BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy14307
         (1235 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3THC|A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex
           With Galactose
 pdb|3THC|B Chain B, Crystal Structure Of Human Beta-Galactosidase In Complex
           With Galactose
 pdb|3THC|C Chain C, Crystal Structure Of Human Beta-Galactosidase In Complex
           With Galactose
 pdb|3THC|D Chain D, Crystal Structure Of Human Beta-Galactosidase In Complex
           With Galactose
 pdb|3THD|A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex
           With 1- Deoxygalactonojirimycin
 pdb|3THD|B Chain B, Crystal Structure Of Human Beta-Galactosidase In Complex
           With 1- Deoxygalactonojirimycin
 pdb|3THD|C Chain C, Crystal Structure Of Human Beta-Galactosidase In Complex
           With 1- Deoxygalactonojirimycin
 pdb|3THD|D Chain D, Crystal Structure Of Human Beta-Galactosidase In Complex
           With 1- Deoxygalactonojirimycin
          Length = 654

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 806 PVLLDKKEPILLDKKEP---VLLDKKEPVLLDKKSPVLLDKKGPVI 848
           P  L +KE ILL   +P     +DK   VLL K  P+L    GPVI
Sbjct: 113 PAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVI 158


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.133    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,515,298
Number of Sequences: 62578
Number of extensions: 1231476
Number of successful extensions: 2811
Number of sequences better than 100.0: 49
Number of HSP's better than 100.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 31
Number of HSP's that attempted gapping in prelim test: 2648
Number of HSP's gapped (non-prelim): 167
length of query: 1235
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1125
effective length of database: 8,089,757
effective search space: 9100976625
effective search space used: 9100976625
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 57 (26.6 bits)