Query         psy14386
Match_columns 344
No_of_seqs    381 out of 3508
Neff          10.0
Searched_HMMs 46136
Date          Fri Aug 16 18:32:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14386.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14386hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074|consensus              100.0 6.4E-36 1.4E-40  276.1   8.2  149  196-344   606-930 (958)
  2 KOG2462|consensus              100.0 8.6E-33 1.9E-37  226.9  10.7  136  136-273   127-265 (279)
  3 KOG2462|consensus              100.0 1.3E-32 2.8E-37  225.9   6.0  110  166-277   129-241 (279)
  4 KOG3608|consensus               99.9 7.9E-27 1.7E-31  196.6   9.4  188  141-343   181-374 (467)
  5 KOG3608|consensus               99.9 8.8E-24 1.9E-28  178.3   9.9  189  140-344   135-344 (467)
  6 KOG3623|consensus               99.9 1.5E-24 3.3E-29  198.0   4.3   77  252-342   895-971 (1007)
  7 KOG1074|consensus               99.9 7.3E-25 1.6E-29  203.3   1.2  111  223-343   605-731 (958)
  8 KOG3623|consensus               99.9 4.3E-23 9.3E-28  188.6   3.6   78  139-216   240-330 (1007)
  9 KOG3576|consensus               99.8 1.1E-19 2.3E-24  142.3   3.6  111  167-277   117-238 (267)
 10 KOG3576|consensus               99.8 6.1E-19 1.3E-23  138.2   7.7  116  136-251   114-240 (267)
 11 PLN03086 PRLI-interacting fact  99.5 3.6E-14 7.8E-19  131.5   9.2  134  140-293   408-553 (567)
 12 PLN03086 PRLI-interacting fact  99.4 2.2E-13 4.8E-18  126.4   8.0  150  168-341   408-560 (567)
 13 PHA00733 hypothetical protein   99.3 2.1E-12 4.6E-17   98.2   4.3   82  193-276    38-124 (128)
 14 KOG3993|consensus               99.2 1.9E-12 4.1E-17  112.8  -0.8  175  168-342   268-479 (500)
 15 PHA00733 hypothetical protein   99.2 2.8E-11 6.1E-16   92.0   5.7   96  152-249    25-125 (128)
 16 PHA02768 hypothetical protein;  99.1 2.5E-11 5.4E-16   75.8   2.0   42  224-267     6-47  (55)
 17 PHA02768 hypothetical protein;  99.1 3.1E-11 6.7E-16   75.3   1.6   42  295-338     7-48  (55)
 18 KOG3993|consensus               99.1 1.9E-11   4E-16  106.7  -0.2  138  138-275   266-482 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.2E-10 4.7E-15   61.3   1.9   26  308-333     1-26  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.9 9.2E-10   2E-14   58.8   2.6   26  238-263     1-26  (26)
 21 PHA00616 hypothetical protein   98.6 2.1E-08 4.5E-13   59.6   1.9   34  223-256     1-34  (44)
 22 PHA00732 hypothetical protein   98.5 8.2E-08 1.8E-12   66.1   2.9   46  223-274     1-47  (79)
 23 PHA00616 hypothetical protein   98.5 6.3E-08 1.4E-12   57.5   1.6   33  251-285     1-33  (44)
 24 PHA00732 hypothetical protein   98.4 3.4E-07 7.3E-12   63.1   3.1   47  195-247     1-48  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  98.2 5.3E-07 1.2E-11   46.7   0.9   23  322-344     1-23  (23)
 26 PF05605 zf-Di19:  Drought indu  98.1 4.2E-06   9E-11   53.5   4.5   25  252-277     3-27  (54)
 27 PF05605 zf-Di19:  Drought indu  98.1 4.9E-06 1.1E-10   53.2   4.4   49  224-275     3-53  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  98.0 3.6E-06 7.8E-11   43.5   2.2   22  252-273     1-22  (23)
 29 PF12756 zf-C2H2_2:  C2H2 type   97.9 5.5E-06 1.2E-10   60.6   2.1   24  253-276     1-24  (100)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.8 7.4E-06 1.6E-10   44.2   1.4   24  321-344     1-24  (27)
 31 COG5189 SFP1 Putative transcri  97.8 3.6E-06 7.8E-11   71.5  -0.2   71  248-341   346-418 (423)
 32 COG5189 SFP1 Putative transcri  97.8 5.9E-06 1.3E-10   70.2   0.7   52  221-272   347-419 (423)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.7 1.2E-05 2.5E-10   41.9   1.1   23  322-344     1-23  (24)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.7 2.7E-05 5.8E-10   40.5   2.4   23  252-274     1-23  (24)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.5E-05 7.5E-10   41.5   1.9   25  251-275     1-25  (27)
 36 PF12756 zf-C2H2_2:  C2H2 type   97.6 3.7E-05   8E-10   56.2   2.6   24  251-274    50-73  (100)
 37 smart00355 ZnF_C2H2 zinc finge  97.4 9.2E-05   2E-09   39.1   1.8   23  322-344     1-23  (26)
 38 KOG2231|consensus               97.4 0.00034 7.3E-09   66.8   6.5  137  169-325   117-275 (669)
 39 KOG2231|consensus               97.1  0.0013 2.7E-08   63.0   6.9  143  168-343   100-261 (669)
 40 PF09237 GAGA:  GAGA factor;  I  97.1 0.00057 1.2E-08   41.6   2.8   29  222-250    23-51  (54)
 41 PF12874 zf-met:  Zinc-finger o  97.1 0.00021 4.6E-09   37.5   0.8   22  322-343     1-22  (25)
 42 PRK04860 hypothetical protein;  97.0 0.00043 9.3E-09   54.8   2.2   38  223-264   119-156 (160)
 43 smart00355 ZnF_C2H2 zinc finge  97.0 0.00085 1.8E-08   35.3   2.6   19  254-272     3-21  (26)
 44 COG5048 FOG: Zn-finger [Genera  96.9 0.00015 3.2E-09   67.9  -1.3  153  167-331   289-456 (467)
 45 KOG2785|consensus               96.8  0.0027 5.9E-08   56.0   6.1   47  296-342   169-241 (390)
 46 PF13909 zf-H2C2_5:  C2H2-type   96.8  0.0012 2.5E-08   34.3   2.1   23  252-275     1-23  (24)
 47 COG5048 FOG: Zn-finger [Genera  96.7 0.00035 7.5E-09   65.4  -0.6  141  194-344   288-441 (467)
 48 PRK04860 hypothetical protein;  96.6  0.0012 2.7E-08   52.1   2.4   39  194-236   118-156 (160)
 49 PF09237 GAGA:  GAGA factor;  I  96.6  0.0028 6.1E-08   38.7   2.9   29  166-194    23-51  (54)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0011 2.3E-08   35.5   0.9   22  322-343     2-23  (27)
 51 PF13909 zf-H2C2_5:  C2H2-type   96.5   0.002 4.2E-08   33.4   1.8   23  224-247     1-23  (24)
 52 PF12874 zf-met:  Zinc-finger o  96.4  0.0027 5.9E-08   33.2   1.9   23  252-274     1-23  (25)
 53 KOG1146|consensus               96.3  0.0011 2.4E-08   67.1   0.5  139  204-342   445-639 (1406)
 54 KOG1146|consensus               96.1  0.0023 5.1E-08   64.9   1.4  134  141-274   438-641 (1406)
 55 KOG2482|consensus               95.7   0.044 9.5E-07   47.8   7.0   51  224-274   280-357 (423)
 56 PF12171 zf-C2H2_jaz:  Zinc-fin  95.4   0.005 1.1E-07   32.9   0.4   22  252-273     2-23  (27)
 57 PF13913 zf-C2HC_2:  zinc-finge  95.2   0.014   3E-07   30.5   1.6   19  323-342     4-22  (25)
 58 PF13913 zf-C2HC_2:  zinc-finge  94.8   0.022 4.7E-07   29.8   1.7   19  296-315     5-23  (25)
 59 smart00451 ZnF_U1 U1-like zinc  94.7    0.02 4.3E-07   32.6   1.6   23  321-343     3-25  (35)
 60 TIGR00622 ssl1 transcription f  94.6   0.052 1.1E-06   39.8   3.8   48  225-274    57-104 (112)
 61 COG5236 Uncharacterized conser  94.6   0.028 6.1E-07   48.9   2.7   20  226-245   223-242 (493)
 62 KOG2785|consensus               94.0    0.23 4.9E-06   44.3   7.2  135  139-273     3-242 (390)
 63 COG5236 Uncharacterized conser  93.6    0.12 2.6E-06   45.2   4.7  131  140-277   152-307 (493)
 64 KOG4173|consensus               93.6   0.045 9.6E-07   44.1   2.0   84  221-317    77-171 (253)
 65 TIGR00622 ssl1 transcription f  93.5     0.1 2.2E-06   38.3   3.5   85  166-258    14-110 (112)
 66 smart00451 ZnF_U1 U1-like zinc  93.3   0.076 1.6E-06   30.1   2.1   23  251-273     3-25  (35)
 67 cd00350 rubredoxin_like Rubred  92.8   0.054 1.2E-06   30.4   1.0    9  250-258    16-24  (33)
 68 PF12013 DUF3505:  Protein of u  92.8    0.19 4.1E-06   37.2   4.3   25  252-276    81-109 (109)
 69 KOG2482|consensus               92.5    0.16 3.4E-06   44.5   3.9  107  140-246   145-357 (423)
 70 PF10571 UPF0547:  Uncharacteri  91.1    0.15 3.4E-06   26.8   1.4   21  284-304     3-25  (26)
 71 PF06524 NOA36:  NOA36 protein;  89.9    0.13 2.7E-06   43.2   0.8   92  246-344   137-232 (314)
 72 KOG4173|consensus               89.3    0.17 3.7E-06   40.9   1.0   74  168-244    80-167 (253)
 73 KOG2893|consensus               89.1    0.11 2.4E-06   42.9  -0.1   42  226-271    13-54  (341)
 74 PF09538 FYDLN_acid:  Protein o  87.8    0.26 5.6E-06   36.2   1.1   13  320-332    25-37  (108)
 75 PF13719 zinc_ribbon_5:  zinc-r  87.7    0.41 8.8E-06   27.6   1.7   11  251-261    25-35  (37)
 76 TIGR02098 MJ0042_CXXC MJ0042 f  87.6    0.37   8E-06   27.9   1.5   10  252-261    26-35  (38)
 77 PF12013 DUF3505:  Protein of u  87.5     1.3 2.8E-05   32.7   4.7   25  224-248    81-109 (109)
 78 COG4049 Uncharacterized protei  87.5    0.28 6.1E-06   30.6   0.9   30  247-276    13-42  (65)
 79 PF09986 DUF2225:  Uncharacteri  87.1    0.14 3.1E-06   42.9  -0.7   24  249-272     3-26  (214)
 80 cd00729 rubredoxin_SM Rubredox  87.0    0.31 6.7E-06   27.5   0.9    9  224-232     3-11  (34)
 81 PRK04023 DNA polymerase II lar  87.0    0.61 1.3E-05   47.1   3.4   24  280-303   650-673 (1121)
 82 PRK14890 putative Zn-ribbon RN  86.5    0.25 5.4E-06   31.5   0.4    8  252-259    26-33  (59)
 83 KOG2893|consensus               86.3    0.26 5.5E-06   40.9   0.4   33  250-289    10-42  (341)
 84 PF13717 zinc_ribbon_4:  zinc-r  86.2    0.57 1.2E-05   26.8   1.7   10  251-260    25-34  (36)
 85 KOG1842|consensus               86.1    0.48   1E-05   43.1   2.0   26  222-247    14-39  (505)
 86 KOG4124|consensus               85.5    0.12 2.6E-06   45.2  -1.9   29  158-187   204-232 (442)
 87 PF09986 DUF2225:  Uncharacteri  85.5    0.19 4.2E-06   42.1  -0.7   43  222-264     4-61  (214)
 88 PF02892 zf-BED:  BED zinc fing  84.8    0.66 1.4E-05   28.0   1.7   23  319-341    14-40  (45)
 89 PF01352 KRAB:  KRAB box;  Inte  84.8    0.34 7.3E-06   28.7   0.3   21   33-53     18-38  (41)
 90 COG4049 Uncharacterized protei  84.6    0.45 9.7E-06   29.7   0.8   27  219-245    13-39  (65)
 91 COG1198 PriA Primosomal protei  83.4    0.77 1.7E-05   45.6   2.3   15  316-330   470-484 (730)
 92 COG2888 Predicted Zn-ribbon RN  82.6    0.97 2.1E-05   28.8   1.7   14  251-264    27-40  (61)
 93 smart00614 ZnF_BED BED zinc fi  81.9    0.83 1.8E-05   28.3   1.3    9  296-304    21-29  (50)
 94 PF05443 ROS_MUCR:  ROS/MUCR tr  81.8    0.78 1.7E-05   35.0   1.3   23  296-321    75-97  (132)
 95 smart00659 RPOLCX RNA polymera  81.6    0.94   2E-05   27.3   1.4   11  224-234     3-13  (44)
 96 PHA00626 hypothetical protein   81.5    0.84 1.8E-05   28.6   1.1   12  321-332    23-34  (59)
 97 PRK00398 rpoP DNA-directed RNA  80.7    0.73 1.6E-05   28.0   0.7    9  282-290     4-12  (46)
 98 smart00531 TFIIE Transcription  80.7     1.4   3E-05   34.5   2.5   14  194-207    98-111 (147)
 99 PF09845 DUF2072:  Zn-ribbon co  80.6       1 2.2E-05   34.0   1.5   14  251-264     1-14  (131)
100 TIGR02300 FYDLN_acid conserved  80.3    0.99 2.1E-05   33.8   1.4   23  283-305    11-38  (129)
101 TIGR00373 conserved hypothetic  79.6     1.7 3.7E-05   34.5   2.7   35  190-233   104-138 (158)
