Query psy14373
Match_columns 65
No_of_seqs 59 out of 61
Neff 4.1
Searched_HMMs 46136
Date Fri Aug 16 18:12:13 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy14373.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14373hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PRK13669 hypothetical protein; 63.9 1.9 4.1E-05 26.9 -0.4 17 47-63 34-50 (78)
2 PF07293 DUF1450: Protein of u 57.9 3.1 6.7E-05 25.7 -0.1 17 47-63 34-50 (78)
3 COG0207 ThyA Thymidylate synth 55.3 9.9 0.00021 28.5 2.1 31 12-43 217-255 (268)
4 PF11475 VP_N-CPKC: Virion pro 48.9 6.2 0.00013 21.0 0.1 21 2-22 6-26 (32)
5 PF13370 Fer4_13: 4Fe-4S singl 46.0 4.4 9.5E-05 22.9 -0.8 11 49-59 5-15 (58)
6 PRK11168 glpC sn-glycerol-3-ph 35.8 14 0.00029 27.1 0.2 15 44-58 3-17 (396)
7 PF05768 DUF836: Glutaredoxin- 33.9 16 0.00035 21.3 0.3 13 46-58 3-15 (81)
8 PF04060 FeS: Putative Fe-S cl 32.0 16 0.00035 19.1 0.1 8 50-57 4-11 (35)
9 PRK10509 bacterioferritin-asso 31.1 15 0.00033 21.4 -0.1 14 45-58 31-44 (64)
10 KOG1493|consensus 29.5 19 0.00041 23.0 0.1 9 52-61 22-30 (84)
11 TIGR03379 glycerol3P_GlpC glyc 28.7 21 0.00046 26.3 0.3 15 44-58 1-15 (397)
12 TIGR01936 nqrA NADH:ubiquinone 27.9 23 0.00051 27.8 0.4 18 45-62 370-388 (447)
13 PF04736 Eclosion: Eclosion ho 27.2 11 0.00025 22.8 -1.1 12 48-59 13-24 (62)
14 COG1150 HdrC Heterodisulfide r 26.8 17 0.00037 26.1 -0.5 13 46-58 37-49 (195)
15 COG3058 FdhE Uncharacterized p 25.9 29 0.00063 26.7 0.6 15 50-64 185-199 (308)
16 KOG3689|consensus 21.7 30 0.00066 29.1 -0.0 38 2-39 187-227 (707)
17 PRK08640 sdhB succinate dehydr 20.6 38 0.00083 24.3 0.3 15 45-59 149-163 (249)
No 1
>PRK13669 hypothetical protein; Provisional
Probab=63.89 E-value=1.9 Score=26.93 Aligned_cols=17 Identities=18% Similarity=0.450 Sum_probs=13.4
Q ss_pred eeeeccccccccccCCC
Q psy14373 47 LKVRSNCGLCRSMPMSS 63 (65)
Q Consensus 47 l~a~~~~~~~~~~~~~~ 63 (65)
.-+.++||.|+..|..-
T Consensus 34 ~gCls~CG~C~~~~FAl 50 (78)
T PRK13669 34 YGCLGYCGICSEGLFAL 50 (78)
T ss_pred cchhhhCcCcccCceEE
Confidence 34789999999988643
No 2
>PF07293 DUF1450: Protein of unknown function (DUF1450); InterPro: IPR009910 This entry consists of several hypothetical bacterial proteins of around 80 residues in length representing two families. Members contain four highly conserved cysteine residues and their function is unknown.
