlP~YDiAi   51 (76)
                      |-+.-+-.++|..|+.-+    +.+.++|+|||+=
T Consensus        39 G~s~~~v~~~L~~me~~l~~~g~~~~~v~v~dICh   73 (131)
T PF07056_consen   39 GFSPRNVTKKLKSMEQNLVKHGGKYSMVPVVDICH   73 (131)
T ss_pred             CCChHHHHHHHHHHHHHHHHccCCcceeeHHHHHH
Confidence            455667789999999888    8899999999863


No 7  
>PRK14022 UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional
Probab=54.32  E-value=9.8  Score=29.13  Aligned_cols=28  Identities=21%  Similarity=0.337  Sum_probs=22.5

Q ss_pred             chhHHHHHhhhhhhhh--cCCcceeeeeeeee
Q psy14251         26 DSAAALTDMGKYLFRE--RRLPVYDIAVAVTK   55 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE--~RlP~YDiAia~T~   55 (76)
                      |+.+||..+++++|..  .++|+  |+|+-|+
T Consensus        90 d~~~al~~la~~~~~~p~~~~~v--IgITGTn  119 (481)
T PRK14022         90 DIKKAMSLIAMEFYDNPQHKLKL--LAFTGTK  119 (481)
T ss_pred             CHHHHHHHHHHHHhcChhhccEE--EEEeCCC
Confidence            6789999999999976  67775  6777664


No 8  
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional
Probab=51.20  E-value=12  Score=28.50  Aligned_cols=28  Identities=25%  Similarity=0.326  Sum_probs=22.2

Q ss_pred             chhHHHHHhhhhhhhhc--CCcceeeeeeeee
Q psy14251         26 DSAAALTDMGKYLFRER--RLPVYDIAVAVTK   55 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~--RlP~YDiAia~T~   55 (76)
                      |+.+||..+++++|+.-  ++|+  |+|+-|+
T Consensus        75 d~~~al~~la~~~~~~~~~~~~v--I~ITGTn  104 (460)
T PRK00139         75 DLRKALALLAAAFYGHPSDKLKL--IGVTGTN  104 (460)
T ss_pred             CHHHHHHHHHHHHhcChhhccEE--EEEECCC
Confidence            78899999999999765  6675  6777653


No 9  
>PF00009 GTP_EFTU:  Elongation factor Tu GTP binding domain;  InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site. The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....
Probab=46.83  E-value=12  Score=24.39  Aligned_cols=18  Identities=33%  Similarity=0.501  Sum_probs=14.9

Q ss_pred             hhhcCCcceeeeeeeeecccc
Q psy14251         39 FRERRLPVYDIAVAVTKKERS   59 (76)
Q Consensus        39 yRE~RlP~YDiAia~T~lDmc   59 (76)
                      -++.++|   +.|++||.|++
T Consensus       118 ~~~~~~p---~ivvlNK~D~~  135 (188)
T PF00009_consen  118 LRELGIP---IIVVLNKMDLI  135 (188)
T ss_dssp             HHHTT-S---EEEEEETCTSS
T ss_pred             ccccccc---eEEeeeeccch
Confidence            4677899   89999999998


No 10 
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. This family consists of the strictly bacterial MurF gene of peptidoglycan biosynthesis. This enzyme is almost always UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase, but in a few species, MurE adds lysine rather than diaminopimelate. This enzyme acts on the product from MurE activity, and so is also subfamily rather than equivalog. Staphylococcus aureus is an example of species in this MurF protein would differ.
Probab=46.31  E-value=20  Score=26.80  Aligned_cols=28  Identities=18%  Similarity=0.111  Sum_probs=22.2

Q ss_pred             chhHHHHHhhhhhhhhcCCcceeeeeeeee
Q psy14251         26 DSAAALTDMGKYLFRERRLPVYDIAVAVTK   55 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~RlP~YDiAia~T~   55 (76)
                      |..+||..+++++|++-..|+  |+|+-|+
T Consensus        56 d~~~al~~la~~~~~~~~~~v--I~VTGTn   83 (417)
T TIGR01143        56 DTLEALQALASAKRAKFSGKV--IGITGSS   83 (417)
T ss_pred             CHHHHHHHHHHHHHhhCCCCE--EEEcCCC
Confidence            788999999999998766665  6776653


No 11 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=45.38  E-value=26  Score=23.26  Aligned_cols=33  Identities=15%  Similarity=0.043  Sum_probs=24.8

Q ss_pred             chhHHHHHhhhhhhhhcCC-cceeeeeeeeeccc
Q psy14251         26 DSAAALTDMGKYLFRERRL-PVYDIAVAVTKKER   58 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~Rl-P~YDiAia~T~lDm   58 (76)
                      |+...|....+|--++.-. .-+|+|+.+|+.|+
T Consensus        65 ~~~~~L~~f~~w~~~~~~~~~~~D~a~Llt~~~~   98 (194)
T cd04269          65 DAGETLNRFLDWKRSNLLPRKPHDNAQLLTGRDF   98 (194)
T ss_pred             CHHHHHHHHHHHHHHhhccccCCCceEEEEeeec
Confidence            5667788888875444332 46999999999997


