Query         psy14373
Match_columns 65
No_of_seqs    59 out of 61
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:12:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14373.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14373hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK13669 hypothetical protein;  63.9     1.9 4.1E-05   26.9  -0.4   17   47-63     34-50  (78)
  2 PF07293 DUF1450:  Protein of u  57.9     3.1 6.7E-05   25.7  -0.1   17   47-63     34-50  (78)
  3 COG0207 ThyA Thymidylate synth  55.3     9.9 0.00021   28.5   2.1   31   12-43    217-255 (268)
  4 PF11475 VP_N-CPKC:  Virion pro  48.9     6.2 0.00013   21.0   0.1   21    2-22      6-26  (32)
  5 PF13370 Fer4_13:  4Fe-4S singl  46.0     4.4 9.5E-05   22.9  -0.8   11   49-59      5-15  (58)
  6 PRK11168 glpC sn-glycerol-3-ph  35.8      14 0.00029   27.1   0.2   15   44-58      3-17  (396)
  7 PF05768 DUF836:  Glutaredoxin-  33.9      16 0.00035   21.3   0.3   13   46-58      3-15  (81)
  8 PF04060 FeS:  Putative Fe-S cl  32.0      16 0.00035   19.1   0.1    8   50-57      4-11  (35)
  9 PRK10509 bacterioferritin-asso  31.1      15 0.00033   21.4  -0.1   14   45-58     31-44  (64)
 10 KOG1493|consensus               29.5      19 0.00041   23.0   0.1    9   52-61     22-30  (84)
 11 TIGR03379 glycerol3P_GlpC glyc  28.7      21 0.00046   26.3   0.3   15   44-58      1-15  (397)
 12 TIGR01936 nqrA NADH:ubiquinone  27.9      23 0.00051   27.8   0.4   18   45-62    370-388 (447)
 13 PF04736 Eclosion:  Eclosion ho  27.2      11 0.00025   22.8  -1.1   12   48-59     13-24  (62)
 14 COG1150 HdrC Heterodisulfide r  26.8      17 0.00037   26.1  -0.5   13   46-58     37-49  (195)
 15 COG3058 FdhE Uncharacterized p  25.9      29 0.00063   26.7   0.6   15   50-64    185-199 (308)
 16 KOG3689|consensus               21.7      30 0.00066   29.1  -0.0   38    2-39    187-227 (707)
 17 PRK08640 sdhB succinate dehydr  20.6      38 0.00083   24.3   0.3   15   45-59    149-163 (249)

No 1  
>PRK13669 hypothetical protein; Provisional
Probab=63.89  E-value=1.9  Score=26.93  Aligned_cols=17  Identities=18%  Similarity=0.450  Sum_probs=13.4

Q ss_pred             eeeeccccccccccCCC
Q psy14373         47 LKVRSNCGLCRSMPMSS   63 (65)
Q Consensus        47 l~a~~~~~~~~~~~~~~   63 (65)
                      .-+.++||.|+..|..-
T Consensus        34 ~gCls~CG~C~~~~FAl   50 (78)
T PRK13669         34 YGCLGYCGICSEGLFAL   50 (78)
T ss_pred             cchhhhCcCcccCceEE
Confidence            34789999999988643


No 2  
>PF07293 DUF1450:  Protein of unknown function (DUF1450);  InterPro: IPR009910 This entry consists of several hypothetical bacterial proteins of around 80 residues in length representing two families. Members contain four highly conserved cysteine residues and their function is unknown.
Probab=57.87  E-value=3.1  Score=25.72  Aligned_cols=17  Identities=29%  Similarity=0.610  Sum_probs=13.5

Q ss_pred             eeeeccccccccccCCC
Q psy14373         47 LKVRSNCGLCRSMPMSS   63 (65)
Q Consensus        47 l~a~~~~~~~~~~~~~~   63 (65)
                      .-+-++||.|+..|..-
T Consensus        34 ~gCl~~Cg~C~~~pFAl   50 (78)
T PF07293_consen   34 YGCLSYCGPCAKKPFAL   50 (78)
T ss_pred             cChhhhCcCCCCCccEE
Confidence            45789999999988643