Probab=57.87 E-value=3.1 Score=25.72 Aligned_cols=17 Identities=29% Similarity=0.610 Sum_probs=13.5
Q ss_pred eeeeccccccccccCCC
Q psy14373 47 LKVRSNCGLCRSMPMSS 63 (65)
Q Consensus 47 l~a~~~~~~~~~~~~~~ 63 (65)
.-+-++||.|+..|..-
T Consensus 34 ~gCl~~Cg~C~~~pFAl 50 (78)
T PF07293_consen 34 YGCLSYCGPCAKKPFAL 50 (78)
T ss_pred cChhhhCcCCCCCccEE
Confidence 45789999999988643
No 3
>COG0207 ThyA Thymidylate synthase [Nucleotide transport and metabolism]
Probab=55.34 E-value=9.9 Score=28.51 Aligned_cols=31 Identities=29% Similarity=0.492 Sum_probs=20.9
Q ss_pred HHHHHHHHHhccCCccc---c-----ccccccCCceeccc
Q psy14373 12 LIQCQRVQSLRVPSAAK---L-----NLHDFKFDDIHMED 43 (65)
Q Consensus 12 l~e~qRl~vllVpsa~~---~-----~lfDfeFdD~~lSd 43 (65)
++|++ .|.-+.|.... + .+|||+||||++.+
T Consensus 217 ~e~~~-~ql~R~p~~~pkl~in~~~~~~f~~~~~Df~l~~ 255 (268)
T COG0207 217 FDQAK-EQLKREPRPLPKLVINPKDKDLFDFTFEDFELVG 255 (268)
T ss_pred HHHHH-HHhccCCCCCCeEEecCCccccccccccceEEEC
Confidence 55665 66665554433 2 24999999999975
No 4
>PF11475 VP_N-CPKC: Virion protein N terminal domain ; InterPro: IPR021573 This is the N-terminal domain of a family of virion proteins which contains a zinc finger domain. Currently no function is known. ; PDB: 2BAI_A.
Probab=48.85 E-value=6.2 Score=20.98 Aligned_cols=21 Identities=19% Similarity=0.449 Sum_probs=13.2
Q ss_pred hhhhhhhhcCHHHHHHHHHhc
Q psy14373 2 VFRILTHTQSLIQCQRVQSLR 22 (65)
Q Consensus 2 v~ki~~~taSl~e~qRl~vll 22 (65)
...|-+|+..+++|-+|+.+.
T Consensus 6 eqeicahsltf~ecpkcsalq 26 (32)
T PF11475_consen 6 EQEICAHSLTFEECPKCSALQ 26 (32)
T ss_dssp -S---SSSS-GGGHHHHH-SS
T ss_pred HHHHHhcccccccCcchhHhh
Confidence 346789999999999999774
No 5
>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A ....
Probab=46.04 E-value=4.4 Score=22.85 Aligned_cols=11 Identities=36% Similarity=0.878 Sum_probs=6.5
Q ss_pred eeccccccccc
Q psy14373 49 VRSNCGLCRSM 59 (65)
Q Consensus 49 a~~~~~~~~~~ 59 (65)
.+++||+|..+
T Consensus 5 ~Ci~Cg~C~~~ 15 (58)
T PF13370_consen 5 KCIGCGLCVEI 15 (58)
T ss_dssp T--S-SHHHHH
T ss_pred hCcCCChHHHh
Confidence 47899999876
No 6
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional
Probab=35.82 E-value=14 Score=27.08 Aligned_cols=15 Identities=20% Similarity=0.656 Sum_probs=12.5
Q ss_pred cceeeeecccccccc
Q psy14373 44 DDTLKVRSNCGLCRS 58 (65)
Q Consensus 44 ddTl~a~~~~~~~~~ 58 (65)
++.+..+++||.|..
T Consensus 3 ~~~~~~Ci~Cg~C~~ 17 (396)
T PRK11168 3 DTSFDSCIKCTVCTT 17 (396)
T ss_pred ccchhhcCCCCCCCc
Confidence 566788999999975
No 7
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system []. Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond []. It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed [] that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family contains several viral glutaredoxins, and many related bacterial and eukaryotic proteins of unknown function. The best characterised member of this family is G4L (P68460 from SWISSPROT) from Vaccinia virus (strain Western Reserve/WR) (VACV), which is necessary for virion morphogenesis and virus replication []. This is a cytomplasmic protein which functions as a shuttle in a redox pathway between membrane-associated E10R and L1R or F9L []. ; PDB: 1TTZ_A 1XPV_A 2FGX_A 2G2Q_C 1WJK_A.