No 12 
>PF14698 ASL_C2:  Argininosuccinate lyase C-terminal; PDB: 1XWO_A 2E9F_A 1TJW_C 1TJU_A 1DCN_B 1K7W_B 1HY1_C 1TJV_B 1AUW_A 1U15_B ....
Probab=45.34  E-value=12  Score=22.65  Aligned_cols=16  Identities=38%  Similarity=0.735  Sum_probs=12.8

Q ss_pred             HHHhhhhhhhhcCCcce
Q psy14251         31 LTDMGKYLFRERRLPVY   47 (76)
Q Consensus        31 L~~Mg~YlyRE~RlP~Y   47 (76)
                      -|++++||-|+ .+||=
T Consensus         4 ATdlAD~LVr~-GipFR   19 (70)
T PF14698_consen    4 ATDLADYLVRK-GIPFR   19 (70)
T ss_dssp             HHHHHHHHHHT-TS-HH
T ss_pred             HHHHHHHHHHc-CCCHH
Confidence            37899999999 99973


No 13 
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=44.79  E-value=23  Score=25.26  Aligned_cols=38  Identities=24%  Similarity=0.312  Sum_probs=25.5

Q ss_pred             chhchh---HHHHHhhhhhhh----hcCCc-ceeeeeeeeeccccc
Q psy14251         23 DAIDSA---AALTDMGKYLFR----ERRLP-VYDIAVAVTKKERSG   60 (76)
Q Consensus        23 ~~iDa~---~AL~~Mg~YlyR----E~RlP-~YDiAia~T~lDmc~   60 (76)
                      =.|||.   +.+++.|.|||.    ....+ -.+|.||..|-|+..
T Consensus        81 fvvDSs~~~~~~~~~Ae~Ly~iL~~~~~~~~~~piLIacNK~Dl~~  126 (181)
T PF09439_consen   81 FVVDSSTDQKELRDVAEYLYDILSDTEVQKNKPPILIACNKQDLFT  126 (181)
T ss_dssp             EEEETTTHHHHHHHHHHHHHHHHHHHHCCTT--EEEEEEE-TTSTT
T ss_pred             EEEeCccchhhHHHHHHHHHHHHHhhhhccCCCCEEEEEeCccccc
Confidence            346663   679999999995    22223 678999999999854


No 14 
>PRK11235 bifunctional antitoxin/transcriptional repressor RelB; Provisional
Probab=44.60  E-value=21  Score=23.00  Aligned_cols=24  Identities=25%  Similarity=0.405  Sum_probs=20.6

Q ss_pred             hhchhHHHHHhhhhhhhhcCCcce
Q psy14251         24 AIDSAAALTDMGKYLFRERRLPVY   47 (76)
Q Consensus        24 ~iDa~~AL~~Mg~YlyRE~RlP~Y   47 (76)
                      -++...|++-.-+|+=+|.++||-
T Consensus        24 Gls~S~Ai~~fl~qi~~~~~iPF~   47 (80)
T PRK11235         24 GVTPSEALRLLLQYVAENGRLPFK   47 (80)
T ss_pred             CCCHHHHHHHHHHHHHHhCCCCCC
Confidence            356678899999999999999985


No 15 
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=44.26  E-value=23  Score=23.97  Aligned_cols=32  Identities=19%  Similarity=0.342  Sum_probs=23.0

Q ss_pred             HHHHHhhhhhhh-----hcCCcceeeeeeeeeccccc
Q psy14251         29 AALTDMGKYLFR-----ERRLPVYDIAVAVTKKERSG   60 (76)
Q Consensus        29 ~AL~~Mg~YlyR-----E~RlP~YDiAia~T~lDmc~   60 (76)
                      ..++....|||.     +.+-|--.+.|+.+|.|+++
T Consensus        87 ~~~~~~~~~l~~il~~~~~~~~~~pvliv~NK~Dl~~  123 (203)
T cd04105          87 KNLKDVAEFLYDILTDLEKVKNKIPVLIACNKQDLFT  123 (203)
T ss_pred             hHHHHHHHHHHHHHHHHhhccCCCCEEEEecchhhcc
Confidence            467888888875     22224456789999999986


No 16 
>TIGR02384 RelB_DinJ addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than Pfam model pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species.
Probab=39.34  E-value=28  Score=21.83  Aligned_cols=23  Identities=26%  Similarity=0.379  Sum_probs=19.7

Q ss_pred             hchhHHHHHhhhhhhhhcCCcce
Q psy14251         25 IDSAAALTDMGKYLFRERRLPVY   47 (76)
Q Consensus        25 iDa~~AL~~Mg~YlyRE~RlP~Y   47 (76)
                      ++-..|++..-+++=+|++|||.
T Consensus        26 l~~s~ai~~fl~qvv~~~~lPF~   48 (83)
T TIGR02384        26 LTPSTAIRMFLKQVIREQGLPFD   48 (83)
T ss_pred             CCHHHHHHHHHHHHHHhCCCCCC
Confidence            56677889999999999999973