No 3  
>COG0207 ThyA Thymidylate synthase [Nucleotide transport and metabolism]
Probab=55.34  E-value=9.9  Score=28.51  Aligned_cols=31  Identities=29%  Similarity=0.492  Sum_probs=20.9

Q ss_pred             HHHHHHHHHhccCCccc---c-----ccccccCCceeccc
Q psy14373         12 LIQCQRVQSLRVPSAAK---L-----NLHDFKFDDIHMED   43 (65)
Q Consensus        12 l~e~qRl~vllVpsa~~---~-----~lfDfeFdD~~lSd   43 (65)
                      ++|++ .|.-+.|....   +     .+|||+||||++.+
T Consensus       217 ~e~~~-~ql~R~p~~~pkl~in~~~~~~f~~~~~Df~l~~  255 (268)
T COG0207         217 FDQAK-EQLKREPRPLPKLVINPKDKDLFDFTFEDFELVG  255 (268)
T ss_pred             HHHHH-HHhccCCCCCCeEEecCCccccccccccceEEEC
Confidence            55665 66665554433   2     24999999999975


No 4  
>PF11475 VP_N-CPKC:  Virion protein N terminal domain ;  InterPro: IPR021573  This is the N-terminal domain of a family of virion proteins which contains a zinc finger domain. Currently no function is known. ; PDB: 2BAI_A.
Probab=48.85  E-value=6.2  Score=20.98  Aligned_cols=21  Identities=19%  Similarity=0.449  Sum_probs=13.2

Q ss_pred             hhhhhhhhcCHHHHHHHHHhc
Q psy14373          2 VFRILTHTQSLIQCQRVQSLR   22 (65)
Q Consensus         2 v~ki~~~taSl~e~qRl~vll   22 (65)
                      ...|-+|+..+++|-+|+.+.
T Consensus         6 eqeicahsltf~ecpkcsalq   26 (32)
T PF11475_consen    6 EQEICAHSLTFEECPKCSALQ   26 (32)
T ss_dssp             -S---SSSS-GGGHHHHH-SS
T ss_pred             HHHHHhcccccccCcchhHhh
Confidence            346789999999999999774


No 5  
>PF13370 Fer4_13:  4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A ....
Probab=46.04  E-value=4.4  Score=22.85  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=6.5

Q ss_pred             eeccccccccc
Q psy14373         49 VRSNCGLCRSM   59 (65)
Q Consensus        49 a~~~~~~~~~~   59 (65)
                      .+++||+|..+
T Consensus         5 ~Ci~Cg~C~~~   15 (58)
T PF13370_consen    5 KCIGCGLCVEI   15 (58)
T ss_dssp             T--S-SHHHHH
T ss_pred             hCcCCChHHHh
Confidence            47899999876


No 6  
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional
Probab=35.82  E-value=14  Score=27.08  Aligned_cols=15  Identities=20%  Similarity=0.656  Sum_probs=12.5

Q ss_pred             cceeeeecccccccc
Q psy14373         44 DDTLKVRSNCGLCRS   58 (65)
Q Consensus        44 ddTl~a~~~~~~~~~   58 (65)
                      ++.+..+++||.|..
T Consensus         3 ~~~~~~Ci~Cg~C~~   17 (396)
T PRK11168          3 DTSFDSCIKCTVCTT   17 (396)
T ss_pred             ccchhhcCCCCCCCc
Confidence            566788999999975


No 7  
>PF05768 DUF836:  Glutaredoxin-like domain (DUF836);  InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system [].  Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond []. It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed [] that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family contains several viral glutaredoxins, and many related bacterial and eukaryotic proteins of unknown function. The best characterised member of this family is G4L (P68460 from SWISSPROT) from Vaccinia virus (strain Western Reserve/WR) (VACV), which is necessary for virion morphogenesis and virus replication []. This is a cytomplasmic protein which functions as a shuttle in a redox pathway between membrane-associated E10R and L1R or F9L []. ; PDB: 1TTZ_A 1XPV_A 2FGX_A 2G2Q_C 1WJK_A.
Probab=33.87  E-value=16  Score=21.31  Aligned_cols=13  Identities=38%  Similarity=0.856  Sum_probs=9.5