Probab=33.87 E-value=16 Score=21.31 Aligned_cols=13 Identities=38% Similarity=0.856 Sum_probs=9.5
Q ss_pred eeeeecccccccc
Q psy14373 46 TLKVRSNCGLCRS 58 (65)
Q Consensus 46 Tl~a~~~~~~~~~ 58 (65)
|+-.+-+|+||..
T Consensus 3 ~l~~k~~C~LC~~ 15 (81)
T PF05768_consen 3 TLYTKPGCHLCDE 15 (81)
T ss_dssp EEEE-SSSHHHHH
T ss_pred EEEcCCCCChHHH
Confidence 5677889999964
No 8
>PF04060 FeS: Putative Fe-S cluster; InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster.; GO: 0051536 iron-sulfur cluster binding; PDB: 2YCL_A 4DJF_E 4DJD_C 4DJE_C.
Probab=31.97 E-value=16 Score=19.06 Aligned_cols=8 Identities=50% Similarity=1.319 Sum_probs=2.8
Q ss_pred eccccccc
Q psy14373 50 RSNCGLCR 57 (65)
Q Consensus 50 ~~~~~~~~ 57 (65)
-.|||.|.
T Consensus 4 ~~nCg~CG 11 (35)
T PF04060_consen 4 GTNCGACG 11 (35)
T ss_dssp S----TTS
T ss_pred CCcCCCCC
Confidence 36999985
No 9
>PRK10509 bacterioferritin-associated ferredoxin; Provisional
Probab=31.07 E-value=15 Score=21.41 Aligned_cols=14 Identities=29% Similarity=0.676 Sum_probs=11.2
Q ss_pred ceeeeecccccccc
Q psy14373 45 DTLKVRSNCGLCRS 58 (65)
Q Consensus 45 dTl~a~~~~~~~~~ 58 (65)
+-+++..+||-|..
T Consensus 31 ~~~~~g~~CG~C~~ 44 (64)
T PRK10509 31 KFVPVGNQCGKCIR 44 (64)
T ss_pred HhcCCCCCccchHH
Confidence 45788999999964
No 10
>KOG1493|consensus
Probab=29.54 E-value=19 Score=22.96 Aligned_cols=9 Identities=67% Similarity=1.889 Sum_probs=7.0
Q ss_pred cccccccccC
Q psy14373 52 NCGLCRSMPM 61 (65)
Q Consensus 52 ~~~~~~~~~~ 61 (65)
+||+|| ||.
T Consensus 22 ~CGiCR-m~F 30 (84)
T KOG1493|consen 22 TCGICR-MPF 30 (84)
T ss_pred ccceEe-ccc
Confidence 899999 443
No 11
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit. Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species.
Probab=28.75 E-value=21 Score=26.28 Aligned_cols=15 Identities=20% Similarity=0.616 Sum_probs=12.4
Q ss_pred cceeeeecccccccc
Q psy14373 44 DDTLKVRSNCGLCRS 58 (65)
Q Consensus 44 ddTl~a~~~~~~~~~ 58 (65)
++++..+++||.|..
T Consensus 1 ~~~~~~Ci~Cg~C~~ 15 (397)
T TIGR03379 1 DTSFESCIKCTVCTV 15 (397)
T ss_pred CcchhhCCCCCCCcc
Confidence 467788999999975
No 12
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit. This model represents the NqrA subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=27.92 E-value=23 Score=27.77 Aligned_cols=18 Identities=17% Similarity=0.316 Sum_probs=14.1
Q ss_pred ceeeeeccccccc-cccCC
Q psy14373 45 DTLKVRSNCGLCR-SMPMS 62 (65)
Q Consensus 45 dTl~a~~~~~~~~-~~~~~ 62 (65)
.-.+|+++||.|- .+||.