No 17 
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=38.42  E-value=19  Score=22.55  Aligned_cols=41  Identities=12%  Similarity=0.259  Sum_probs=26.5

Q ss_pred             hHHHHHhhhhhhhhcCCcceeeeeeeeeccc-ccceEeccceeecc
Q psy14251         28 AAALTDMGKYLFRERRLPVYDIAVAVTKKER-SGMIWLSNQFHLTS   72 (76)
Q Consensus        28 ~~AL~~Mg~YlyRE~RlP~YDiAia~T~lDm-c~m~~~s~~~~~~~   72 (76)
                      ..+++.+++    |...+|.|+.-.+.+-+- +...+..|.+|++.
T Consensus       113 n~~l~~~a~----~~~~~~id~~~~~~~~~~~~~~~~~~DgiHpn~  154 (169)
T cd01828         113 NRQLAQLAQ----QEGVTFLDLWAVFTNADGDLKNEFTTDGLHLNA  154 (169)
T ss_pred             HHHHHHHHH----HCCCEEEechhhhcCCCCCcchhhccCccccCH
Confidence            344555555    789999998766544432 33456678899874


No 18 
>PRK14093 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase; Provisional
Probab=38.13  E-value=30  Score=26.62  Aligned_cols=27  Identities=37%  Similarity=0.365  Sum_probs=21.7

Q ss_pred             chhHHHHHhhhhhhhhcCCcceeeeeeee
Q psy14251         26 DSAAALTDMGKYLFRERRLPVYDIAVAVT   54 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~RlP~YDiAia~T   54 (76)
                      |.-+||..++.++|+...+|+  |+|+-|
T Consensus        90 d~~~al~~la~~~~~~~~~~v--IgVTGS  116 (479)
T PRK14093         90 DVLAALRDLGRAARARLEAKV--IAVTGS  116 (479)
T ss_pred             CHHHHHHHHHHHHHHhcCCCE--EEEcCC
Confidence            678999999999998766665  677765


No 19 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=37.74  E-value=19  Score=20.44  Aligned_cols=15  Identities=20%  Similarity=0.302  Sum_probs=12.3

Q ss_pred             CCcceeeeeeeeeccccc
Q psy14251         43 RLPVYDIAVAVTKKERSG   60 (76)
Q Consensus        43 RlP~YDiAia~T~lDmc~   60 (76)
                      ..|   +.|+++|.|++.
T Consensus       108 ~~p---~ivv~nK~D~~~  122 (161)
T TIGR00231       108 NVP---IILVGNKIDLRD  122 (161)
T ss_pred             CCc---EEEEEEcccCCc
Confidence            456   579999999987


No 20 
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional
Probab=35.73  E-value=35  Score=28.20  Aligned_cols=28  Identities=25%  Similarity=0.444  Sum_probs=22.3

Q ss_pred             chhHHHHHhhhhhhhhcCCcceeeeeeeee
Q psy14251         26 DSAAALTDMGKYLFRERRLPVYDIAVAVTK   55 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~RlP~YDiAia~T~   55 (76)
                      |..+||..+++++|.+...|+  |||+-|+
T Consensus        89 d~~~al~~la~~~~~~~~~~v--IgVTGT~  116 (822)
T PRK11930         89 DPLKALQELAAYHRSQFDIPV--IGITGSN  116 (822)
T ss_pred             CHHHHHHHHHHHHHHhCCCCE--EEEeCCC
Confidence            778999999999998766665  7777653


No 21 
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=35.42  E-value=59  Score=17.83  Aligned_cols=22  Identities=9%  Similarity=-0.132  Sum_probs=15.7

Q ss_pred             cCCcceeeeeeeeecccccceE
Q psy14251         42 RRLPVYDIAVAVTKKERSGMIW   63 (76)
Q Consensus        42 ~RlP~YDiAia~T~lDmc~m~~   63 (76)
                      ...+-.-+.|++||.|+++...
T Consensus        98 ~~~~~~~~ivv~nk~D~~~~~~  119 (157)
T cd00882          98 KEGENIPIILVGNKIDLPEERV  119 (157)
T ss_pred             hccCCCcEEEEEeccccccccc
Confidence            3344555689999999987654


No 22 
>PF04221 RelB:  RelB antitoxin;  InterPro: IPR007337  Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. Several toxin/antitoxin pairs may occur in a single species. RelE and RelB form a toxin-antitoxin system; RelE represses translation, probably through binding ribosomes [, ]. RelB stably binds RelE, presumably deactivating it.; PDB: 2KC8_B 2K29_A.
Probab=35.32  E-value=35  Score=20.90  Aligned_cols=23  Identities=22%  Similarity=0.290  Sum_probs=16.2