102 TIGR00373 conserved hypothetic  79.3     2.4 5.3E-05   33.6   3.4   35  162-205   104-138 (158)
103 KOG2807|consensus               78.4     2.9 6.3E-05   36.6   3.8   24  251-274   345-368 (378)
104 COG1996 RPC10 DNA-directed RNA  78.3    0.75 1.6E-05   28.3   0.2   10  252-261     7-16  (49)
105 COG1592 Rubrerythrin [Energy p  78.2     1.6 3.4E-05   34.8   2.0   23  195-230   134-156 (166)
106 PRK14714 DNA polymerase II lar  77.7       2 4.4E-05   44.7   3.1   21  281-301   692-717 (1337)
107 PRK00464 nrdR transcriptional   77.6    0.45 9.8E-06   37.4  -1.1   12  252-263    29-40  (154)
108 PF06524 NOA36:  NOA36 protein;  77.3    0.85 1.8E-05   38.4   0.3   28  248-275   206-233 (314)
109 PF13240 zinc_ribbon_2:  zinc-r  76.4     1.9 4.1E-05   21.9   1.3    6  296-301    16-21  (23)
110 TIGR02300 FYDLN_acid conserved  75.3     1.8 3.9E-05   32.5   1.5   12  280-291    25-36  (129)
111 KOG2186|consensus               75.0     2.2 4.8E-05   35.9   2.2   55  195-252     3-57  (276)
112 COG1997 RPL43A Ribosomal prote  74.6     1.8 3.9E-05   30.0   1.2   11  280-290    34-44  (89)
113 smart00834 CxxC_CXXC_SSSS Puta  74.5       1 2.3E-05   26.4   0.1   12  252-263     6-17  (41)
114 PRK06266 transcription initiat  74.3     3.3 7.1E-05   33.6   3.0   16  167-182   117-132 (178)
115 PF03604 DNA_RNApol_7kD:  DNA d  74.2     1.7 3.7E-05   24.1   0.9   11  252-262     1-11  (32)
116 smart00734 ZnF_Rad18 Rad18-lik  74.1     2.4 5.3E-05   22.2   1.4   19  323-342     3-21  (26)
117 COG3364 Zn-ribbon containing p  73.2     1.8 3.9E-05   30.9   1.0   13  251-263     2-14  (112)
118 PRK06266 transcription initiat  73.1       3 6.5E-05   33.8   2.5   33  192-233   114-146 (178)
119 smart00531 TFIIE Transcription  72.8     4.3 9.4E-05   31.8   3.3   38  164-205    96-133 (147)
120 KOG2186|consensus               72.8       2 4.2E-05   36.3   1.3   54  168-224     4-57  (276)
121 PF09723 Zn-ribbon_8:  Zinc rib  72.3     1.1 2.5E-05   26.6  -0.1   13  252-264     6-18  (42)
122 TIGR02605 CxxC_CxxC_SSSS putat  72.1    0.89 1.9E-05   28.4  -0.6    7  253-259     7-13  (52)
123 COG1592 Rubrerythrin [Energy p  72.1     2.2 4.8E-05   33.9   1.4   13  316-328   144-156 (166)
124 PF05443 ROS_MUCR:  ROS/MUCR tr  72.0     2.2 4.7E-05   32.6   1.3   22  196-220    73-94  (132)
125 PF02176 zf-TRAF:  TRAF-type zi  71.5     1.4 3.1E-05   28.3   0.2   41  222-263     8-54  (60)
126 PRK09678 DNA-binding transcrip  70.3     1.1 2.5E-05   30.1  -0.5   17  248-264    24-42  (72)
127 PF07282 OrfB_Zn_ribbon:  Putat  70.1     3.5 7.5E-05   27.5   1.9   34  290-333    25-58  (69)
128 PRK00464 nrdR transcriptional   69.7    0.61 1.3E-05   36.7  -2.1   14  168-181    29-42  (154)
129 COG0068 HypF Hydrogenase matur  69.3    0.82 1.8E-05   44.5  -1.8   28  296-329   154-181 (750)
130 PRK12496 hypothetical protein;  68.9     2.6 5.7E-05   33.7   1.3   11  252-262   128-138 (164)
131 COG4530 Uncharacterized protei  68.9     3.4 7.3E-05   29.9   1.6   13  319-331    24-36  (129)
132 PRK14559 putative protein seri  68.8     5.3 0.00012   39.4   3.5   24  283-306    29-54  (645)
133 PF13248 zf-ribbon_3:  zinc-rib  68.8     3.8 8.2E-05   21.4   1.5   20  283-302     4-25  (26)
134 KOG2807|consensus               68.7     8.2 0.00018   34.0   4.2   31  222-258   344-374 (378)
135 PF14353 CpXC:  CpXC protein     68.0     2.2 4.8E-05   32.5   0.7   11  253-263     3-13  (128)
136 KOG4167|consensus               67.8     1.4 3.1E-05   42.8  -0.6   24  321-344   792-815 (907)
137 PRK09678 DNA-binding transcrip  66.8     1.3 2.9E-05   29.8  -0.7   18  317-334    23-42  (72)
138 PRK03564 formate dehydrogenase  66.1     1.7 3.7E-05   38.5  -0.4   47  280-330   211-261 (309)
139 KOG1280|consensus               65.7     1.7 3.7E-05   38.3  -0.4   36  293-328    79-116 (381)
140 COG4957 Predicted transcriptio  65.3     3.4 7.3E-05   31.2   1.1   23  296-321    79-101 (148)
141 PF15135 UPF0515:  Uncharacteri  64.7     6.3 0.00014   33.2   2.7   83  206-303    90-184 (278)
142 KOG2272|consensus               63.8     2.5 5.3E-05   35.6   0.2   16  320-335   220-235 (332)
143 PF12773 DZR:  Double zinc ribb  63.7     6.8 0.00015   24.0   2.2   21  280-300    28-50  (50)
144 PRK14714 DNA polymerase II lar  62.7     4.9 0.00011   42.1   2.1   21  282-302   668-688 (1337)
145 smart00504 Ubox Modified RING   62.5      10 0.00023   24.3   3.0   46  282-333     2-47  (63)
146 TIGR00595 priA primosomal prot  62.4     5.5 0.00012   38.2   2.3   23  280-302   239-262 (505)
147 PF07754 DUF1610:  Domain of un  61.1     5.1 0.00011   20.6   1.0    7  322-328    17-23  (24)
148 PF04216 FdhE:  Protein involve  61.0    0.65 1.4E-05   41.0  -3.9   34  295-329   213-246 (290)
149 COG1773 Rubredoxin [Energy pro  61.0     4.3 9.2E-05   25.7   0.8   13  251-263     3-15  (55)
150 PRK14559 putative protein seri  60.1      11 0.00023   37.3   3.8   20  283-302    17-36  (645)
151 KOG3362|consensus               59.4     2.9 6.4E-05   31.9  -0.1   30  284-314   121-150 (156)
152 KOG0717|consensus               59.2      38 0.00082   31.6   6.8   25  137-161   458-482 (508)
153 PF04438 zf-HIT:  HIT zinc fing  59.1     2.8 6.1E-05   22.9  -0.2   19  283-302     4-22  (30)
154 COG5188 PRP9 Splicing factor 3  58.9     9.8 0.00021   33.8   3.0   29  244-272   367-396 (470)
155 PF04959 ARS2:  Arsenite-resist  58.7     4.5 9.7E-05   33.8   0.9   28  222-249    76-103 (214)
156 cd00730 rubredoxin Rubredoxin;  57.3     6.8 0.00015   24.3   1.3   11  252-262     2-12  (50)
157 KOG2593|consensus               57.0      12 0.00026   34.4   3.3   15  167-181   128-142 (436)
158 PRK04023 DNA polymerase II lar  56.9     8.5 0.00018   39.4   2.5   33  282-330   639-672 (1121)
159 COG5151 SSL1 RNA polymerase II  56.4     6.8 0.00015   34.1   1.6   26  249-274   386-411 (421)
160 PF15135 UPF0515:  Uncharacteri  56.4     9.6 0.00021   32.2   2.4   73  151-236    91-168 (278)
161 TIGR01206 lysW lysine biosynth  56.3     6.8 0.00015   24.7   1.2   10  252-261     3-12  (54)
162 PF15269 zf-C2H2_7:  Zinc-finge  56.0     7.4 0.00016   23.1   1.2   21  322-342    21-41  (54)
163 PRK00432 30S ribosomal protein  54.6     5.5 0.00012   24.7   0.6   13  320-332    36-48  (50)
164 KOG4167|consensus               54.5     4.4 9.6E-05   39.6   0.2   29  135-163   788-816 (907)
165 TIGR00280 L37a ribosomal prote  54.4     6.1 0.00013   27.9   0.8   26  280-305    34-65  (91)
166 KOG2593|consensus               54.1      15 0.00034   33.7   3.5   37  192-231   125-161 (436)
167 KOG1244|consensus               54.1     6.2 0.00014   33.7   1.0   13  168-180   194-206 (336)
168 PF13878 zf-C2H2_3:  zinc-finge  53.7      17 0.00037   21.4   2.6   27  291-317    11-39  (41)
169 PTZ00255 60S ribosomal protein  53.7     7.1 0.00015   27.5   1.1   26  280-305    35-66  (90)
170 PRK05580 primosome assembly pr  52.9     9.4  0.0002   38.2   2.2   23  280-302   407-430 (679)
171 PF14446 Prok-RING_1:  Prokaryo  52.8     9.1  0.0002   24.1   1.3   20  283-302     7-30  (54)
172 TIGR01562 FdhE formate dehydro  52.5     3.9 8.6E-05   36.2  -0.4   46  280-329   209-260 (305)
173 PF09332 Mcm10:  Mcm10 replicat  52.3     2.6 5.7E-05   37.8  -1.6   14  224-237   253-266 (344)
174 PF00301 Rubredoxin:  Rubredoxi  52.0       5 0.00011   24.5   0.1   13  252-264     2-14  (47)
175 PF08274 PhnA_Zn_Ribbon:  PhnA   51.4     6.6 0.00014   21.4   0.5    8  251-258    19-26  (30)
176 smart00064 FYVE Protein presen  51.0       8 0.00017   25.5   1.0   21  283-303    12-36  (68)
177 PF07975 C1_4:  TFIIH C1-like d  50.8     4.2 9.1E-05   25.3  -0.4   26  249-274    19-44  (51)
178 KOG4377|consensus               50.7     9.7 0.00021   34.6   1.7   19  299-317   409-427 (480)
179 COG5151 SSL1 RNA polymerase II  50.5      23  0.0005   31.0   3.8   19  250-268   321-339 (421)
180 PRK03824 hypA hydrogenase nick  50.1       5 0.00011   30.9  -0.1   11  224-234    71-81  (135)
181 PF05191 ADK_lid:  Adenylate ki  50.0     5.3 0.00011   22.8  -0.0    9  254-262     4-12  (36)
182 PF01780 Ribosomal_L37ae:  Ribo  50.0     3.5 7.6E-05   29.0  -0.9   25  280-304    34-64  (90)
183 PF13451 zf-trcl:  Probable zin  49.8      11 0.00023   23.3   1.3   17  250-266     3-19  (49)
184 PF01363 FYVE:  FYVE zinc finge  49.6     8.7 0.00019   25.4   1.0   31  253-301    11-41  (69)
185 COG1198 PriA Primosomal protei  49.5     9.2  0.0002   38.3   1.5   35  283-330   437-471 (730)
186 PRK03976 rpl37ae 50S ribosomal  49.3     8.3 0.00018   27.2   0.8   26  280-305    35-66  (90)
187 PF05495 zf-CHY:  CHY zinc fing  48.8     3.1 6.6E-05   28.0  -1.3   13  223-235    41-53  (71)
188 COG4957 Predicted transcriptio  48.8     8.6 0.00019   29.1   0.9   24  196-222    77-100 (148)
189 COG4888 Uncharacterized Zn rib  46.6     8.2 0.00018   27.6   0.5    8  296-303    49-56  (104)
190 PF02318 FYVE_2:  FYVE-type zin  46.0     6.4 0.00014   29.5  -0.1   49  251-329    54-102 (118)
191 PRK13130 H/ACA RNA-protein com  46.0      13 0.00029   23.6   1.4   24  280-303     4-27  (56)
192 KOG1701|consensus               45.7     4.2 9.1E-05   37.1  -1.3   39  169-209   276-316 (468)
193 KOG3408|consensus               45.5      13 0.00029   27.6   1.4   23  321-343    57-79  (129)
194 COG3091 SprT Zn-dependent meta  45.4     9.1  0.0002   29.8   0.6    9  195-204   117-125 (156)
195 PF12760 Zn_Tnp_IS1595:  Transp  45.1      21 0.00046   21.5   2.1    9  250-258    36-44  (46)
196 PF04959 ARS2:  Arsenite-resist  45.0     7.9 0.00017   32.3   0.3   29  193-221    75-103 (214)
197 PRK14873 primosome assembly pr  44.6     6.6 0.00014   39.0  -0.3   23  280-302   409-431 (665)
198 COG5152 Uncharacterized conser  44.4     6.9 0.00015   31.7  -0.2   15  250-264   195-209 (259)
199 PF05290 Baculo_IE-1:  Baculovi  44.2      14 0.00031   28.0   1.4   21  246-266    75-95  (140)
200 PF14311 DUF4379:  Domain of un  44.0      14  0.0003   23.3   1.2    9  225-233    30-38  (55)
201 COG1327 Predicted transcriptio  43.7      15 0.00032   28.6   1.5   11  296-306    31-41  (156)
202 TIGR00595 priA primosomal prot  43.1      13 0.00028   35.8   1.4   11  319-329   251-261 (505)
203 cd00065 FYVE FYVE domain; Zinc  43.1      15 0.00033   23.1   1.3   33  253-303     4-36  (57)
204 PF05613 Herpes_U15:  Human her  43.1      12 0.00026   25.8   0.9   24    6-29      7-30  (110)
205 COG1439 Predicted nucleic acid  42.9     9.5 0.00021   30.6   0.4   11  252-262   140-150 (177)
206 TIGR00244 transcriptional regu  42.6      14  0.0003   28.7   1.3   11  296-306    31-41  (147)
207 KOG4377|consensus               42.6      10 0.00022   34.5   0.6  107  167-276   271-428 (480)