T Consensus 370 ~~~~aCI~CG~C~~vCPm~ 388 (447)
T TIGR01936 370 GGERAMIPIGIYERVMPLD 388 (447)
T ss_pred CCccceeECChHhhcCCCC
Confidence 4568999999994 67875
No 13
>PF04736 Eclosion: Eclosion hormone; InterPro: IPR006825 Eclosion hormone is an insect neuropeptide that triggers the performance of ecdysis behaviour, which causes shedding of the old cuticle at the end of a molt [, ].; GO: 0008255 ecdysis-triggering hormone activity, 0007218 neuropeptide signaling pathway, 0018990 ecdysis, chitin-based cuticle
Probab=27.16 E-value=11 Score=22.76 Aligned_cols=12 Identities=33% Similarity=0.791 Sum_probs=9.3
Q ss_pred eeeccccccccc
Q psy14373 48 KVRSNCGLCRSM 59 (65)
Q Consensus 48 ~a~~~~~~~~~~ 59 (65)
-+--||+.|+.|
T Consensus 13 vCi~NCaQCKkM 24 (62)
T PF04736_consen 13 VCIRNCAQCKKM 24 (62)
T ss_pred HHHHHHHHHHHH
Confidence 345699999987
No 14
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=26.75 E-value=17 Score=26.11 Aligned_cols=13 Identities=31% Similarity=0.644 Sum_probs=11.5
Q ss_pred eeeeecccccccc
Q psy14373 46 TLKVRSNCGLCRS 58 (65)
Q Consensus 46 Tl~a~~~~~~~~~ 58 (65)
++.++.+||.|-+
T Consensus 37 ~l~~C~QCG~CT~ 49 (195)
T COG1150 37 YLEGCYQCGTCTG 49 (195)
T ss_pred hHhHhhccCcccC
Confidence 7889999999964
No 15
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=25.87 E-value=29 Score=26.67 Aligned_cols=15 Identities=47% Similarity=1.028 Sum_probs=12.4
Q ss_pred eccccccccccCCCC
Q psy14373 50 RSNCGLCRSMPMSSV 64 (65)
Q Consensus 50 ~~~~~~~~~~~~~~~ 64 (65)
.--|-.|.|+|++|+
T Consensus 185 ~~~CPvCGS~PvaSm 199 (308)
T COG3058 185 RQYCPVCGSMPVASM 199 (308)
T ss_pred cccCCCcCCCCccee
Confidence 347999999999986
No 16
>KOG3689|consensus
Probab=21.74 E-value=30 Score=29.13 Aligned_cols=38 Identities=21% Similarity=0.199 Sum_probs=31.0
Q ss_pred hhhhhhhhcCHHHHHHHHHhccCCccc---cccccccCCce
Q psy14373 2 VFRILTHTQSLIQCQRVQSLRVPSAAK---LNLHDFKFDDI 39 (65)
Q Consensus 2 v~ki~~~taSl~e~qRl~vllVpsa~~---~~lfDfeFdD~ 39 (65)
..+|+.++.++.+++||++.++....+ +.++|+.+...
T Consensus 187 ~~~~~~~~~~~~~~~~~si~~~~~~~~~~~~~~~~~~~~~~ 227 (707)
T KOG3689|consen 187 FPKILYTARSLLQCTRCSIQLLDMSTLEEFSWVLDVLETEQ 227 (707)
T ss_pred cchhhhhhhhhhhhcccceeeeccccchhhhhhhHHHhhhh
Confidence 467899999999999999999887765 67777776555
No 17
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed
Probab=20.58 E-value=38 Score=24.31 Aligned_cols=15 Identities=27% Similarity=0.485 Sum_probs=11.9
Q ss_pred ceeeeeccccccccc
Q psy14373 45 DTLKVRSNCGLCRSM 59 (65)
Q Consensus 45 dTl~a~~~~~~~~~~ 59 (65)
+-+..++.||.|.+.
T Consensus 149 ~~~~~CI~CG~C~sa 163 (249)
T PRK08640 149 YELSKCMTCGCCLEA 163 (249)
T ss_pred hhhhhccCcCccccc
Confidence 446779999999873
Done!