Q ss_pred             hchhHHHHHhhhhhhhhcCCcce
Q psy14251         25 IDSAAALTDMGKYLFRERRLPVY   47 (76)
Q Consensus        25 iDa~~AL~~Mg~YlyRE~RlP~Y   47 (76)
                      ++-..|++-+-+++=+|.++||.
T Consensus        25 lt~s~ai~~fl~qiv~~~~iPF~   47 (83)
T PF04221_consen   25 LTLSDAINMFLKQIVREGGIPFE   47 (83)
T ss_dssp             --HHHHHHHHHHHHHHHSS-S--
T ss_pred             CCHHHHHHHHHHHHHHhCCCCcc
Confidence            55667888889999999999973


No 23 
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=35.23  E-value=51  Score=20.50  Aligned_cols=17  Identities=18%  Similarity=0.102  Sum_probs=12.8

Q ss_pred             cceeeeeeeeecccccc
Q psy14251         45 PVYDIAVAVTKKERSGM   61 (76)
Q Consensus        45 P~YDiAia~T~lDmc~m   61 (76)
                      |-.-|+|+.+|.|+++.
T Consensus       119 ~~~piiiv~nK~Dl~~~  135 (180)
T cd04127         119 ENPDIVLCGNKADLEDQ  135 (180)
T ss_pred             CCCcEEEEEeCccchhc
Confidence            33457899999999864


No 24 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=35.04  E-value=22  Score=20.10  Aligned_cols=13  Identities=8%  Similarity=0.054  Sum_probs=11.1

Q ss_pred             eeeeeeecccccc
Q psy14251         49 IAVAVTKKERSGM   61 (76)
Q Consensus        49 iAia~T~lDmc~m   61 (76)
                      +.|++||.|++..
T Consensus       107 ~ivv~nK~D~~~~  119 (163)
T cd00880         107 VLLVLNKIDLLPE  119 (163)
T ss_pred             EEEEEEccccCCh
Confidence            6899999999864


No 25 
>PF09865 DUF2092:  Predicted periplasmic protein (DUF2092);  InterPro: IPR019207  This entry represents various hypothetical prokaryotic proteins of unknown function. 
Probab=33.46  E-value=26  Score=25.59  Aligned_cols=20  Identities=20%  Similarity=0.340  Sum_probs=17.0

Q ss_pred             chhHHHHHhhhhhhhhcCCc
Q psy14251         26 DSAAALTDMGKYLFRERRLP   45 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~RlP   45 (76)
                      ||.+.|+.|++||=--.+|-
T Consensus         1 ~A~~iL~~m~~~L~~~k~fs   20 (214)
T PF09865_consen    1 KADQILKAMSDYLAALKSFS   20 (214)
T ss_pred             CHHHHHHHHHHHHhhCcEEE
Confidence            68899999999997777766


No 26 
>KOG0463|consensus
Probab=31.85  E-value=23  Score=30.66  Aligned_cols=15  Identities=40%  Similarity=0.605  Sum_probs=11.8

Q ss_pred             Ccceeeeeeeeecccccc
Q psy14251         44 LPVYDIAVAVTKKERSGM   61 (76)
Q Consensus        44 lP~YDiAia~T~lDmc~m   61 (76)
                      .|||   |++||.|||--
T Consensus       274 VPVf---vVVTKIDMCPA  288 (641)
T KOG0463|consen  274 VPVF---VVVTKIDMCPA  288 (641)
T ss_pred             CcEE---EEEEeeccCcH
Confidence            5654   88999999964


No 27 
>PF11502 BCL9:  B-cell lymphoma 9 protein;  InterPro: IPR024670 The Wnt pathway plays a role in embryonic development, stem cell growth and tumorigenesis. B-cell lymphoma 9 (BCL9) associates with beta-catenin and Tcf in the nucleus when the Wnt pathway is stimulated leading to the transactivation of Wnt target genes []. This entry represents a beta-catenin binding domain found in BCL9 and BCL9 homologues.; PDB: 3SL9_F 2GL7_C.
Probab=30.89  E-value=32  Score=20.42  Aligned_cols=16  Identities=44%  Similarity=0.625  Sum_probs=9.6

Q ss_pred             hHHHHHhhhhhhhhcC
Q psy14251         28 AAALTDMGKYLFRERR   43 (76)
Q Consensus        28 ~~AL~~Mg~YlyRE~R   43 (76)
                      =+-||+|-+.||+|.+
T Consensus        14 L~tlr~mq~~lfpe~~   29 (40)
T PF11502_consen   14 LATLRDMQRMLFPEES   29 (40)
T ss_dssp             HHHHHHHHHHH-----
T ss_pred             HHHHHHHHHHhCcccc
Confidence            3679999999999975


No 28 
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=30.46  E-value=23  Score=21.87  Aligned_cols=35  Identities=11%  Similarity=0.146  Sum_probs=27.1

Q ss_pred             hhhhcCCcceeeeeeeeecccc--cceEeccceeecc
Q psy14251         38 LFRERRLPVYDIAVAVTKKERS--GMIWLSNQFHLTS   72 (76)
Q Consensus        38 lyRE~RlP~YDiAia~T~lDmc--~m~~~s~~~~~~~   72 (76)
                      +-+|...+|.|+.-++.+.+.|  .....+|.+|++.
T Consensus       142 ~a~~~~~~~iD~~~~~~~~~~~~~~~~~~~D~~Hpn~  178 (191)
T cd01834         142 LAAENGVAFVDLFTPMKEAFQKAGEAVLTVDGVHPNE  178 (191)
T ss_pred             HHHHcCCeEEecHHHHHHHHHhCCCccccCCCCCCCH
Confidence            3457789999999888877777  4566789999863