208 PRK12380 hydrogenase nickel in  42.3      11 0.00023   28.1   0.6   10  196-205    71-80  (113)
209 smart00154 ZnF_AN1 AN1-like Zi  42.2      11 0.00023   22.0   0.4   12  321-332    12-23  (39)
210 PF03811 Zn_Tnp_IS1:  InsA N-te  41.1     5.5 0.00012   22.8  -0.9   19  309-327    17-35  (36)
211 KOG4124|consensus               41.1     5.5 0.00012   35.3  -1.3   45  297-341   355-418 (442)
212 TIGR00100 hypA hydrogenase nic  40.8      11 0.00023   28.2   0.4   10  224-233    71-80  (115)
213 PRK05978 hypothetical protein;  40.8      17 0.00037   28.4   1.5    9  296-304    55-63  (148)
214 PF01286 XPA_N:  XPA protein N-  40.6     8.9 0.00019   21.6  -0.1   13  253-265     5-17  (34)
215 KOG1280|consensus               39.4      31 0.00067   30.8   3.0   51  250-302    78-128 (381)
216 smart00290 ZnF_UBP Ubiquitin C  39.3      16 0.00035   22.3   1.0   33  284-317     2-34  (50)
217 KOG2636|consensus               39.1      20 0.00043   33.2   1.8   30  313-342   393-423 (497)
218 smart00661 RPOL9 RNA polymeras  38.9      19  0.0004   22.2   1.2   14  321-334    20-33  (52)
219 COG1571 Predicted DNA-binding   38.6      18  0.0004   33.4   1.6   30  225-265   352-381 (421)
220 PRK00564 hypA hydrogenase nick  37.6      13 0.00028   27.8   0.4   10  196-205    72-81  (117)
221 KOG0978|consensus               37.2     8.4 0.00018   37.9  -0.8   21  321-341   678-698 (698)
222 PF09416 UPF1_Zn_bind:  RNA hel  36.9      11 0.00024   29.4  -0.0   44  280-329    13-68  (152)
223 KOG3408|consensus               36.7      23  0.0005   26.4   1.5   23  194-216    56-78  (129)
224 PF12907 zf-met2:  Zinc-binding  36.1     9.9 0.00021   22.3  -0.3   20  322-341     2-24  (40)
225 COG1571 Predicted DNA-binding   35.8      20 0.00043   33.2   1.4   16  319-334   365-380 (421)
226 PRK14873 primosome assembly pr  35.6      17 0.00036   36.3   0.9   44  283-330   385-431 (665)
227 PF03833 PolC_DP2:  DNA polymer  35.6      12 0.00027   37.5   0.0   26  280-305   679-704 (900)
228 PF01428 zf-AN1:  AN1-like Zinc  35.6      12 0.00026   22.2  -0.0   12  320-331    12-23  (43)
229 COG3357 Predicted transcriptio  35.1      22 0.00048   24.9   1.2   14  250-263    57-70  (97)
230 cd02335 ZZ_ADA2 Zinc finger, Z  35.1     6.9 0.00015   24.1  -1.2    9  280-288    14-22  (49)
231 PF13453 zf-TFIIB:  Transcripti  34.4      21 0.00046   20.9   0.9   22  318-339    16-37  (41)
232 PF14445 Prok-RING_2:  Prokaryo  33.9     7.4 0.00016   23.8  -1.1    9  320-328    40-48  (57)
233 KOG4317|consensus               33.8      13 0.00027   32.6  -0.2   16  280-295    18-33  (383)
234 KOG2906|consensus               33.6     2.3 4.9E-05   30.1  -3.8   15  250-264    20-34  (105)
235 KOG2071|consensus               33.5      22 0.00048   34.2   1.3   26  319-344   416-441 (579)
236 COG1655 Uncharacterized protei  33.3     8.3 0.00018   32.2  -1.3    9  252-260    63-71  (267)
237 PF10083 DUF2321:  Uncharacteri  33.2     3.9 8.4E-05   31.9  -3.0   17  319-335    66-82  (158)
238 PRK00420 hypothetical protein;  32.9      26 0.00057   25.9   1.4    8  296-303    43-50  (112)
239 PF09855 DUF2082:  Nucleic-acid  32.8      18 0.00039   23.8   0.4    8  252-259     1-8   (64)
240 COG4640 Predicted membrane pro  32.8      29 0.00063   31.6   1.8   28  284-311     4-33  (465)
241 smart00440 ZnF_C2C2 C2C2 Zinc   32.1     5.4 0.00012   23.4  -1.9    8  252-259    29-36  (40)
242 PF01155 HypA:  Hydrogenase exp  32.0      15 0.00034   27.2   0.0   12  224-235    71-82  (113)
243 TIGR00143 hypF [NiFe] hydrogen  31.8     6.5 0.00014   39.4  -2.6   36  224-265    69-104 (711)
244 COG2260 Predicted Zn-ribbon RN  31.6      26 0.00057   22.4   1.0   21  282-302     6-26  (59)
245 PF08271 TF_Zn_Ribbon:  TFIIB z  31.5      14  0.0003   22.0  -0.3    8  252-259     1-8   (43)
246 COG1545 Predicted nucleic-acid  31.5      23 0.00051   27.4   1.0   20  283-302    31-52  (140)
247 PF07295 DUF1451:  Protein of u  31.4      16 0.00034   28.6   0.0    9  252-260   113-121 (146)
248 PRK05580 primosome assembly pr  31.4      24 0.00052   35.3   1.3   46  282-330   382-430 (679)
249 PF14634 zf-RING_5:  zinc-RING   31.1      22 0.00047   21.1   0.6   10  319-328    34-43  (44)
250 KOG0320|consensus               30.9      42 0.00092   27.0   2.3   17  135-151   127-143 (187)
251 COG0675 Transposase and inacti  30.8      25 0.00055   31.5   1.2   28  291-333   307-334 (364)
252 PF05129 Elf1:  Transcription e  30.8      15 0.00034   25.4  -0.1    9  280-288    21-29  (81)
253 PTZ00448 hypothetical protein;  30.6      30 0.00066   31.3   1.6   23  321-343   314-336 (373)
254 KOG1813|consensus               29.9      26 0.00057   30.5   1.1   43  250-302   240-284 (313)
255 KOG0782|consensus               29.7      26 0.00055   33.5   1.0   34  296-335   256-290 (1004)
256 PF03833 PolC_DP2:  DNA polymer  29.5      18 0.00039   36.5   0.0   11  323-333   694-704 (900)
257 PF10263 SprT-like:  SprT-like   29.5      15 0.00033   28.8  -0.4    9  252-260   144-152 (157)
258 COG1675 TFA1 Transcription ini  28.3      59  0.0013   26.3   2.7   18  191-208   109-126 (176)
259 PRK08351 DNA-directed RNA poly  27.7      34 0.00073   22.2   1.0   19  283-301     5-23  (61)
260 PF01927 Mut7-C:  Mut7-C RNAse   27.6      38 0.00082   26.4   1.6   17  251-267   124-140 (147)
261 PRK03681 hypA hydrogenase nick  27.6      26 0.00057   26.1   0.6   10  252-261    71-80  (114)
262 PF04810 zf-Sec23_Sec24:  Sec23  27.5      31 0.00067   20.1   0.8   15  316-330    19-33  (40)
263 PF08792 A2L_zn_ribbon:  A2L zi  27.5      34 0.00073   19.1   0.9    7  282-288     4-10  (33)
264 smart00731 SprT SprT homologue  27.5      29 0.00064   27.0   0.9   12  250-261   132-143 (146)
265 PF13824 zf-Mss51:  Zinc-finger  27.3      49  0.0011   21.0   1.7   12  320-331    13-24  (55)
266 PF10276 zf-CHCC:  Zinc-finger   27.3      27 0.00058   20.5   0.5   12  250-261    28-39  (40)
267 KOG0978|consensus               26.8      23  0.0005   35.1   0.2   16  250-265   677-692 (698)
268 KOG3214|consensus               26.8      16 0.00035   26.1  -0.6   10  296-305    50-59  (109)
269 KOG0717|consensus               26.8      35 0.00075   31.9   1.3   22  224-245   293-314 (508)
270 PTZ00303 phosphatidylinositol   26.4      24 0.00051   35.2   0.2   41  252-305   461-501 (1374)
271 PF08790 zf-LYAR:  LYAR-type C2  26.1      14 0.00029   19.8  -0.8    8  254-261     3-10  (28)
272 PF11672 DUF3268:  Protein of u  25.8      27 0.00059   25.3   0.4    7  252-258    32-38  (102)
273 COG4896 Uncharacterized protei  25.7      38 0.00083   21.8   1.0   36  225-260     4-40  (68)
274 PF04606 Ogr_Delta:  Ogr/Delta-  25.4      12 0.00026   22.8  -1.3   36  296-333     2-39  (47)
275 COG5188 PRP9 Splicing factor 3  25.1      45 0.00097   29.9   1.6   29  313-341   366-395 (470)
276 PF10013 DUF2256:  Uncharacteri  25.0      40 0.00086   20.0   0.9   11  295-305    10-20  (42)
277 COG2093 DNA-directed RNA polym  25.0      40 0.00086   21.9   1.0   19  284-302     7-27  (64)
278 KOG2071|consensus               24.8      47   0.001   32.1   1.8   28  248-275   415-442 (579)
279 cd00924 Cyt_c_Oxidase_Vb Cytoc  24.7      35 0.00077   24.5   0.8   12  222-233    78-89  (97)
280 KOG1512|consensus               24.5      28 0.00061   30.1   0.3   16  280-301   307-322 (381)
281 PF14205 Cys_rich_KTR:  Cystein  24.5      43 0.00093   21.1   1.0    8  252-259     5-12  (55)
282 PLN02294 cytochrome c oxidase   24.2      37  0.0008   27.1   0.9   13  250-262   140-152 (174)
283 PF06220 zf-U1:  U1 zinc finger  23.9      63  0.0014   18.6   1.6   10  322-331     4-13  (38)
284 PHA02942 putative transposase;  23.7      37 0.00081   31.3   1.0   32  290-332   322-353 (383)
285 PF14787 zf-CCHC_5:  GAG-polypr  23.5      36 0.00079   19.4   0.5   15  253-267     4-18  (36)
286 PRK14892 putative transcriptio  23.4      34 0.00074   24.7   0.5    8  251-258    21-28  (99)
287 PRK04351 hypothetical protein;  23.3      38 0.00083   26.6   0.8   13  249-261   130-142 (149)
288 PF04423 Rad50_zn_hook:  Rad50   23.2      68  0.0015   20.0   1.8   16  248-264    18-33  (54)
289 PF05766 NinG:  Bacteriophage L  23.1      46 0.00099   27.3   1.3   26  279-304     4-35  (189)
290 KOG0782|consensus               23.1      31 0.00067   33.0   0.3   27  238-264   240-266 (1004)
291 COG2331 Uncharacterized protei  23.1      13 0.00027   25.1  -1.6   12  251-262    12-23  (82)
292 COG1645 Uncharacterized Zn-fin  23.0      42  0.0009   25.6   0.9    8  296-303    47-54  (131)
293 PF11023 DUF2614:  Protein of u  22.9      42 0.00091   24.7   0.9   12  250-261    68-79  (114)
294 COG3677 Transposase and inacti  22.8      37  0.0008   25.9   0.6   16  319-334    51-66  (129)
295 COG3809 Uncharacterized protei  22.8      50  0.0011   22.5   1.2   34  283-316     3-44  (88)
296 PRK07218 replication factor A;  22.7      47   0.001   31.0   1.4   21  282-302   298-318 (423)
297 COG4391 Uncharacterized protei  22.2      32 0.00068   22.2   0.1   19  242-260    15-33  (62)
298 PF03107 C1_2:  C1 domain;  Int  22.2      65  0.0014   17.3   1.4    8  321-328    15-22  (30)
299 cd01121 Sms Sms (bacterial rad  22.0      57  0.0012   30.0   1.8   20  282-301     1-22  (372)
300 PRK06393 rpoE DNA-directed RNA  21.7      56  0.0012   21.5   1.2   19  284-302     8-26  (64)
301 COG1779 C4-type Zn-finger prot  21.5      31 0.00067   28.2   0.0    7  253-259    16-22  (201)
302 COG4306 Uncharacterized protei  21.3      18 0.00039   27.0  -1.3   13  321-333    68-80  (160)
303 PF06397 Desulfoferrod_N:  Desu  21.3      36 0.00078   19.5   0.2   10  320-329     5-14  (36)
304 COG1998 RPS31 Ribosomal protei  21.2      53  0.0012   20.2   1.0   10  321-330    37-46  (51)
305 cd02341 ZZ_ZZZ3 Zinc finger, Z  21.1      25 0.00055   21.5  -0.4    9  280-288    14-22  (48)
306 KOG0402|consensus               20.9      32 0.00069   23.7  -0.0   10  281-290    36-45  (92)
307 PRK12722 transcriptional activ  20.7      56  0.0012   26.7   1.3   49  258-329   114-162 (187)
308 TIGR03829 YokU_near_AblA uncha  20.7      78  0.0017   22.4   1.8   15  296-310    38-52  (89)
309 PRK00762 hypA hydrogenase nick  20.7      43 0.00093   25.3   0.6   11  252-263    71-81  (124)
310 PF14369 zf-RING_3:  zinc-finge  20.4      56  0.0012   18.5   0.9    7  324-330    24-30  (35)
311 PF11238 DUF3039:  Protein of u  20.3      34 0.00074   21.8   0.0    8  296-303    47-54  (58)
312 PLN02748 tRNA dimethylallyltra  20.0      61  0.0013   30.8   1.6   24  320-343   417-441 (468)