Q ss_pred             eeeeecccccccc
Q psy14373         46 TLKVRSNCGLCRS   58 (65)
Q Consensus        46 Tl~a~~~~~~~~~   58 (65)
                      |+-.+-+|+||..
T Consensus         3 ~l~~k~~C~LC~~   15 (81)
T PF05768_consen    3 TLYTKPGCHLCDE   15 (81)
T ss_dssp             EEEE-SSSHHHHH
T ss_pred             EEEcCCCCChHHH
Confidence            5677889999964


No 8  
>PF04060 FeS:  Putative Fe-S cluster;  InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster.; GO: 0051536 iron-sulfur cluster binding; PDB: 2YCL_A 4DJF_E 4DJD_C 4DJE_C.
Probab=31.97  E-value=16  Score=19.06  Aligned_cols=8  Identities=50%  Similarity=1.319  Sum_probs=2.8

Q ss_pred             eccccccc
Q psy14373         50 RSNCGLCR   57 (65)
Q Consensus        50 ~~~~~~~~   57 (65)
                      -.|||.|.
T Consensus         4 ~~nCg~CG   11 (35)
T PF04060_consen    4 GTNCGACG   11 (35)
T ss_dssp             S----TTS
T ss_pred             CCcCCCCC
Confidence            36999985


No 9  
>PRK10509 bacterioferritin-associated ferredoxin; Provisional
Probab=31.07  E-value=15  Score=21.41  Aligned_cols=14  Identities=29%  Similarity=0.676  Sum_probs=11.2

Q ss_pred             ceeeeecccccccc
Q psy14373         45 DTLKVRSNCGLCRS   58 (65)
Q Consensus        45 dTl~a~~~~~~~~~   58 (65)
                      +-+++..+||-|..
T Consensus        31 ~~~~~g~~CG~C~~   44 (64)
T PRK10509         31 KFVPVGNQCGKCIR   44 (64)
T ss_pred             HhcCCCCCccchHH
Confidence            45788999999964


No 10 
>KOG1493|consensus
Probab=29.54  E-value=19  Score=22.96  Aligned_cols=9  Identities=67%  Similarity=1.889  Sum_probs=7.0

Q ss_pred             cccccccccC
Q psy14373         52 NCGLCRSMPM   61 (65)
Q Consensus        52 ~~~~~~~~~~   61 (65)
                      +||+|| ||.
T Consensus        22 ~CGiCR-m~F   30 (84)
T KOG1493|consen   22 TCGICR-MPF   30 (84)
T ss_pred             ccceEe-ccc
Confidence            899999 443


No 11 
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit. Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species.
Probab=28.75  E-value=21  Score=26.28  Aligned_cols=15  Identities=20%  Similarity=0.616  Sum_probs=12.4

Q ss_pred             cceeeeecccccccc
Q psy14373         44 DDTLKVRSNCGLCRS   58 (65)
Q Consensus        44 ddTl~a~~~~~~~~~   58 (65)
                      ++++..+++||.|..
T Consensus         1 ~~~~~~Ci~Cg~C~~   15 (397)
T TIGR03379         1 DTSFESCIKCTVCTV   15 (397)
T ss_pred             CcchhhCCCCCCCcc
Confidence            467788999999975


No 12 
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit. This model represents the NqrA subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=27.92  E-value=23  Score=27.77  Aligned_cols=18  Identities=17%  Similarity=0.316  Sum_probs=14.1

Q ss_pred             ceeeeeccccccc-cccCC
Q psy14373         45 DTLKVRSNCGLCR-SMPMS   62 (65)
Q Consensus        45 dTl~a~~~~~~~~-~~~~~   62 (65)
                      .-.+|+++||.|- .+||.
T Consensus       370 ~~~~aCI~CG~C~~vCPm~  388 (447)
T TIGR01936       370 GGERAMIPIGIYERVMPLD  388 (447)
T ss_pred             CCccceeECChHhhcCCCC
Confidence            4568999999994 67875