No 29 
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=30.00  E-value=26  Score=20.92  Aligned_cols=13  Identities=15%  Similarity=0.253  Sum_probs=11.0

Q ss_pred             eeeeeeecccccc
Q psy14251         49 IAVAVTKKERSGM   61 (76)
Q Consensus        49 iAia~T~lDmc~m   61 (76)
                      +.|++||.|+++.
T Consensus       104 ~iiv~NK~Dl~~~  116 (158)
T cd01879         104 VVVALNMIDEAEK  116 (158)
T ss_pred             EEEEEehhhhccc
Confidence            5799999999864


No 30 
>PF00674 DUP:  DUP family;  InterPro: IPR001142 A number of uncharacterised integral membrane proteins from yeast contain an internal duplication due to duplicated genes. Duplicated copies of genes may be classified in two types of cluster organisation. The first type includes genes sharing a significant level of identity in the amino acid sequences of their predicted protein product. They are recovered on two different chromosomes, transcribed in the same orientation and the distance between them is conserved. The second type of cluster is based on one gene unit tandemly repeated. This duplication is itself repeated elsewhere in the genome. The basic gene unit is recovered many times in the genome and is a component of a multigene family of unknown function. These organisations in clusters of genes suggest a 'Lego organisation' of the yeast chromosomes []. The proteins belonging to this family are of unknown function.
Probab=28.82  E-value=62  Score=20.63  Aligned_cols=29  Identities=28%  Similarity=0.402  Sum_probs=22.1

Q ss_pred             cccchhchhHHHHHhhhhhhhhcCCc----cee
Q psy14251         20 VGRDAIDSAAALTDMGKYLFRERRLP----VYD   48 (76)
Q Consensus        20 v~~~~iDa~~AL~~Mg~YlyRE~RlP----~YD   48 (76)
                      -+.++-.=|.--+.|-.|||.|.--+    |||
T Consensus        55 P~~d~~~Wd~IA~~mN~yly~~~~w~t~~~FyD   87 (108)
T PF00674_consen   55 PGVDMKKWDIIASRMNQYLYEEGLWNTPYFFYD   87 (108)
T ss_pred             CCCCcccHHHHHHHHHHHHHhCCCCCCcCcccC
Confidence            34555666778889999999987655    887


No 31 
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=28.23  E-value=56  Score=20.93  Aligned_cols=14  Identities=21%  Similarity=0.159  Sum_probs=11.6

Q ss_pred             eeeeeeeecccccc
Q psy14251         48 DIAVAVTKKERSGM   61 (76)
Q Consensus        48 DiAia~T~lDmc~m   61 (76)
                      -|+|+.+|.|+++.
T Consensus       116 piilv~NK~Dl~~~  129 (175)
T smart00177      116 VILVFANKQDLPDA  129 (175)
T ss_pred             cEEEEEeCcCcccC
Confidence            47899999999753


No 32 
>COG3077 RelB DNA-damage-inducible protein J [DNA replication, recombination, and repair]
Probab=26.77  E-value=57  Score=21.69  Aligned_cols=22  Identities=23%  Similarity=0.258  Sum_probs=17.9

Q ss_pred             hchhHHHHHhhhhhhhhcCCcc
Q psy14251         25 IDSAAALTDMGKYLFRERRLPV   46 (76)
Q Consensus        25 iDa~~AL~~Mg~YlyRE~RlP~   46 (76)
                      ++-..|.|-|-+|.=+|.++||
T Consensus        28 lt~S~airm~L~~va~~~~lPf   49 (88)
T COG3077          28 LTISDAIRMFLTKVAREGALPF   49 (88)
T ss_pred             CCHHHHHHHHHHHHHHcCCCCc
Confidence            4556677788899999999996


No 33 
>TIGR03348 VI_IcmF type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems.
Probab=26.74  E-value=31  Score=30.28  Aligned_cols=16  Identities=38%  Similarity=0.656  Sum_probs=13.2

Q ss_pred             hcCCcceeeeeeeeecccc
Q psy14251         41 ERRLPVYDIAVAVTKKERS   59 (76)
Q Consensus        41 E~RlP~YDiAia~T~lDmc   59 (76)
                      .-|+|||   |++||+|+=
T Consensus       241 g~~~PVY---vv~Tk~Dll  256 (1169)
T TIGR03348       241 GARFPVY---LVLTKADLL  256 (1169)
T ss_pred             CCCCCEE---EEEecchhh
Confidence            4599999   889999963


No 34 
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=25.99  E-value=61  Score=18.81  Aligned_cols=12  Identities=25%  Similarity=0.529  Sum_probs=8.4