No 1  
>KOG1074|consensus
Probab=100.00  E-value=6.4e-36  Score=276.10  Aligned_cols=149  Identities=35%  Similarity=0.735  Sum_probs=133.1

Q ss_pred             eecCccCCccCCHHHHHHHHHHcCCCCCcccCCCccccCChHHHHHHHHHhCCC----Cceecc---ccCcccCChhHHH
Q psy14386        196 YECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGV----KPYSCE---ICGRGFITKGLCK  268 (344)
Q Consensus       196 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~----k~~~C~---~C~k~f~~~~~L~  268 (344)
                      -+|-+|.+...-++.|+.|.|+|+|++||+|.+||+.|.++.+|+.||-+|...    -+|.|+   +|.+.|.+.-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            789999999999999999999999999999999999999999999999998644    458999   9999999999999


Q ss_pred             HHHhhhcCCCC-----------CCcCCCCCCCccCCCC------------------------------------------
Q psy14386        269 SHQKIHSGNDN-----------RQYPCPVCKKLFVSKS------------------------------------------  295 (344)
Q Consensus       269 ~H~~~h~~~~~-----------~~~~C~~C~~~f~~~~------------------------------------------  295 (344)
                      .|+++|.+...           .--+|..|.+.|..-.                                          
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            99999984211           1125777777763210                                          


Q ss_pred             --------------------------------------------------------------------------------
Q psy14386        296 --------------------------------------------------------------------------------  295 (344)
Q Consensus       296 --------------------------------------------------------------------------------  295 (344)
                                                                                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             ------------------------------------CcccccccCChhhHHHHHHHccCCCcccccccchhccChHHHHH
Q psy14386        296 ------------------------------------CNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMV  339 (344)
Q Consensus       296 ------------------------------------C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~~  339 (344)
                                                          |..||+.|...++|..|+|+|+|+|||.|.+|+++|.++.+|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                                99999999999999999999999999999999999999999999


Q ss_pred             HhhhC
Q psy14386        340 HKKKH  344 (344)
Q Consensus       340 H~~~H  344 (344)
                      ||.+|
T Consensus       926 HMgtH  930 (958)
T KOG1074|consen  926 HMGTH  930 (958)
T ss_pred             hhccc
Confidence            99988


No 2  
>KOG2462|consensus
Probab=100.00  E-value=8.6e-33  Score=226.94  Aligned_cols=136  Identities=32%  Similarity=0.613  Sum_probs=128.6

Q ss_pred             CCCcccccccccccCCHHHHHHHHHhcCC---CCccccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHH
Q psy14386        136 SKSLHKCDRCPKKFSSLAKYNFHVSNHGV---DKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLI  212 (344)
Q Consensus       136 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  212 (344)
                      ....|+|+.||+.|.+..+|.+|...|-.   .+.+.|+.|+|.|.+...|..|+++|+  -+++|.+|||.|.+.+.|+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhh
Confidence            44569999999999999999999999854   567999999999999999999999997  5799999999999999999


Q ss_pred             HHHHHcCCCCCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhh
Q psy14386        213 VHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKI  273 (344)
Q Consensus       213 ~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~  273 (344)
                      -|+|+|+|||||.|..|+|.|..+++|+.||+||.+.|+|+|+.|+|.|..++.|.+|...
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999999999999999999999999999999999999999764


No 3  
>KOG2462|consensus
Probab=99.97  E-value=1.3e-32  Score=225.94  Aligned_cols=110  Identities=29%  Similarity=0.671  Sum_probs=76.9

Q ss_pred             CccccccccccccChHHHHHHHHHhcC---CCceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCccccCChHHHHHH
Q psy14386        166 KPFQCFKCEKRFRSKLGLDEHEAKHTG---RYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDH  242 (344)
Q Consensus       166 ~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H  242 (344)
                      ..|+|+.||+.|.+.++|.+|...|..   .+.+.|++|+|.|.+...|+.|+|+|+  -+++|.+|||.|..++-|+.|
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc
Confidence            347777788888887888887777743   345667777777777777777777775  466777777777777777777


Q ss_pred             HHHhCCCCceeccccCcccCChhHHHHHHhhhcCC
Q psy14386        243 ENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGN  277 (344)
Q Consensus       243 ~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~  277 (344)
                      +|+|||||||.|+.|+|+|..+++|+.|+++|.+.
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~  241 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDV  241 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCC
Confidence            77777777777777777777666666666666554


No 4  
>KOG3608|consensus
Probab=99.94  E-value=7.9e-27  Score=196.57  Aligned_cols=188  Identities=26%  Similarity=0.515  Sum_probs=167.6

Q ss_pred             cccccccccCCHHHHHHHHHhcCCCCccccccccccccChHHHHHHHHHhc--CCCceecCccCCccCCHHHHHHHHHHc
Q psy14386        141 KCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHT--GRYEYECNACGKGFQNKSYLIVHQRVH  218 (344)
Q Consensus       141 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h  218 (344)
                      .+..|-+.+.+++.|+.|++.|.++|...|+.||.-|.++..|..|++..+  ...+|+|..|.|.|.+...|..|++.|
T Consensus       181 ~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  181 NWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             cchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh
Confidence            345699999999999999999999999999999999999999999987643  456899999999999999999999999


Q ss_pred             CCCCCcccCCCccccCChHHHHHHHHH-hCCCCceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCc
Q psy14386        219 STDKPYACKTCPRSFKTKQTLLDHENR-HMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCN  297 (344)
Q Consensus       219 ~~~~~~~C~~C~~~f~~~~~L~~H~~~-h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~  297 (344)
                      ..  -|+|+.|+.+...+++|.+|++. |...|||+|+.|.+.|.+.+.|.+|..+|..   -.|.|+.          +
T Consensus       261 vn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~---~~y~C~h----------~  325 (467)
T KOG3608|consen  261 VN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSK---TVYQCEH----------P  325 (467)
T ss_pred             hh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccc---cceecCC----------C
Confidence            64  69999999999999999999995 8889999999999999999999999999973   5677654          2


Q ss_pred             ccccccCChhhHHHHHH-HccCCC--cccccccchhccChHHHHHHhhh
Q psy14386        298 ICGQSFTQFSPMAIHKR-LHTGER--PYSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       298 ~C~k~f~~~~~L~~H~~-~H~~~k--~~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      .|..+|.+...+++|++ +|.|..  +|.|..|++.|++..+|..|++.
T Consensus       326 ~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~k  374 (467)
T KOG3608|consen  326 DCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMK  374 (467)
T ss_pred             CCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHH
Confidence            37778888899999976 454654  59999999999999999999864


No 5  
>KOG3608|consensus
Probab=99.90  E-value=8.8e-24  Score=178.28  Aligned_cols=189  Identities=25%  Similarity=0.562  Sum_probs=166.5

Q ss_pred             ccc--cccccccCCHHHHHHHHHhcCC------------CCc-ccccc--ccccccChHHHHHHHHHhcCCCceecCccC
Q psy14386        140 HKC--DRCPKKFSSLAKYNFHVSNHGV------------DKP-FQCFK--CEKRFRSKLGLDEHEAKHTGRYEYECNACG  202 (344)
Q Consensus       140 ~~C--~~C~~~f~~~~~l~~H~~~h~~------------~~~-~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  202 (344)
                      |.|  ..|+..|.+...|..|...|..            ++| +.|.+  |-+.|.+++.|.+|++.|+++|...|+.||
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg  214 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCG  214 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHH
Confidence            555  6799999999999999877632            223 56766  999999999999999999999999999999


Q ss_pred             CccCCHHHHHHHHHHc--CCCCCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhhcCCCCC
Q psy14386        203 KGFQNKSYLIVHQRVH--STDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNR  280 (344)
Q Consensus       203 ~~f~~~~~l~~H~~~h--~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~  280 (344)
                      ..|.++..|..|.+..  ....+|.|..|.|.|.+...|+.|+..|.  .-|+|+.|..+....+.|..|++.-+.+ .+
T Consensus       215 ~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~-dk  291 (467)
T KOG3608|consen  215 ELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSK-DK  291 (467)
T ss_pred             HHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhcc-CC
Confidence            9999999999998754  34679999999999999999999999995  5699999999999999999999987776 58


Q ss_pred             CcCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCcccccc--cchhccChHHHHHHhhhC
Q psy14386        281 QYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCEL--CNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       281 ~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~--C~~~f~~~~~L~~H~~~H  344 (344)
                      ||+|+.            |.+.|.+.+.|.+|..+|. +-.|+|+.  |..+|.+...|++|++.|
T Consensus       292 pfKCd~------------Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~ev  344 (467)
T KOG3608|consen  292 PFKCDE------------CDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEV  344 (467)
T ss_pred             Cccccc------------hhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHh
Confidence            988655            5567778899999999998 77899998  999999999999999854


No 6  
>KOG3623|consensus
Probab=99.90  E-value=1.5e-24  Score=197.98  Aligned_cols=77  Identities=35%  Similarity=0.795  Sum_probs=71.0

Q ss_pred             eeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCcccccccchhc
Q psy14386        252 YSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAF  331 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f  331 (344)
                      |.|+.|+|+|.-.+.|.+|.--|+|.  |||+|            .+|.|.|..+-.|..|+|.|.|+|||+|+.|+|.|
T Consensus       895 yaCDqCDK~FqKqSSLaRHKYEHsGq--RPyqC------------~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRF  960 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKYEHSGQ--RPYQC------------IICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRF  960 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhhhhcCC--CCccc------------chhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhc
Confidence            99999999999999999999999998  99985            56667788889999999999999999999999999


Q ss_pred             cChHHHHHHhh
Q psy14386        332 VSRSTLMVHKK  342 (344)
Q Consensus       332 ~~~~~L~~H~~  342 (344)
                      +.......||.
T Consensus       961 SHSGSYSQHMN  971 (1007)
T KOG3623|consen  961 SHSGSYSQHMN  971 (1007)
T ss_pred             ccccchHhhhc
Confidence            99999998873


No 7  
>KOG1074|consensus
Probab=99.89  E-value=7.3e-25  Score=203.32  Aligned_cols=111  Identities=32%  Similarity=0.653  Sum_probs=94.9

Q ss_pred             CcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCc---cc
Q psy14386        223 PYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCN---IC  299 (344)
Q Consensus       223 ~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~---~C  299 (344)
                      |-+|-+|-+..+-++.|+.|.++|+||+||+|.+||++|.++.+|+.|+-+|...  -+++        ...+|+   +|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~--p~~R--------~q~ScP~~~ic  674 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAK--PPAR--------VQFSCPSTFIC  674 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccC--cccc--------ccccCCchhhh
Confidence            5799999999999999999999999999999999999999999999999999754  2222        224588   99


Q ss_pred             ccccCChhhHHHHHHHccC-CCc------------ccccccchhccChHHHHHHhhh
Q psy14386        300 GQSFTQFSPMAIHKRLHTG-ERP------------YSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       300 ~k~f~~~~~L~~H~~~H~~-~k~------------~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      -+.|...-.|..|+++|.+ ..+            =+|..|.+.|.....+..|+--
T Consensus       675 ~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se  731 (958)
T KOG1074|consen  675 QKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISE  731 (958)
T ss_pred             cccccccccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhc
Confidence            9999999999999999984 222            3799999999888887777643


No 8  
>KOG3623|consensus
Probab=99.87  E-value=4.3e-23  Score=188.64  Aligned_cols=78  Identities=28%  Similarity=0.545  Sum_probs=70.8

Q ss_pred             cccccccccccCCHHHHHHHHHhcCCC-------------CccccccccccccChHHHHHHHHHhcCCCceecCccCCcc
Q psy14386        139 LHKCDRCPKKFSSLAKYNFHVSNHGVD-------------KPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGF  205 (344)
Q Consensus       139 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  205 (344)
                      .|.|..|...|..+..|.+||..|...             +.|+|..|||.|..+..|+.|+|+|.|+|||.|+.|+|.|
T Consensus       240 nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRF  319 (1007)
T KOG3623|consen  240 NFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRF  319 (1007)
T ss_pred             CCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCccccccc
Confidence            367999999999999999999888532             4599999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHH
Q psy14386        206 QNKSYLIVHQR  216 (344)
Q Consensus       206 ~~~~~l~~H~~  216 (344)
                      ....+...||.
T Consensus       320 SHSGSySSHmS  330 (1007)
T KOG3623|consen  320 SHSGSYSSHMS  330 (1007)
T ss_pred             ccCCccccccc
Confidence            99998888863


