Diaphorina citri psyllid: psy14294

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

AQRKTLKSKAASNADKVRSDLLKNLLEQQLLNDVLGKNEMALPPPSVSREVDMFELPPAPAQTVQDEEEDSDSDDTEAKFRYADLHSVDINSEQFSALPPDMRHEILTELLEQRKLSSWHKMHEMPQNDQHSMLEFRCNIVINKLLVDLISDVSIWLHQLTKGTHDLAGGSVPNAHLIGLYHRICKLLFFKIKPVFVFDGGVPQLKKQTISTLEKDRDQLLLERGKQTRLASTITEQMSREAQELLQLFGVPFIVAPGEAEAQCASLELGNHTQGVITDDSDIWLFGARTVYKNFFDKKSHVLRYTAPDIRYYF

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccCEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHcccEEEEEccccccccccccEEEEccccccccCEEECHHHHHccc

********************LLKNLLE**************************FE******************************HSVDINSEQFSALPPDMRHEILT************************MLEFRCNIVINKLLVDLISDVSIWLHQLTKGTHDLAGGSVPNAHLIGLYHRICKLLFFKIKPVFVFDGGVPQLKKQTI************************TEQMSREAQELLQLFGVPFIVAPGEAEAQCASLELGNHTQGVITDDSDIWLFGARTVYKNFFDKKSHVLRYTAPDIRYYF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004527 [MF]	exonuclease activity	probable	GO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0048256 [MF]	flap endonuclease activity	probable	GO:0016787, GO:0003824, GO:0004536, GO:0004519, GO:0004520, GO:0016788, GO:0004518, GO:0003674

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ORY, chain A
Confidence level:very confident
Coverage over the Query: 123-313
View the alignment between query and template
View the model in PyMOL