Q ss_pred             CCcceeeeeeeeecc
Q psy14251         43 RLPVYDIAVAVTKKE   57 (76)
Q Consensus        43 RlP~YDiAia~T~lD   57 (76)
                      ..|   |.++.||.|
T Consensus       108 ~~p---iilv~nK~D  119 (119)
T PF08477_consen  108 NIP---IILVGNKSD  119 (119)
T ss_dssp             CSE---EEEEEE-TC
T ss_pred             CCC---EEEEEeccC
Confidence            377   678889987


No 35 
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=25.36  E-value=34  Score=25.12  Aligned_cols=21  Identities=43%  Similarity=0.621  Sum_probs=16.7

Q ss_pred             hhcCCc--ceeeee-----eeeeccccc
Q psy14251         40 RERRLP--VYDIAV-----AVTKKERSG   60 (76)
Q Consensus        40 RE~RlP--~YDiAi-----a~T~lDmc~   60 (76)
                      .|.|||  |-||..     .+||.||-.
T Consensus        77 ~~s~f~p~f~~~~~k~vIgvVTK~DLae  104 (148)
T COG4917          77 PESRFPPGFLDIGVKKVIGVVTKADLAE  104 (148)
T ss_pred             ccccCCcccccccccceEEEEecccccc
Confidence            589999  888743     589999974


No 36 
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=24.32  E-value=1.1e+02  Score=18.67  Aligned_cols=13  Identities=8%  Similarity=0.003  Sum_probs=11.2

Q ss_pred             eeeeeeecccccc
Q psy14251         49 IAVAVTKKERSGM   61 (76)
Q Consensus        49 iAia~T~lDmc~m   61 (76)
                      |.|+.+|.|+++.
T Consensus       109 iilv~nK~Dl~~~  121 (164)
T cd04175         109 MILVGNKCDLEDE  121 (164)
T ss_pred             EEEEEECCcchhc
Confidence            6799999999864


No 37 
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=23.97  E-value=78  Score=19.45  Aligned_cols=33  Identities=18%  Similarity=0.186  Sum_probs=19.7

Q ss_pred             hHHHHHhhhhhhhh--cCCcceeeeeeeeeccccc
Q psy14251         28 AAALTDMGKYLFRE--RRLPVYDIAVAVTKKERSG   60 (76)
Q Consensus        28 ~~AL~~Mg~YlyRE--~RlP~YDiAia~T~lDmc~   60 (76)
                      ..++..+-..++++  .+.|---|.|+.||.|+..
T Consensus        82 ~~s~~~~~~~~~~~i~~~~~~~piilv~nK~Dl~~  116 (174)
T smart00174       82 PASFENVKEKWYPEVKHFCPNTPIILVGTKLDLRE  116 (174)
T ss_pred             HHHHHHHHHHHHHHHHhhCCCCCEEEEecChhhhh
Confidence            34455554322222  2345556899999999975


No 38 
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=23.86  E-value=79  Score=20.13  Aligned_cols=35  Identities=9%  Similarity=0.016  Sum_probs=24.5

Q ss_pred             hhhhcCCcceeeeeeeeeccccc------------ceEeccceeecc
Q psy14251         38 LFRERRLPVYDIAVAVTKKERSG------------MIWLSNQFHLTS   72 (76)
Q Consensus        38 lyRE~RlP~YDiAia~T~lDmc~------------m~~~s~~~~~~~   72 (76)
                      +-++.-.+|.|+.-.+.+.+-|-            ..+..|.+|+|.
T Consensus       138 ~a~~~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DgvH~~~  184 (200)
T cd01829         138 EVAKAGGEFVDVWDGFVDENGRFTYSGTDVNGKKVRLRTNDGIHFTA  184 (200)
T ss_pred             HHHHcCCEEEEhhHhhcCCCCCeeeeccCCCCcEEEeecCCCceECH
Confidence            33456688999988887766662            123569999985


No 39 
>PF13472 Lipase_GDSL_2:  GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=23.43  E-value=30  Score=20.32  Aligned_cols=37  Identities=16%  Similarity=0.239  Sum_probs=26.2

Q ss_pred             hhhhhhcCCcceeeeeeeeecccc-cceEeccceeecc
Q psy14251         36 KYLFRERRLPVYDIAVAVTKKERS-GMIWLSNQFHLTS   72 (76)
Q Consensus        36 ~YlyRE~RlP~YDiAia~T~lDmc-~m~~~s~~~~~~~   72 (76)
                      +-+.++..+||+|+.-++.+-+.+ ...+.+|.+|++.
T Consensus       136 ~~~a~~~~~~~id~~~~~~~~~~~~~~~~~~D~~Hp~~  173 (179)
T PF13472_consen  136 RELAKKYGVPFIDLFDAFDDHDGWFPKYYFSDGVHPNP  173 (179)
T ss_dssp             HHHHHHCTEEEEEHHHHHBTTTSCBHTCTBTTSSSBBH
T ss_pred             HHHHHHcCCEEEECHHHHccccccchhhcCCCCCCcCH
Confidence            335577799999999887754322 2445689999874


No 40 
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=23.19  E-value=91  Score=19.52  Aligned_cols=14  Identities=14%  Similarity=0.373  Sum_probs=11.3