No 9  
>KOG3576|consensus
Probab=99.78  E-value=1.1e-19  Score=142.33  Aligned_cols=111  Identities=31%  Similarity=0.552  Sum_probs=67.4

Q ss_pred             ccccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCccccCChHHHHHHHHHh
Q psy14386        167 PFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRH  246 (344)
Q Consensus       167 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  246 (344)
                      .|.|.+|+|.|.-...|.+|++-|...+.|-|..||+.|.+...|++|+|+|+|.+||+|..|+++|.++-.|..|.+.-
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kv  196 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKV  196 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHH
Confidence            35555555555555555555555555555555555555555555555555555555555555555555555555555433


Q ss_pred             C-----------CCCceeccccCcccCChhHHHHHHhhhcCC
Q psy14386        247 M-----------GVKPYSCEICGRGFITKGLCKSHQKIHSGN  277 (344)
Q Consensus       247 ~-----------~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~  277 (344)
                      +           ..|.|.|..||.+-.....+..|++.|+..
T Consensus       197 hgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  197 HGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             cCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            3           346688888888887777888888877653


No 10 
>KOG3576|consensus
Probab=99.77  E-value=6.1e-19  Score=138.16  Aligned_cols=116  Identities=28%  Similarity=0.489  Sum_probs=107.2

Q ss_pred             CCCcccccccccccCCHHHHHHHHHhcCCCCccccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHH
Q psy14386        136 SKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQ  215 (344)
Q Consensus       136 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  215 (344)
                      ....|.|.+|++.|.-...|++|++-|..-+.|.|..||+.|.....|++|+++|+|.+||+|..|++.|..+-+|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            35679999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             HHcCC-----------CCCcccCCCccccCChHHHHHHHHHhCCCCc
Q psy14386        216 RVHST-----------DKPYACKTCPRSFKTKQTLLDHENRHMGVKP  251 (344)
Q Consensus       216 ~~h~~-----------~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~  251 (344)
                      +.-+|           ++.|.|..||.+-.....+..|++.|+..-|
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            75444           4679999999999999999999999986654


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.52  E-value=3.6e-14  Score=131.54  Aligned_cols=134  Identities=21%  Similarity=0.491  Sum_probs=83.8

Q ss_pred             ccccccccccCCHHHHHHHHHhcCCCCcccccc--ccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHH
Q psy14386        140 HKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFK--CEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRV  217 (344)
Q Consensus       140 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  217 (344)
                      ..|+.|.... ....|..|...... ....|+.  |+..|. +..+..         ++.|+.|++.|. ...|..|+++
T Consensus       408 V~C~NC~~~i-~l~~l~lHe~~C~r-~~V~Cp~~~Cg~v~~-r~el~~---------H~~C~~Cgk~f~-~s~LekH~~~  474 (567)
T PLN03086        408 VECRNCKHYI-PSRSIALHEAYCSR-HNVVCPHDGCGIVLR-VEEAKN---------HVHCEKCGQAFQ-QGEMEKHMKV  474 (567)
T ss_pred             EECCCCCCcc-chhHHHHHHhhCCC-cceeCCcccccceee-cccccc---------CccCCCCCCccc-hHHHHHHHHh
Confidence            4577777644 34556667655433 2345764  777763 222222         356777777774 5667777777


Q ss_pred             cCCCCCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccC----------ChhHHHHHHhhhcCCCCCCcCCCCC
Q psy14386        218 HSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFI----------TKGLCKSHQKIHSGNDNRQYPCPVC  287 (344)
Q Consensus       218 h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~----------~~~~L~~H~~~h~~~~~~~~~C~~C  287 (344)
                      |+  +++.|+ ||+.+ .+..|..|+.+|.+.+|+.|+.|++.|.          ..+.|..|..++ |.  +++.|..|
T Consensus       475 ~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~--rt~~C~~C  547 (567)
T PLN03086        475 FH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GS--RTAPCDSC  547 (567)
T ss_pred             cC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CC--cceEcccc
Confidence            64  677777 77644 5577777777777777777777777774          134677776664 33  66666666


Q ss_pred             CCccCC
Q psy14386        288 KKLFVS  293 (344)
Q Consensus       288 ~~~f~~  293 (344)
                      |+.++.
T Consensus       548 gk~Vrl  553 (567)
T PLN03086        548 GRSVML  553 (567)
T ss_pred             CCeeee
Confidence            555543


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.44  E-value=2.2e-13  Score=126.39  Aligned_cols=150  Identities=20%  Similarity=0.462  Sum_probs=109.1

Q ss_pred             cccccccccccChHHHHHHHHHhcCCCceecCc--cCCccCCHHHHHHHHHHcCCCCCcccCCCccccCChHHHHHHHHH
Q psy14386        168 FQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNA--CGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENR  245 (344)
Q Consensus       168 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  245 (344)
                      ..|+.|.+... ..+|..|..... .....|+.  |+..|. +..+.         +.+.|+.|++.|. ...|..|+++
T Consensus       408 V~C~NC~~~i~-l~~l~lHe~~C~-r~~V~Cp~~~Cg~v~~-r~el~---------~H~~C~~Cgk~f~-~s~LekH~~~  474 (567)
T PLN03086        408 VECRNCKHYIP-SRSIALHEAYCS-RHNVVCPHDGCGIVLR-VEEAK---------NHVHCEKCGQAFQ-QGEMEKHMKV  474 (567)
T ss_pred             EECCCCCCccc-hhHHHHHHhhCC-CcceeCCcccccceee-ccccc---------cCccCCCCCCccc-hHHHHHHHHh
Confidence            57999887654 455668875443 34467884  999883 23333         3468999999996 6789999999


Q ss_pred             hCCCCceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCccccccc-CChhhHHHHHHHccCCCcccc
Q psy14386        246 HMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSF-TQFSPMAIHKRLHTGERPYSC  324 (344)
Q Consensus       246 h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f-~~~~~L~~H~~~H~~~k~~~C  324 (344)
                      |+  +||.|+ ||+.+ .+..|..|+.+|.++  +++.|..|++.|.....   .-.| ...+.|..|..++ |.+++.|
T Consensus       475 ~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~--Kpi~C~fC~~~v~~g~~---~~d~~d~~s~Lt~HE~~C-G~rt~~C  544 (567)
T PLN03086        475 FH--EPLQCP-CGVVL-EKEQMVQHQASTCPL--RLITCRFCGDMVQAGGS---AMDVRDRLRGMSEHESIC-GSRTAPC  544 (567)
T ss_pred             cC--CCccCC-CCCCc-chhHHHhhhhccCCC--CceeCCCCCCccccCcc---ccchhhhhhhHHHHHHhc-CCcceEc
Confidence            86  899999 99755 678999999999987  88887776665521100   0000 0246899999986 9999999


Q ss_pred             cccchhccChHHHHHHh
Q psy14386        325 ELCNKAFVSRSTLMVHK  341 (344)
Q Consensus       325 ~~C~~~f~~~~~L~~H~  341 (344)
                      ..||+.|..+ .|..|+
T Consensus       545 ~~Cgk~Vrlr-dm~~H~  560 (567)
T PLN03086        545 DSCGRSVMLK-EMDIHQ  560 (567)
T ss_pred             cccCCeeeeh-hHHHHH
Confidence            9999888755 566665


No 13 
>PHA00733 hypothetical protein
Probab=99.30  E-value=2.1e-12  Score=98.17  Aligned_cols=82  Identities=17%  Similarity=0.252  Sum_probs=59.7

Q ss_pred             CCceecCccCCccCCHHHHHHH--H---HHcCCCCCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHH
Q psy14386        193 RYEYECNACGKGFQNKSYLIVH--Q---RVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLC  267 (344)
Q Consensus       193 ~~~~~C~~C~~~f~~~~~l~~H--~---~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L  267 (344)
                      .+++.|.+|++.|.....|..|  +   ..+.+.+||.|+.|++.|.+...|..|++.|  +.+|.|+.|+++|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3456666666666555554444  1   1234578888888888888888888888876  4578899999999998888


Q ss_pred             HHHHhhhcC
Q psy14386        268 KSHQKIHSG  276 (344)
Q Consensus       268 ~~H~~~h~~  276 (344)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            888887765


No 14 
>KOG3993|consensus
Probab=99.20  E-value=1.9e-12  Score=112.78  Aligned_cols=175  Identities=20%  Similarity=0.351  Sum_probs=104.5

Q ss_pred             cccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHHcCCCCCcc---cCCCccccCChHHHHHHHH
Q psy14386        168 FQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYA---CKTCPRSFKTKQTLLDHEN  244 (344)
Q Consensus       168 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~---C~~C~~~f~~~~~L~~H~~  244 (344)
                      |.|..|...|.....|.+|.-.....--|+|+.|+|.|.-..+|..|+|+|....--.   =+-=.+.-.++...+.-.+
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            6777777777777777777643333344777777777777777777777774321000   0000000000000000000


Q ss_pred             --HhCCCCceeccccCcccCChhHHHHHHhhhcCCCC-C--------------CcCCCCCCCccCCC-------------
Q psy14386        245 --RHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDN-R--------------QYPCPVCKKLFVSK-------------  294 (344)
Q Consensus       245 --~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~-~--------------~~~C~~C~~~f~~~-------------  294 (344)
                        .-..+..|.|.+|+|.|.+...|++|+.+|+.... +              .+-|..|...+...             
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~s  427 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGS  427 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeecc
Confidence              00223468888888888888888888887764211 0              01244444333221             


Q ss_pred             ----CCcccccccCChhhHHHHHHHccCCCcccccccchhccChHHHHHHhh
Q psy14386        295 ----SCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKK  342 (344)
Q Consensus       295 ----~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~~H~~  342 (344)
                          .|++||-.+.++..=-.|.+.-..+.-|.|.+|.-+|...-+|.+|..
T Consensus       428 ael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin  479 (500)
T KOG3993|consen  428 AELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHIN  479 (500)
T ss_pred             ccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhh
Confidence                188888888877766666666666778999999999999999999874


No 15 
>PHA00733 hypothetical protein
Probab=99.19  E-value=2.8e-11  Score=92.04  Aligned_cols=96  Identities=20%  Similarity=0.254  Sum_probs=73.3

Q ss_pred             HHHHHHHHHhcCCCCccccccccccccChHHHHHH--HH---HhcCCCceecCccCCccCCHHHHHHHHHHcCCCCCccc
Q psy14386        152 LAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEH--EA---KHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYAC  226 (344)
Q Consensus       152 ~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C  226 (344)
                      ...|..+-..-...+++.|.+|.+.|.....|..+  +.   .+.+.+||.|+.|++.|.+...|..|++.|  +.+|.|
T Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C  102 (128)
T PHA00733         25 LEELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVC  102 (128)
T ss_pred             HHHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccC
Confidence            44454444444446678888888888776665555  22   234578999999999999999999999976  457999


Q ss_pred             CCCccccCChHHHHHHHHHhCCC
Q psy14386        227 KTCPRSFKTKQTLLDHENRHMGV  249 (344)
Q Consensus       227 ~~C~~~f~~~~~L~~H~~~h~~~  249 (344)
                      ..|++.|.....|..|+...++.
T Consensus       103 ~~CgK~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        103 PVCGKEFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             CCCCCccCCHHHHHHHHHHhcCc
Confidence            99999999999999999887754


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.12  E-value=2.5e-11  Score=75.77  Aligned_cols=42  Identities=19%  Similarity=0.477  Sum_probs=29.0

Q ss_pred             cccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHH
Q psy14386        224 YACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLC  267 (344)
Q Consensus       224 ~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L  267 (344)
                      |.|+.||+.|+..++|..|+++|+  ++|+|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            667777777777777777777766  567777777777666554


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=99.10  E-value=3.1e-11  Score=75.34  Aligned_cols=42  Identities=21%  Similarity=0.495  Sum_probs=38.7

Q ss_pred             CCcccccccCChhhHHHHHHHccCCCcccccccchhccChHHHH
Q psy14386        295 SCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLM  338 (344)
Q Consensus       295 ~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~  338 (344)
                      .|+.||+.|...++|..|+++|+  ++|+|..|++.|.+.+.|.
T Consensus         7 ~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          7 ECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             CcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            48899999999999999999999  8999999999999888763


No 18 
>KOG3993|consensus
Probab=99.07  E-value=1.9e-11  Score=106.66  Aligned_cols=138  Identities=20%  Similarity=0.322  Sum_probs=104.9

Q ss_pred             CcccccccccccCCHHHHHHHHHhcCCCCccccccccccccChHHHHHHHHHhcCC------------------------
Q psy14386        138 SLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGR------------------------  193 (344)
Q Consensus       138 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~------------------------  193 (344)
                      +.|.|..|...|...-.|..|.-.......|+|+.|+|+|....+|..|.|+|...                        
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            45999999999999999999986655556699999999999999999999998521                        


Q ss_pred             ---------CceecCccCCccCCHHHHHHHHHHcCCC-------------------------------------------
Q psy14386        194 ---------YEYECNACGKGFQNKSYLIVHQRVHSTD-------------------------------------------  221 (344)
Q Consensus       194 ---------~~~~C~~C~~~f~~~~~l~~H~~~h~~~-------------------------------------------  221 (344)
                               .-|.|.+|+|.|.+...|+.|+.+|...                                           
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a  425 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVA  425 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeee
Confidence                     1288999999999999999998776431                                           