No 13 
>PF04736 Eclosion:  Eclosion hormone;  InterPro: IPR006825 Eclosion hormone is an insect neuropeptide that triggers the performance of ecdysis behaviour, which causes shedding of the old cuticle at the end of a molt [, ].; GO: 0008255 ecdysis-triggering hormone activity, 0007218 neuropeptide signaling pathway, 0018990 ecdysis, chitin-based cuticle
Probab=27.16  E-value=11  Score=22.76  Aligned_cols=12  Identities=33%  Similarity=0.791  Sum_probs=9.3

Q ss_pred             eeeccccccccc
Q psy14373         48 KVRSNCGLCRSM   59 (65)
Q Consensus        48 ~a~~~~~~~~~~   59 (65)
                      -+--||+.|+.|
T Consensus        13 vCi~NCaQCKkM   24 (62)
T PF04736_consen   13 VCIRNCAQCKKM   24 (62)
T ss_pred             HHHHHHHHHHHH
Confidence            345699999987


No 14 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=26.75  E-value=17  Score=26.11  Aligned_cols=13  Identities=31%  Similarity=0.644  Sum_probs=11.5

Q ss_pred             eeeeecccccccc
Q psy14373         46 TLKVRSNCGLCRS   58 (65)
Q Consensus        46 Tl~a~~~~~~~~~   58 (65)
                      ++.++.+||.|-+
T Consensus        37 ~l~~C~QCG~CT~   49 (195)
T COG1150          37 YLEGCYQCGTCTG   49 (195)
T ss_pred             hHhHhhccCcccC
Confidence            7889999999964


No 15 
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=25.87  E-value=29  Score=26.67  Aligned_cols=15  Identities=47%  Similarity=1.028  Sum_probs=12.4

Q ss_pred             eccccccccccCCCC
Q psy14373         50 RSNCGLCRSMPMSSV   64 (65)
Q Consensus        50 ~~~~~~~~~~~~~~~   64 (65)
                      .--|-.|.|+|++|+
T Consensus       185 ~~~CPvCGS~PvaSm  199 (308)
T COG3058         185 RQYCPVCGSMPVASM  199 (308)
T ss_pred             cccCCCcCCCCccee
Confidence            347999999999986


No 16 
>KOG3689|consensus
Probab=21.74  E-value=30  Score=29.13  Aligned_cols=38  Identities=21%  Similarity=0.199  Sum_probs=31.0

Q ss_pred             hhhhhhhhcCHHHHHHHHHhccCCccc---cccccccCCce
Q psy14373          2 VFRILTHTQSLIQCQRVQSLRVPSAAK---LNLHDFKFDDI   39 (65)
Q Consensus         2 v~ki~~~taSl~e~qRl~vllVpsa~~---~~lfDfeFdD~   39 (65)
                      ..+|+.++.++.+++||++.++....+   +.++|+.+...
T Consensus       187 ~~~~~~~~~~~~~~~~~si~~~~~~~~~~~~~~~~~~~~~~  227 (707)
T KOG3689|consen  187 FPKILYTARSLLQCTRCSIQLLDMSTLEEFSWVLDVLETEQ  227 (707)
T ss_pred             cchhhhhhhhhhhhcccceeeeccccchhhhhhhHHHhhhh
Confidence            467899999999999999999887765   67777776555


No 17 
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed
Probab=20.58  E-value=38  Score=24.31  Aligned_cols=15  Identities=27%  Similarity=0.485  Sum_probs=11.9

Q ss_pred             ceeeeeccccccccc
Q psy14373         45 DTLKVRSNCGLCRSM   59 (65)
Q Consensus        45 dTl~a~~~~~~~~~~   59 (65)
                      +-+..++.||.|.+.
T Consensus       149 ~~~~~CI~CG~C~sa  163 (249)
T PRK08640        149 YELSKCMTCGCCLEA  163 (249)
T ss_pred             hhhhhccCcCccccc
Confidence            446779999999873


Done!