Q ss_pred             eeeeeeeecccccc
Q psy14251         48 DIAVAVTKKERSGM   61 (76)
Q Consensus        48 DiAia~T~lDmc~m   61 (76)
                      -+.|+++|.|+++-
T Consensus       117 p~iiv~nK~Dl~~~  130 (173)
T cd04154         117 TLLILANKQDLPGA  130 (173)
T ss_pred             CEEEEEECcccccC
Confidence            36799999999763


No 41 
>PF01584 CheW:  CheW-like domain;  InterPro: IPR002545 CheW proteins are part of the chemotaxis signalling mechanism in bacteria. CheW interacts with the methyl accepting chemotaxis proteins (MCPs) and relays signals to CheY, which affects flagellar rotation. This family includes CheW and other related proteins that are involved in chemotaxis. The CheW-like regulatory domain in CheA [] binds to CheW, suggesting that these domains can interact with each other.; GO: 0004871 signal transducer activity, 0006935 chemotaxis, 0007165 signal transduction, 0005622 intracellular; PDB: 2HO9_A 2CH4_A 1B3Q_A 3UR1_A 1K0S_A 2QDL_B.
Probab=22.39  E-value=9.7  Score=22.83  Aligned_cols=20  Identities=30%  Similarity=0.544  Sum_probs=15.9

Q ss_pred             hhhhhhhhcCCcceeeeeee
Q psy14251         34 MGKYLFRERRLPVYDIAVAV   53 (76)
Q Consensus        34 Mg~YlyRE~RlP~YDiAia~   53 (76)
                      .|-+-||++.+|++|++-.+
T Consensus        39 ~G~~~~~g~~ipvidL~~~l   58 (138)
T PF01584_consen   39 LGVINYRGEIIPVIDLARLL   58 (138)
T ss_dssp             EEEEEETTEEEEEEEHHHHH
T ss_pred             EEEEEECCcEEEhhhHHHhh
Confidence            46788999999999987433


No 42 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=21.82  E-value=64  Score=21.21  Aligned_cols=40  Identities=28%  Similarity=0.360  Sum_probs=24.5

Q ss_pred             ccchhchhHHHHHhhhhhhhhcCCcceeeeeeeeeccccc
Q psy14251         21 GRDAIDSAAALTDMGKYLFRERRLPVYDIAVAVTKKERSG   60 (76)
Q Consensus        21 ~~~~iDa~~AL~~Mg~YlyRE~RlP~YDiAia~T~lDmc~   60 (76)
                      ..+.+|+...|....+..-..+....+||++.+|-.|+.+
T Consensus        67 ~~~~~~~~~~L~~f~~~~~~~~~~~~~dl~~l~t~~d~~~  106 (196)
T PF13688_consen   67 SNSNIDAEDTLQDFNNDFSSWRDSSYYDLAHLFTGRDFSG  106 (196)
T ss_dssp             TSSS--HHHHHHHH--HHHTHHHHTTSSEEEEEE----GG
T ss_pred             cccccCHHHHHHHHhhhhhhccCCCCCCEEEEEecccCCC
Confidence            5567888889988876555555556889999999888764


No 43 
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=21.77  E-value=1.2e+02  Score=18.82  Aligned_cols=17  Identities=6%  Similarity=-0.091  Sum_probs=13.0

Q ss_pred             ceeeeeeeeecccccce
Q psy14251         46 VYDIAVAVTKKERSGMI   62 (76)
Q Consensus        46 ~YDiAia~T~lDmc~m~   62 (76)
                      ---|.|+.+|.|+.+..
T Consensus       106 ~~piivv~nK~Dl~~~~  122 (165)
T cd01865         106 NAQVILVGNKCDMEDER  122 (165)
T ss_pred             CCCEEEEEECcccCccc
Confidence            33489999999997643


No 44 
>KOG3944|consensus
Probab=21.22  E-value=41  Score=26.99  Aligned_cols=22  Identities=27%  Similarity=0.498  Sum_probs=19.3

Q ss_pred             HHHHhhhhhhhhcCCcceeeee
Q psy14251         30 ALTDMGKYLFRERRLPVYDIAV   51 (76)
Q Consensus        30 AL~~Mg~YlyRE~RlP~YDiAi   51 (76)
                      +|-+.|-|+-|-.-|||+|||-
T Consensus         5 s~~ela~~~srl~mfP~FDiah   26 (291)
T KOG3944|consen    5 SLDELALAFSRLKMFPFFDIAH   26 (291)
T ss_pred             hHHHHHHHhhhccccchhhHHH
Confidence            5778899999999999999973


No 45 
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=21.13  E-value=1.2e+02  Score=19.19  Aligned_cols=22  Identities=18%  Similarity=0.264  Sum_probs=14.6