Q ss_pred             ---CCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhhc
Q psy14386        222 ---KPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       222 ---~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~  275 (344)
                         ....|+.|+-.+.++..-..|.+.-.-+.-|.|.+|.-+|.+..+|.+|+...|
T Consensus       426 ~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  426 GSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             ccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcC
Confidence               012455555555555444444443344556889999999999999999887654


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.99  E-value=2.2e-10  Score=61.27  Aligned_cols=26  Identities=46%  Similarity=0.998  Sum_probs=24.3

Q ss_pred             hHHHHHHHccCCCcccccccchhccC
Q psy14386        308 PMAIHKRLHTGERPYSCELCNKAFVS  333 (344)
Q Consensus       308 ~L~~H~~~H~~~k~~~C~~C~~~f~~  333 (344)
                      +|.+|+++|+|++||+|++|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58999999999999999999999974


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.91  E-value=9.2e-10  Score=58.82  Aligned_cols=26  Identities=42%  Similarity=0.924  Sum_probs=18.8

Q ss_pred             HHHHHHHHhCCCCceeccccCcccCC
Q psy14386        238 TLLDHENRHMGVKPYSCEICGRGFIT  263 (344)
Q Consensus       238 ~L~~H~~~h~~~k~~~C~~C~k~f~~  263 (344)
                      +|..|+++|+|++||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            46777777777777777777777753


No 21 
>PHA00616 hypothetical protein
Probab=98.60  E-value=2.1e-08  Score=59.58  Aligned_cols=34  Identities=21%  Similarity=0.397  Sum_probs=20.1

Q ss_pred             CcccCCCccccCChHHHHHHHHHhCCCCceeccc
Q psy14386        223 PYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEI  256 (344)
Q Consensus       223 ~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~  256 (344)
                      ||+|+.||+.|..+++|..|++.|+|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4556666666666666666666666666655543


No 22 
>PHA00732 hypothetical protein
Probab=98.50  E-value=8.2e-08  Score=66.15  Aligned_cols=46  Identities=22%  Similarity=0.437  Sum_probs=30.9

Q ss_pred             CcccCCCccccCChHHHHHHHHH-hCCCCceeccccCcccCChhHHHHHHhhh
Q psy14386        223 PYACKTCPRSFKTKQTLLDHENR-HMGVKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       223 ~~~C~~C~~~f~~~~~L~~H~~~-h~~~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      ||.|..|++.|.+..+|+.|++. |+   ++.|+.||+.|.   .|..|.+++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            46677777777777777777764 44   346777777776   366676554


No 23 
>PHA00616 hypothetical protein
Probab=98.48  E-value=6.3e-08  Score=57.53  Aligned_cols=33  Identities=21%  Similarity=0.248  Sum_probs=30.1

Q ss_pred             ceeccccCcccCChhHHHHHHhhhcCCCCCCcCCC
Q psy14386        251 PYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCP  285 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~  285 (344)
                      ||+|+.||+.|.+++.|.+|++.|+|+  .++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~--~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ--NKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC--Ccccee
Confidence            799999999999999999999999998  676654


No 24 
>PHA00732 hypothetical protein
Probab=98.35  E-value=3.4e-07  Score=63.11  Aligned_cols=47  Identities=26%  Similarity=0.474  Sum_probs=31.8

Q ss_pred             ceecCccCCccCCHHHHHHHHHH-cCCCCCcccCCCccccCChHHHHHHHHHhC
Q psy14386        195 EYECNACGKGFQNKSYLIVHQRV-HSTDKPYACKTCPRSFKTKQTLLDHENRHM  247 (344)
Q Consensus       195 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~  247 (344)
                      ||.|+.|++.|.+...|..|++. |.   ++.|+.|++.|.   .|..|++++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            46777777777777777777764 43   346777777776   3666775543


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.19  E-value=5.3e-07  Score=46.71  Aligned_cols=23  Identities=43%  Similarity=0.986  Sum_probs=17.7

Q ss_pred             ccccccchhccChHHHHHHhhhC
Q psy14386        322 YSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      |+|+.|++.|.+...|..|+++|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67778888888888888887765


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.14  E-value=4.2e-06  Score=53.53  Aligned_cols=25  Identities=20%  Similarity=0.593  Sum_probs=12.0

Q ss_pred             eeccccCcccCChhHHHHHHhhhcCC
Q psy14386        252 YSCEICGRGFITKGLCKSHQKIHSGN  277 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~h~~~  277 (344)
                      |.||+|++. .+...|..|....|..
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~   27 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRS   27 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcC
Confidence            455555552 3334555555544443


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.11  E-value=4.9e-06  Score=53.19  Aligned_cols=49  Identities=18%  Similarity=0.386  Sum_probs=22.8

Q ss_pred             cccCCCccccCChHHHHHHHHHh-CC-CCceeccccCcccCChhHHHHHHhhhc
Q psy14386        224 YACKTCPRSFKTKQTLLDHENRH-MG-VKPYSCEICGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       224 ~~C~~C~~~f~~~~~L~~H~~~h-~~-~k~~~C~~C~k~f~~~~~L~~H~~~h~  275 (344)
                      |.|++|++ ..+...|..|.... .. .+.+.||+|...+.  .+|..|+..++
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            45555555 23334455554432 22 23455555555433  25555555544


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.03  E-value=3.6e-06  Score=43.52  Aligned_cols=22  Identities=41%  Similarity=0.881  Sum_probs=13.1

Q ss_pred             eeccccCcccCChhHHHHHHhh
Q psy14386        252 YSCEICGRGFITKGLCKSHQKI  273 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~  273 (344)
                      |.|+.|++.|.++..|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666554


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.91  E-value=5.5e-06  Score=60.63  Aligned_cols=24  Identities=25%  Similarity=0.461  Sum_probs=0.0

Q ss_pred             eccccCcccCChhHHHHHHhhhcC
Q psy14386        253 SCEICGRGFITKGLCKSHQKIHSG  276 (344)
Q Consensus       253 ~C~~C~k~f~~~~~L~~H~~~h~~  276 (344)
                      +|..|+..|.+...|..|+...|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~   24 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHG   24 (100)
T ss_dssp             ------------------------
T ss_pred             Cccccccccccccccccccccccc
Confidence            366677777777777777655554


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.85  E-value=7.4e-06  Score=44.17  Aligned_cols=24  Identities=46%  Similarity=0.933  Sum_probs=21.0

Q ss_pred             cccccccchhccChHHHHHHhhhC
Q psy14386        321 PYSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       321 ~~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      ||+|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            588999999999999999998876


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.82  E-value=3.6e-06  Score=71.45  Aligned_cols=71  Identities=24%  Similarity=0.509  Sum_probs=46.3

Q ss_pred             CCCceeccc--cCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCccccc
Q psy14386        248 GVKPYSCEI--CGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCE  325 (344)
Q Consensus       248 ~~k~~~C~~--C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~  325 (344)
                      ++|||+|++  |.|++++...|+-|++--|.. .+..+-+.          ++            .|.-.-...|||.|+
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~-~~~~~~p~----------p~------------~~~~F~~~~KPYrCe  402 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQN-QKLHENPS----------PE------------KMNIFSAKDKPYRCE  402 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccC-cccCCCCC----------cc------------ccccccccCCceecc
Confidence            469999987  999999999999998754421 01000000          00            111112345899999


Q ss_pred             ccchhccChHHHHHHh
Q psy14386        326 LCNKAFVSRSTLMVHK  341 (344)
Q Consensus       326 ~C~~~f~~~~~L~~H~  341 (344)
                      +|+|.|....+|.-|+
T Consensus       403 vC~KRYKNlNGLKYHr  418 (423)
T COG5189         403 VCDKRYKNLNGLKYHR  418 (423)
T ss_pred             ccchhhccCccceecc
Confidence            9999999999998885


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.80  E-value=5.9e-06  Score=70.17  Aligned_cols=52  Identities=35%  Similarity=0.720  Sum_probs=38.4

Q ss_pred             CCCcccCC--CccccCChHHHHHHHHH-h------------------CCCCceeccccCcccCChhHHHHHHh
Q psy14386        221 DKPYACKT--CPRSFKTKQTLLDHENR-H------------------MGVKPYSCEICGRGFITKGLCKSHQK  272 (344)
Q Consensus       221 ~~~~~C~~--C~~~f~~~~~L~~H~~~-h------------------~~~k~~~C~~C~k~f~~~~~L~~H~~  272 (344)
                      +|||+|++  |.|.|+....|+-|+.- |                  ...|||.|++|+|.+++...|+-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            46777765  77777777777777652 1                  23589999999999999999988864


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.74  E-value=1.2e-05  Score=41.93  Aligned_cols=23  Identities=39%  Similarity=0.891  Sum_probs=15.4

Q ss_pred             ccccccchhccChHHHHHHhhhC
Q psy14386        322 YSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777777777777777777654


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.73  E-value=2.7e-05  Score=40.50  Aligned_cols=23  Identities=35%  Similarity=0.911  Sum_probs=12.2

Q ss_pred             eeccccCcccCChhHHHHHHhhh
Q psy14386        252 YSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45555666666666666665554


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.63  E-value=3.5e-05  Score=41.48  Aligned_cols=25  Identities=28%  Similarity=0.850  Sum_probs=17.8

Q ss_pred             ceeccccCcccCChhHHHHHHhhhc
Q psy14386        251 PYSCEICGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L~~H~~~h~  275 (344)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5677777777777777777776664


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.62  E-value=3.7e-05  Score=56.18  Aligned_cols=24  Identities=17%  Similarity=0.592  Sum_probs=15.3

Q ss_pred             ceeccccCcccCChhHHHHHHhhh
Q psy14386        251 PYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      .+.|..|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            566666766666666666666654


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.41  E-value=9.2e-05  Score=39.15  Aligned_cols=23  Identities=43%  Similarity=0.842  Sum_probs=16.4

Q ss_pred             ccccccchhccChHHHHHHhhhC
Q psy14386        322 YSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      |.|..|+++|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            56777777777777777777654


No 38 
>KOG2231|consensus
Probab=97.41  E-value=0.00034  Score=66.81  Aligned_cols=137  Identities=20%  Similarity=0.396  Sum_probs=74.8

Q ss_pred             ccccccccccChHHHHHHHHHhcCCCceecCccCC---------ccCCHHHHHHHHHHcC-CCC----CcccCCCccccC
Q psy14386        169 QCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGK---------GFQNKSYLIVHQRVHS-TDK----PYACKTCPRSFK  234 (344)
Q Consensus       169 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~---------~f~~~~~l~~H~~~h~-~~~----~~~C~~C~~~f~  234 (344)
                      .|..| -.|.....|..|+..-+.  .+.|..|-.         .......|..|++.-- +++    --.|..|...|-
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fl  193 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFL  193 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhc
Confidence            46666 566677788888754332  245554432         2234566677765311 121    135777777777


Q ss_pred             ChHHHHHHHHHhCCCCceecccc------CcccCChhHHHHHHhhhcCCCCCCcCCC--CCCCccCCCCCcccccccCCh
Q psy14386        235 TKQTLLDHENRHMGVKPYSCEIC------GRGFITKGLCKSHQKIHSGNDNRQYPCP--VCKKLFVSKSCNICGQSFTQF  306 (344)
Q Consensus       235 ~~~~L~~H~~~h~~~k~~~C~~C------~k~f~~~~~L~~H~~~h~~~~~~~~~C~--~C~~~f~~~~C~~C~k~f~~~  306 (344)
                      ....|..|++.++    |.|..|      +.-|.....|..|.+.+|      |.|+  .|.       +..+-..|...
T Consensus       194 d~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H------flCE~~~C~-------~~~f~~~~~~e  256 (669)
T KOG2231|consen  194 DDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH------FLCEEEFCR-------TKKFYVAFELE  256 (669)
T ss_pred             cHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC------ccccccccc-------cceeeehhHHH
Confidence            7777777777654    445555      334556677777777654      4454  332       12222233444


Q ss_pred             hhHHHHHHHccCCCccccc
Q psy14386        307 SPMAIHKRLHTGERPYSCE  325 (344)
Q Consensus       307 ~~L~~H~~~H~~~k~~~C~  325 (344)
                      ..|+.|.+.+.-++.|.|.
T Consensus       257 i~lk~~~~~~~~e~~~~~~  275 (669)
T KOG2231|consen  257 IELKAHNRFIQHEKCYICR  275 (669)
T ss_pred             HHHHhhccccchheeccCC
Confidence            5555555444445555553


No 39 
>KOG2231|consensus
Probab=97.11  E-value=0.0013  Score=63.01  Aligned_cols=143  Identities=23%  Similarity=0.437  Sum_probs=98.0

Q ss_pred             cccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHH-HcCCCCCcccCCC----------ccccCCh
Q psy14386        168 FQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQR-VHSTDKPYACKTC----------PRSFKTK  236 (344)
Q Consensus       168 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C----------~~~f~~~  236 (344)
                      +.|..|+..|....            ..-.|..| -.|.....|++|++ .|.   .+.|.+|          .+.| ++
T Consensus       100 ~~C~~C~~~~~~~~------------~~~~~~~c-~~~~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif~~e~k~Y-t~  162 (669)
T KOG2231|consen  100 HSCHICDRRFRALY------------NKKECLHC-TEFKSVENLKNHMRDQHK---LHLCSLCLQNLKIFINERKLY-TR  162 (669)
T ss_pred             hhcCccccchhhhc------------ccCCCccc-cchhHHHHHHHHHHHhhh---hhccccccccceeeeeeeehe-hH
Confidence            78999998874322            11348888 78889999999996 453   3444443          3333 56


