BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy14307
(1235 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3THC|A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex
With Galactose
pdb|3THC|B Chain B, Crystal Structure Of Human Beta-Galactosidase In Complex
With Galactose
pdb|3THC|C Chain C, Crystal Structure Of Human Beta-Galactosidase In Complex
With Galactose
pdb|3THC|D Chain D, Crystal Structure Of Human Beta-Galactosidase In Complex
With Galactose
pdb|3THD|A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex
With 1- Deoxygalactonojirimycin
pdb|3THD|B Chain B, Crystal Structure Of Human Beta-Galactosidase In Complex
With 1- Deoxygalactonojirimycin
pdb|3THD|C Chain C, Crystal Structure Of Human Beta-Galactosidase In Complex
With 1- Deoxygalactonojirimycin
pdb|3THD|D Chain D, Crystal Structure Of Human Beta-Galactosidase In Complex
With 1- Deoxygalactonojirimycin
Length = 654
Score = 31.6 bits (70), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
Query: 806 PVLLDKKEPILLDKKEP---VLLDKKEPVLLDKKSPVLLDKKGPVI 848
P L +KE ILL +P +DK VLL K P+L GPVI
Sbjct: 113 PAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVI 158
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.309 0.133 0.378
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,515,298
Number of Sequences: 62578
Number of extensions: 1231476
Number of successful extensions: 2811
Number of sequences better than 100.0: 49
Number of HSP's better than 100.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 31
Number of HSP's that attempted gapping in prelim test: 2648
Number of HSP's gapped (non-prelim): 167
length of query: 1235
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1125
effective length of database: 8,089,757
effective search space: 9100976625
effective search space used: 9100976625
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 57 (26.6 bits)