Diaphorina citri psyllid: psy14290


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
PIRSGFLNQIHNFAQHCSKTEREVLARGFQLVVFLHEEAWTNHRSTGKDRTADLIFHFHPGIAQVTASYHKCSRKRLQVSAPLVIECASGESKQEHRPIPGEEFTFQSPNAEDIRDLVVYFLEGLKKRSSFVIALQDYKAPGEGSSFLSFHRGDLILLEEGSTGETVFFMKKLWTNTVPGKDRNADLIFHFHQELPKLLRGYHKCSKEEAAKLAALVYRVRFGESKQELQAIPQMLRELIPSDSIKIQSSTEWKRCIIAAYNQDAGMSPEDAKITFLKIIYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPQTKISLDYKSISW
ccccHHHHHHHHHHHHHccccccccccccEEEEHHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccEEEECcccHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccEEHcccccccEEEEEEEEEccccccccccccEEHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHccHHHcccccccHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccCEEEEEEECcccccccEEEEEEccccEEEEcccccCCcccccccc
***SGFLNQIHNFAQHCSKTEREVLARGFQLVVFLHEEAWTNHRSTGKDRTADLIFHFHPGIAQVTASYHKCSRKRLQVSAPLVIEC**********PIPGEEFTFQSPNAEDIRDLVVYFLEGLKKRSSFVIALQDYKAPGEGSSFLSFHRGDLILLEEGSTGETVFFMKKLWTNTVPGKDRNADLIFHFHQELPKLLRGYHKCSKEEAAKLAALVYRVRFGESKQELQAIPQMLRELIPSDSIKIQSSTEWKRCIIAAYNQDAGMSPEDAKITFLKIIYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPQTKISLDYKSISW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PIRSGFLNQIHNFAQHCSKTEREVLARGFQLVVFLHEEAWTNHRSTGKDRTADLIFHFHPGIAQVTASYHKCSRKRLQVSAPLVIECASGESKQEHRPIPGEEFTFQSPNAEDIRDLVVYFLEGLKKRSSFVIALQDYKAPGEGSSFLSFHRGDLILLEEGSTGETVFFMKKLWTNTVPGKDRNADLIFHFHQELPKLLRGYHKCSKEEAAKLAALVYRVRFGESKQELQAIPQMLRELIPSDSIKIQSSTEWKRCIIAAYNQDAGMSPEDAKITFLKIIYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPQTKISLDYKSISW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myosin-VIIa Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements: can function in cells as a single-molecule cargo transporter. A very slow and high-duty-ratio motor, may be suitable for tension maintenance of actin filaments. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. Plays a key role in the formation of cellular projections and other actin-based functions required for embryonic and larval viability. Necessary for auditory transduction: plays a role in Johnston organ (JO) organization by functioning in scolopidial apical attachment and therefore to acoustic stimulus propagation from the antenna a2/a3 joint to transducing elements.confidentQ29P71
Myosin-VIIa Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements: can function in cells as a single-molecule cargo transporter. A very slow and high-duty-ratio motor, may be suitable for tension maintenance of actin filaments. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. Plays a key role in the formation of cellular projections and other actin-based functions required for embryonic and larval viability. Necessary for auditory transduction: plays a role in Johnston organ (JO) organization by functioning in scolopidial apical attachment and therefore to acoustic stimulus propagation from the antenna a2/a3 joint to transducing elements.confidentQ9V3Z6
Unconventional myosin-VIIa Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. In the retina, plays an important role in the renewal of the outer photoreceptor disks. Plays an important role in the distribution and migration of retinal pigment epithelial (RPE) melanosomes and phagosomes, and in the regulation of opsin transport in retinal photoreceptors. Mediates intracellular transport of RPE65 in the retina pigment epithelium. In the inner ear, plays an important role in differentiation, morphogenesis and organization of cochlear hair cell bundles. Motor protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity.confidentP97479

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0030048 [BP]actin filament-based movementprobableGO:0030029, GO:0009987, GO:0006928, GO:0008150, GO:0044763, GO:0044699
GO:0030898 [MF]actin-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0001750 [CC]photoreceptor outer segmentprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005765 [CC]lysosomal membraneprobableGO:0005737, GO:0044446, GO:0000323, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0005764, GO:0044444, GO:0044437, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0007040 [BP]lysosome organizationprobableGO:0006996, GO:0007033, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042470 [CC]melanosomeprobableGO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0048770, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0044464, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0045202 [CC]synapseprobableGO:0005575
GO:0035293 [BP]chitin-based larval cuticle pattern formationprobableGO:0032502, GO:0042337, GO:0042335, GO:0044707, GO:0007389, GO:0032501, GO:0048856, GO:0007591, GO:0007275, GO:0008363, GO:0002165, GO:0002164, GO:0044767, GO:0003002, GO:0035017, GO:0008150, GO:0009791, GO:0042303, GO:0040003, GO:0044699, GO:0002168
GO:0032027 [MF]myosin light chain bindingprobableGO:0005488, GO:0003674, GO:0005515, GO:0017022, GO:0008092
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0043531 [MF]ADP bindingprobableGO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0001917 [CC]photoreceptor inner segmentprobableGO:0005575, GO:0044464, GO:0005623
GO:0031477 [CC]myosin VII complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0016461, GO:0016459, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000146 [MF]microfilament motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0050957 [BP]equilibrioceptionprobableGO:0032501, GO:0050885, GO:0044707, GO:0050877, GO:0007600, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0032420 [CC]stereociliumprobableGO:0032421, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0005902, GO:0043228, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0032391 [CC]photoreceptor connecting ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0035317 [BP]imaginal disc-derived wing hair organizationprobableGO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0044763, GO:0048731, GO:0022008, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0008150, GO:0048736, GO:0048737
GO:0008407 [BP]chaeta morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0007275, GO:0022416
GO:0048800 [BP]antennal morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0009791, GO:0002165, GO:0035214, GO:0009653, GO:0007275, GO:0044699, GO:0007455, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0032501, GO:0035114, GO:0008150, GO:0007469, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0060122 [BP]inner ear receptor stereocilium organizationprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0060119, GO:0060113, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0048513, GO:0044699, GO:0043583, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0048699, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0048839, GO:0007399, GO:0007423, GO:0048856, GO:0042490, GO:0044763
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PVL, chain A
Confidence level:very confident
Coverage over the Query: 13-35,47-325
View the alignment between query and template
View the model in PyMOL