Q ss_pred             HHHHHHHHHhCC-CC----ceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHH
Q psy14386        237 QTLLDHENRHMG-VK----PYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAI  311 (344)
Q Consensus       237 ~~L~~H~~~h~~-~k----~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~  311 (344)
                      ..|..|++.--. ++    --.|..|...|.....|.+|++.++      |.|-.|.+.      +.++.-|.....|..
T Consensus       163 ~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h------~~chfC~~~------~~~neyy~~~~dLe~  230 (669)
T KOG2231|consen  163 AELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH------EFCHFCDYK------TGQNEYYNDYDDLEE  230 (669)
T ss_pred             HHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce------eheeecCcc------cccchhcccchHHHH
Confidence            678888874221 11    2579999999999999999998765      456666531      345677888899999


Q ss_pred             HHHHccCCCccccc--ccc-hhccChHHHHHHhhh
Q psy14386        312 HKRLHTGERPYSCE--LCN-KAFVSRSTLMVHKKK  343 (344)
Q Consensus       312 H~~~H~~~k~~~C~--~C~-~~f~~~~~L~~H~~~  343 (344)
                      |.+.++    |.|.  .|. +.|.....+..|++.
T Consensus       231 HfR~~H----flCE~~~C~~~~f~~~~~~ei~lk~  261 (669)
T KOG2231|consen  231 HFRKGH----FLCEEEFCRTKKFYVAFELEIELKA  261 (669)
T ss_pred             HhhhcC----ccccccccccceeeehhHHHHHHHh
Confidence            988764    7887  665 455555566666553


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.08  E-value=0.00057  Score=41.63  Aligned_cols=29  Identities=21%  Similarity=0.354  Sum_probs=10.6

Q ss_pred             CCcccCCCccccCChHHHHHHHHHhCCCC
Q psy14386        222 KPYACKTCPRSFKTKQTLLDHENRHMGVK  250 (344)
Q Consensus       222 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~k  250 (344)
                      .|-.|++|+..+.+..+|++|+.++++.|
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            34444444444444444444444444433


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.06  E-value=0.00021  Score=37.54  Aligned_cols=22  Identities=36%  Similarity=0.883  Sum_probs=17.9

Q ss_pred             ccccccchhccChHHHHHHhhh
Q psy14386        322 YSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5788888888888888888865


No 42 
>PRK04860 hypothetical protein; Provisional
Probab=96.99  E-value=0.00043  Score=54.75  Aligned_cols=38  Identities=34%  Similarity=0.765  Sum_probs=26.2

Q ss_pred             CcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCCh
Q psy14386        223 PYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITK  264 (344)
Q Consensus       223 ~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~  264 (344)
                      +|.|. |+.   ....+++|.++|+++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            57776 766   555567777777777777777777766543


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.96  E-value=0.00085  Score=35.26  Aligned_cols=19  Identities=37%  Similarity=0.775  Sum_probs=7.9

Q ss_pred             ccccCcccCChhHHHHHHh
Q psy14386        254 CEICGRGFITKGLCKSHQK  272 (344)
Q Consensus       254 C~~C~k~f~~~~~L~~H~~  272 (344)
                      |+.|++.|.+...|..|++
T Consensus         3 C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        3 CPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCcchhCCHHHHHHHHH
Confidence            4444444444444444443


No 44 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.90  E-value=0.00015  Score=67.92  Aligned_cols=153  Identities=24%  Similarity=0.357  Sum_probs=85.7

Q ss_pred             ccccccccccccChHHHHHHHH--HhcCC--CceecC--ccCCccCCHHHHHHHHHHcCCCCCcccCC--CccccCChHH
Q psy14386        167 PFQCFKCEKRFRSKLGLDEHEA--KHTGR--YEYECN--ACGKGFQNKSYLIVHQRVHSTDKPYACKT--CPRSFKTKQT  238 (344)
Q Consensus       167 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~  238 (344)
                      ++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.....+..|...|++..++.+..  |...+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLN  368 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccC
Confidence            4556666666666666666666  56666  666666  56666666666666666666665555543  3333322222


Q ss_pred             H-----HHHHHHhCCCCceeccc--cCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHH
Q psy14386        239 L-----LDHENRHMGVKPYSCEI--CGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAI  311 (344)
Q Consensus       239 L-----~~H~~~h~~~k~~~C~~--C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~  311 (344)
                      -     ..........+.+.+..  |-..+.....+..|...|...  +++.          ..+..|.+.|.....+..
T Consensus       369 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~----------~~~~~~~~~~~~~~~~~~  436 (467)
T COG5048         369 NEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSF--RPYN----------CKNPPCSKSFNRHYNLIP  436 (467)
T ss_pred             CCCccchhhccCccCCccccccccchhhhhcccccccccccccccc--CCcC----------CCCCcchhhccCcccccc
Confidence            0     00111112233344432  555555555555555555443  2111          126677778888888888


Q ss_pred             HHHHccCCCcccccccchhc
Q psy14386        312 HKRLHTGERPYSCELCNKAF  331 (344)
Q Consensus       312 H~~~H~~~k~~~C~~C~~~f  331 (344)
                      |++.|....++.|..++..+
T Consensus       437 ~~~~~~~~~~~~~~~~~~~~  456 (467)
T COG5048         437 HKKIHTNHAPLLCSILKSFR  456 (467)
T ss_pred             cccccccCCceeeccccccc
Confidence            88888888887777765433


No 45 
>KOG2785|consensus
Probab=96.84  E-value=0.0027  Score=56.00  Aligned_cols=47  Identities=21%  Similarity=0.429  Sum_probs=42.4

Q ss_pred             CcccccccCChhhHHHHHHHccCCC-----------------------cccccccc---hhccChHHHHHHhh
Q psy14386        296 CNICGQSFTQFSPMAIHKRLHTGER-----------------------PYSCELCN---KAFVSRSTLMVHKK  342 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~H~~~k-----------------------~~~C~~C~---~~f~~~~~L~~H~~  342 (344)
                      |..|++.|.+......||..|+|-.                       -|.|-.|+   +.|.+....+.||+
T Consensus       169 CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  169 CLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             eeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            9999999999999999999988732                       37899999   99999999999996


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.78  E-value=0.0012  Score=34.29  Aligned_cols=23  Identities=35%  Similarity=0.527  Sum_probs=12.2

Q ss_pred             eeccccCcccCChhHHHHHHhhhc
Q psy14386        252 YSCEICGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~h~  275 (344)
                      |+|+.|+.... ...|.+|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666665555 556666665554


No 47 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.69  E-value=0.00035  Score=65.44  Aligned_cols=141  Identities=24%  Similarity=0.387  Sum_probs=89.7

Q ss_pred             CceecCccCCccCCHHHHHHHHH--HcCCC--CCcccC--CCccccCChHHHHHHHHHhCCCCceeccc--cCcccCChh
Q psy14386        194 YEYECNACGKGFQNKSYLIVHQR--VHSTD--KPYACK--TCPRSFKTKQTLLDHENRHMGVKPYSCEI--CGRGFITKG  265 (344)
Q Consensus       194 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~L~~H~~~h~~~k~~~C~~--C~k~f~~~~  265 (344)
                      .++.|..|...|.....|.+|.+  .|.++  +++.|+  .|++.|.+...+..|..+|++..++.+..  |.+.+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            35667777777777777777777  67777  777777  57777777777777777777777666654  333333332


Q ss_pred             HHHHHHhhhcC---CCCCCcCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCC--cccccccchhccChHHHHHH
Q psy14386        266 LCKSHQKIHSG---NDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGER--PYSCELCNKAFVSRSTLMVH  340 (344)
Q Consensus       266 ~L~~H~~~h~~---~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k--~~~C~~C~~~f~~~~~L~~H  340 (344)
                      .-..+......   .....+.+.          =..|-..+.....+..|...|...+  .+.+..|.+.|.....|..|
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  437 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETL----------SNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPH  437 (467)
T ss_pred             CCCCccchhhccCccCCcccccc----------ccchhhhhccccccccccccccccCCcCCCCCcchhhccCccccccc
Confidence            21111111100   000111111          1236667777888888888888877  47788899999999999999


Q ss_pred             hhhC
Q psy14386        341 KKKH  344 (344)
Q Consensus       341 ~~~H  344 (344)
                      ++.|
T Consensus       438 ~~~~  441 (467)
T COG5048         438 KKIH  441 (467)
T ss_pred             cccc
Confidence            8765


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=96.64  E-value=0.0012  Score=52.15  Aligned_cols=39  Identities=26%  Similarity=0.677  Sum_probs=33.3

Q ss_pred             CceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCccccCCh
Q psy14386        194 YEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTK  236 (344)
Q Consensus       194 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  236 (344)
                      .+|.|. |+.   ....+.+|.++|+++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            469998 987   667789999999999999999999988654


No 49 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.56  E-value=0.0028  Score=38.69  Aligned_cols=29  Identities=21%  Similarity=0.298  Sum_probs=12.6

Q ss_pred             CccccccccccccChHHHHHHHHHhcCCC
Q psy14386        166 KPFQCFKCEKRFRSKLGLDEHEAKHTGRY  194 (344)
Q Consensus       166 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  194 (344)
                      .|-.|+.|+..+....+|.+|+..+++.+
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            34455555555555555555555544443


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.52  E-value=0.0011  Score=35.55  Aligned_cols=22  Identities=36%  Similarity=0.748  Sum_probs=18.7

Q ss_pred             ccccccchhccChHHHHHHhhh
Q psy14386        322 YSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      |-|.+|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888875


No 51 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.48  E-value=0.002  Score=33.41  Aligned_cols=23  Identities=39%  Similarity=0.683  Sum_probs=11.7

Q ss_pred             cccCCCccccCChHHHHHHHHHhC
Q psy14386        224 YACKTCPRSFKTKQTLLDHENRHM  247 (344)
Q Consensus       224 ~~C~~C~~~f~~~~~L~~H~~~h~  247 (344)
                      |+|+.|+.... ...|..|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45556665555 555666655543


No 52 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.36  E-value=0.0027  Score=33.20  Aligned_cols=23  Identities=22%  Similarity=0.723  Sum_probs=14.6

Q ss_pred             eeccccCcccCChhHHHHHHhhh
Q psy14386        252 YSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      |.|..|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            45666666666666666666543


No 53 
>KOG1146|consensus
Probab=96.33  E-value=0.0011  Score=67.09  Aligned_cols=139  Identities=22%  Similarity=0.209  Sum_probs=94.7

Q ss_pred             ccCCHHHHHHHHH-HcCCCCCcccCCCccccCChHHHHHHHHHhC-------------------------CCCceecccc
Q psy14386        204 GFQNKSYLIVHQR-VHSTDKPYACKTCPRSFKTKQTLLDHENRHM-------------------------GVKPYSCEIC  257 (344)
Q Consensus       204 ~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~-------------------------~~k~~~C~~C  257 (344)
                      .+.+...+..|+. .|.-.+.|+|+.|+..|+....|..|||.-+                         +.+||.|..|
T Consensus       445 ~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C  524 (1406)
T KOG1146|consen  445 LLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRAC  524 (1406)
T ss_pred             hhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceee
Confidence            3444444444443 3555688999999999999999999999722                         3478999999


Q ss_pred             CcccCChhHHHHHHhhh--cCC----------CC--CCc-CCCCC--------------CCccCCCCCcccccccCChhh
Q psy14386        258 GRGFITKGLCKSHQKIH--SGN----------DN--RQY-PCPVC--------------KKLFVSKSCNICGQSFTQFSP  308 (344)
Q Consensus       258 ~k~f~~~~~L~~H~~~h--~~~----------~~--~~~-~C~~C--------------~~~f~~~~C~~C~k~f~~~~~  308 (344)
                      ..++....+|.+|+..-  -.+          ..  .+. .|..+              .+....+.|..|+..-.-..+
T Consensus       525 ~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarn  604 (1406)
T KOG1146|consen  525 NYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARN  604 (1406)
T ss_pred             eeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhc
Confidence            99999999999998642  110          00  000 02111              233344569999988888889


Q ss_pred             HHHHHH-HccCCCcccccccchhccChHHHHHHhh
Q psy14386        309 MAIHKR-LHTGERPYSCELCNKAFVSRSTLMVHKK  342 (344)
Q Consensus       309 L~~H~~-~H~~~k~~~C~~C~~~f~~~~~L~~H~~  342 (344)
                      |+-|+. .++...|--|..|+-.+.....|..|.+
T Consensus       605 lrihmtss~~s~~p~~~Lq~~it~~l~~~~~~~~~  639 (1406)
T KOG1146|consen  605 LRIHMTASPSSSPPSLVLQQNITSSLASLLGGQGR  639 (1406)
T ss_pred             cccccccCCCCCChHHHhhhcchhhccccccCcCC
Confidence            999975 3555555778888877777777666544


No 54 
>KOG1146|consensus
Probab=96.10  E-value=0.0023  Score=64.91  Aligned_cols=134  Identities=16%  Similarity=0.232  Sum_probs=86.1

Q ss_pred             cccccccccCCHHHHHHHHHh-cCCCCccccccccccccChHHHHHHHHHhc-------------------------CCC
Q psy14386        141 KCDRCPKKFSSLAKYNFHVSN-HGVDKPFQCFKCEKRFRSKLGLDEHEAKHT-------------------------GRY  194 (344)
Q Consensus       141 ~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-------------------------~~~  194 (344)
                      .|..|+..+.+...+..|+.. +...+.|.|+.|+..|.....|..|||..+                         +.+
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~  517 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGK  517 (1406)
T ss_pred             cccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCC
Confidence            344555555555555555432 444466777777777777777777777621                         235