Q ss_pred             hhcCCcceeeeeeeeecccccc
Q psy14251         40 RERRLPVYDIAVAVTKKERSGM   61 (76)
Q Consensus        40 RE~RlP~YDiAia~T~lDmc~m   61 (76)
                      ++.+++-.=|.|+++|.|+.+-
T Consensus        94 ~~~~~~~~piliv~NK~Dl~~~  115 (167)
T cd04161          94 QHPRVSGKPILVLANKQDKKNA  115 (167)
T ss_pred             cCccccCCcEEEEEeCCCCcCC
Confidence            4434333347899999998653


No 46 
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional
Probab=20.94  E-value=88  Score=26.15  Aligned_cols=28  Identities=29%  Similarity=0.357  Sum_probs=22.4

Q ss_pred             chhHHHHHhhhhhhhhcCCcceeeeeeeee
Q psy14251         26 DSAAALTDMGKYLFRERRLPVYDIAVAVTK   55 (76)
Q Consensus        26 Da~~AL~~Mg~YlyRE~RlP~YDiAia~T~   55 (76)
                      |...||..++.++|+....|+  |+|+-|+
T Consensus       585 d~~~al~~la~~~~~~~~~~v--I~VTGTn  612 (958)
T PRK11929        585 DTRAALGRLATAWRARFSLPV--VAITGSN  612 (958)
T ss_pred             CHHHHHHHHHHHHHhcCCCcE--EEEeCCC
Confidence            678999999999998766665  6777664


No 47 
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=20.79  E-value=72  Score=20.43  Aligned_cols=17  Identities=35%  Similarity=0.743  Sum_probs=13.2

Q ss_pred             hhcCCcceeeeeeeeecccc
Q psy14251         40 RERRLPVYDIAVAVTKKERS   59 (76)
Q Consensus        40 RE~RlP~YDiAia~T~lDmc   59 (76)
                      ++.+.|   +.|++||.|+-
T Consensus       126 ~~~~~p---viiv~nK~D~~  142 (179)
T TIGR03598       126 RERGIP---VLIVLTKADKL  142 (179)
T ss_pred             HHcCCC---EEEEEECcccC
Confidence            556778   46889999985


No 48 
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=20.30  E-value=81  Score=19.39  Aligned_cols=37  Identities=24%  Similarity=0.193  Sum_probs=19.9

Q ss_pred             hchhHHHHHhhhhhhhhc--CCcceeeeeeeeecccccc
Q psy14251         25 IDSAAALTDMGKYLFRER--RLPVYDIAVAVTKKERSGM   61 (76)
Q Consensus        25 iDa~~AL~~Mg~YlyRE~--RlP~YDiAia~T~lDmc~m   61 (76)
                      +|+..++.++..++..+-  ..|-.-|.++.+|.|++..
T Consensus        82 ~~~~~s~~~~~~~~~~~~~~~~~~~piilv~nK~Dl~~~  120 (175)
T cd01870          82 IDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRND  120 (175)
T ss_pred             CCCHHHHHHHHHHHHHHHHhhCCCCCEEEEeeChhcccC
Confidence            344445555554433221  1122236799999998753


No 49 
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=20.18  E-value=1.4e+02  Score=18.03  Aligned_cols=13  Identities=15%  Similarity=0.077  Sum_probs=10.6

Q ss_pred             eeeeeeecccccc
Q psy14251         49 IAVAVTKKERSGM   61 (76)
Q Consensus        49 iAia~T~lDmc~m   61 (76)
                      |+|+.+|.|++..
T Consensus       109 iviv~nK~Dl~~~  121 (163)
T cd04176         109 IILVGNKVDLESE  121 (163)
T ss_pred             EEEEEECccchhc
Confidence            4788999999763


No 50 
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=20.05  E-value=94  Score=20.04  Aligned_cols=36  Identities=19%  Similarity=0.277  Sum_probs=21.8

Q ss_pred             hchhHHHHHhhhhhhhh--cCCcceeeeeeeeeccccc
Q psy14251         25 IDSAAALTDMGKYLFRE--RRLPVYDIAVAVTKKERSG   60 (76)
Q Consensus        25 iDa~~AL~~Mg~YlyRE--~RlP~YDiAia~T~lDmc~   60 (76)
                      +++..++..+...+..+  .+.|=--|.|+.||.|++.
T Consensus        82 i~~~~s~~~~~~~~~~~i~~~~~~~piilvgnK~Dl~~  119 (187)
T cd04129          82 VDTPDSLENVRTKWIEEVRRYCPNVPVILVGLKKDLRQ  119 (187)
T ss_pred             CCCHHHHHHHHHHHHHHHHHhCCCCCEEEEeeChhhhh
Confidence            35556677665432222  1334345788999999975


No 51 
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=20.01  E-value=65  Score=19.35  Aligned_cols=15  Identities=7%  Similarity=-0.024  Sum_probs=11.9

Q ss_pred             eeeeeeeecccccce
Q psy14251         48 DIAVAVTKKERSGMI   62 (76)
Q Consensus        48 DiAia~T~lDmc~m~   62 (76)
                      -|+|+++|.|+....
T Consensus       109 piiiv~NK~Dl~~~~  123 (164)
T cd04145         109 PMILVGNKADLEHQR  123 (164)
T ss_pred             CEEEEeeCccccccc
Confidence            368899999997654


Done!