Q ss_pred             ceecCccCCccCCHHHHHHHHHH--cCC-----------------------------------------CCCcccCCCcc
Q psy14386        195 EYECNACGKGFQNKSYLIVHQRV--HST-----------------------------------------DKPYACKTCPR  231 (344)
Q Consensus       195 ~~~C~~C~~~f~~~~~l~~H~~~--h~~-----------------------------------------~~~~~C~~C~~  231 (344)
                      +|.|..|...+..+.+|.+|+..  |..                                         .-.|.|.+|++
T Consensus       518 p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~y  597 (1406)
T KOG1146|consen  518 PYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSY  597 (1406)
T ss_pred             cccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcc
Confidence            67788888888887888777642  110                                         12378888888


Q ss_pred             ccCChHHHHHHHHH-hCCCCceeccccCcccCChhHHHHHHhhh
Q psy14386        232 SFKTKQTLLDHENR-HMGVKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       232 ~f~~~~~L~~H~~~-h~~~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      -.+-..+|+.||.. ++...|..|-.|+-.+.....+..+.+.+
T Consensus       598 etniarnlrihmtss~~s~~p~~~Lq~~it~~l~~~~~~~~~lp  641 (1406)
T KOG1146|consen  598 ETNIARNLRIHMTASPSSSPPSLVLQQNITSSLASLLGGQGRLP  641 (1406)
T ss_pred             hhhhhhccccccccCCCCCChHHHhhhcchhhccccccCcCCCC
Confidence            88878888888774 33344477777777777766666666655


No 55 
>KOG2482|consensus
Probab=95.66  E-value=0.044  Score=47.75  Aligned_cols=51  Identities=18%  Similarity=0.252  Sum_probs=41.1

Q ss_pred             cccCCCccccCChHHHHHHHHHhCC---------------------------CCceeccccCcccCChhHHHHHHhhh
Q psy14386        224 YACKTCPRSFKTKQTLLDHENRHMG---------------------------VKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       224 ~~C~~C~~~f~~~~~L~~H~~~h~~---------------------------~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      ..|-.|...+.+...|..||++-+.                           .+.-.|-.|.-.|.....|..|+.-+
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            5899999999999999999986441                           12356788899999999999998764


No 56 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.41  E-value=0.005  Score=32.88  Aligned_cols=22  Identities=27%  Similarity=0.635  Sum_probs=14.5

Q ss_pred             eeccccCcccCChhHHHHHHhh
Q psy14386        252 YSCEICGRGFITKGLCKSHQKI  273 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~  273 (344)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5566677777776666666654


No 57 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.20  E-value=0.014  Score=30.53  Aligned_cols=19  Identities=32%  Similarity=0.814  Sum_probs=9.3

Q ss_pred             cccccchhccChHHHHHHhh
Q psy14386        323 SCELCNKAFVSRSTLMVHKK  342 (344)
Q Consensus       323 ~C~~C~~~f~~~~~L~~H~~  342 (344)
                      .|+.||+.| ..+.|.+|++
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            455555555 4444555543


No 58 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.85  E-value=0.022  Score=29.78  Aligned_cols=19  Identities=32%  Similarity=0.898  Sum_probs=15.6

Q ss_pred             CcccccccCChhhHHHHHHH
Q psy14386        296 CNICGQSFTQFSPMAIHKRL  315 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~  315 (344)
                      |++||+.| ....|.+|+.+
T Consensus         5 C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    5 CPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CCCCCCEE-CHHHHHHHHHh
Confidence            88888888 67889999764


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.73  E-value=0.02  Score=32.60  Aligned_cols=23  Identities=30%  Similarity=0.667  Sum_probs=17.5

Q ss_pred             cccccccchhccChHHHHHHhhh
Q psy14386        321 PYSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       321 ~~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      +|.|.+|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888888888888753


No 60 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.60  E-value=0.052  Score=39.78  Aligned_cols=48  Identities=19%  Similarity=0.362  Sum_probs=29.6

Q ss_pred             ccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhh
Q psy14386        225 ACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       225 ~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      .|--|...|........  ..-.....|.|+.|...|--.-++-.|...|
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhcc
Confidence            37777777765431110  0022345688888888888777777777666


No 61 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.56  E-value=0.028  Score=48.94  Aligned_cols=20  Identities=25%  Similarity=0.378  Sum_probs=10.5

Q ss_pred             cCCCccccCChHHHHHHHHH
Q psy14386        226 CKTCPRSFKTKQTLLDHENR  245 (344)
Q Consensus       226 C~~C~~~f~~~~~L~~H~~~  245 (344)
                      |..|...|-.-..|.+|++.
T Consensus       223 C~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hhhccceecChHHHHHHHHh
Confidence            55555555555555555553


No 62 
>KOG2785|consensus
Probab=94.04  E-value=0.23  Score=44.30  Aligned_cols=135  Identities=17%  Similarity=0.283  Sum_probs=88.6

Q ss_pred             cccccccccccCCHHHHHHHHHh--cC-----------------------------------CCCccccccccccccChH
Q psy14386        139 LHKCDRCPKKFSSLAKYNFHVSN--HG-----------------------------------VDKPFQCFKCEKRFRSKL  181 (344)
Q Consensus       139 ~~~C~~C~~~f~~~~~l~~H~~~--h~-----------------------------------~~~~~~C~~C~~~f~~~~  181 (344)
                      .|.|.-|...|.+...-+.|+++  |.                                   .+-++.|..|.+.|.+..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            48999999999999888888764  21                                   113578999999999888


Q ss_pred             HHHHHHHHhcCC-----------------Ccee-------------cCccCCccCCHHHHHHHH------HHc------C
Q psy14386        182 GLDEHEAKHTGR-----------------YEYE-------------CNACGKGFQNKSYLIVHQ------RVH------S  219 (344)
Q Consensus       182 ~l~~H~~~h~~~-----------------~~~~-------------C~~C~~~f~~~~~l~~H~------~~h------~  219 (344)
                      ....|+..-...                 +.+.             +..+-..+........+.      .+-      -
T Consensus        83 a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~e~~~dd~~Edi~~d~~~e~  162 (390)
T KOG2785|consen   83 AHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSEEEEEDDEEEDIEEDGDDED  162 (390)
T ss_pred             hHHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccchhhccCcchhhhhhccchhc
Confidence            888887542110                 0011             111111111111111110      000      0


Q ss_pred             CCCCcccCCCccccCChHHHHHHHHHhCCC-----------------------CceeccccC---cccCChhHHHHHHhh
Q psy14386        220 TDKPYACKTCPRSFKTKQTLLDHENRHMGV-----------------------KPYSCEICG---RGFITKGLCKSHQKI  273 (344)
Q Consensus       220 ~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~-----------------------k~~~C~~C~---k~f~~~~~L~~H~~~  273 (344)
                      ..-|-.|-.|++.+++-..-..||..++|-                       .-|.|-.|+   +.|.+....+.||..
T Consensus       163 e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  163 ELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             ccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            123467999999999999999999988864                       237888898   999999999999975


No 63 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.60  E-value=0.12  Score=45.15  Aligned_cols=131  Identities=21%  Similarity=0.312  Sum_probs=87.5

Q ss_pred             ccccc--cccccCCHHHHHHHHHhcCCCCcccccccc---cccc------ChHHHHHHHHHhcCCC----ceecCccCCc
Q psy14386        140 HKCDR--CPKKFSSLAKYNFHVSNHGVDKPFQCFKCE---KRFR------SKLGLDEHEAKHTGRY----EYECNACGKG  204 (344)
Q Consensus       140 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~---~~f~------~~~~l~~H~~~h~~~~----~~~C~~C~~~  204 (344)
                      |.|+.  |.........|..|.+..++.  +.|..|-   +.|.      ++..|..|...-..+.    .=.|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            67864  666667788999999886654  6777774   3444      3455666654322221    2369999999


Q ss_pred             cCCHHHHHHHHHHcCCCCCcccCCCc----cccCChHHHHHHHHHhCCCCceeccc--cC----cccCChhHHHHHHhhh
Q psy14386        205 FQNKSYLIVHQRVHSTDKPYACKTCP----RSFKTKQTLLDHENRHMGVKPYSCEI--CG----RGFITKGLCKSHQKIH  274 (344)
Q Consensus       205 f~~~~~l~~H~~~h~~~~~~~C~~C~----~~f~~~~~L~~H~~~h~~~k~~~C~~--C~----k~f~~~~~L~~H~~~h  274 (344)
                      |.+-..|.+|+|..+ ++-|.|+.-+    .-|+....|..|.+.    --|.|..  |.    ..|.....|..|+..-
T Consensus       230 FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~~~k~~vf~~~~el~~h~~~~  304 (493)
T COG5236         230 FYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCRVGKCYVFPYHTELLEHLTRF  304 (493)
T ss_pred             ecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEecCcEEEeccHHHHHHHHHHH
Confidence            999999999999654 3334443322    247777788877663    3366654  42    3588889999999877


Q ss_pred             cCC
Q psy14386        275 SGN  277 (344)
Q Consensus       275 ~~~  277 (344)
                      |+.
T Consensus       305 h~~  307 (493)
T COG5236         305 HKV  307 (493)
T ss_pred             hhc
Confidence            764


No 64 
>KOG4173|consensus
Probab=93.59  E-value=0.045  Score=44.14  Aligned_cols=84  Identities=26%  Similarity=0.471  Sum_probs=58.2

Q ss_pred             CCCcccCC--CccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhhcCC--------CCCCcCCCCCCCc
Q psy14386        221 DKPYACKT--CPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGN--------DNRQYPCPVCKKL  290 (344)
Q Consensus       221 ~~~~~C~~--C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~--------~~~~~~C~~C~~~  290 (344)
                      .+.|.|.+  |...|..-..+..|..+-++.   .|..|.+.|.+...|..|+..-|.-        ..-.|+|-+    
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~Clv----  149 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLV----  149 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHH----
Confidence            34578887  778888887777777665544   7999999999999999998643310        013455433    


Q ss_pred             cCCCCCcccccccCChhhHHHHH-HHcc
Q psy14386        291 FVSKSCNICGQSFTQFSPMAIHK-RLHT  317 (344)
Q Consensus       291 f~~~~C~~C~k~f~~~~~L~~H~-~~H~  317 (344)
                            ..|+..|.+......|+ ++|.
T Consensus       150 ------EgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  150 ------EGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             ------HhhhhhhhhhhhhhhHHHHhcc
Confidence                  44777888888888885 5563


No 65 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.49  E-value=0.1  Score=38.33  Aligned_cols=85  Identities=19%  Similarity=0.298  Sum_probs=48.6

Q ss_pred             CccccccccccccChHHHHHHHHHhcCCC------------ceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCcccc
Q psy14386        166 KPFQCFKCEKRFRSKLGLDEHEAKHTGRY------------EYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSF  233 (344)
Q Consensus       166 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  233 (344)
                      -|..|+.|+-..-....|.+-...--..+            .-.|--|...|........  ..-.....|+|+.|...|
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCcc
Confidence            35566666666555555544211000011            1237788888865431110  001233468899999999


Q ss_pred             CChHHHHHHHHHhCCCCceeccccC
Q psy14386        234 KTKQTLLDHENRHMGVKPYSCEICG  258 (344)
Q Consensus       234 ~~~~~L~~H~~~h~~~k~~~C~~C~  258 (344)
                      --.-.+..|...|.      |+.|.
T Consensus        92 C~dCD~fiHe~Lh~------CPGC~  110 (112)
T TIGR00622        92 CVDCDVFVHESLHC------CPGCI  110 (112)
T ss_pred             ccccchhhhhhccC------CcCCC
Confidence            88888888887774      76665


No 66 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.25  E-value=0.076  Score=30.12  Aligned_cols=23  Identities=22%  Similarity=0.469  Sum_probs=18.5

Q ss_pred             ceeccccCcccCChhHHHHHHhh
Q psy14386        251 PYSCEICGRGFITKGLCKSHQKI  273 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L~~H~~~  273 (344)
                      +|.|..|++.|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888888888888764


No 67 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.82  E-value=0.054  Score=30.43  Aligned_cols=9  Identities=44%  Similarity=1.571  Sum_probs=3.9

Q ss_pred             CceeccccC
Q psy14386        250 KPYSCEICG  258 (344)
Q Consensus       250 k~~~C~~C~  258 (344)
                      .++.|+.||
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            344444444


No 68 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.81  E-value=0.19  Score=37.20  Aligned_cols=25  Identities=28%  Similarity=0.514  Sum_probs=23.1

Q ss_pred             eec----cccCcccCChhHHHHHHhhhcC
Q psy14386        252 YSC----EICGRGFITKGLCKSHQKIHSG  276 (344)
Q Consensus       252 ~~C----~~C~k~f~~~~~L~~H~~~h~~  276 (344)
                      |.|    ..|++.+.+...+.+|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998875


No 69 
>KOG2482|consensus
Probab=92.55  E-value=0.16  Score=44.46  Aligned_cols=107  Identities=28%  Similarity=0.463  Sum_probs=76.2

Q ss_pred             ccccccccccC-CHHHHHHHHHh-cCC-----C----------------CccccccccccccChHHHHHHHHHh--cCCC
Q psy14386        140 HKCDRCPKKFS-SLAKYNFHVSN-HGV-----D----------------KPFQCFKCEKRFRSKLGLDEHEAKH--TGRY  194 (344)
Q Consensus       140 ~~C~~C~~~f~-~~~~l~~H~~~-h~~-----~----------------~~~~C~~C~~~f~~~~~l~~H~~~h--~~~~  194 (344)
                      .+|-.|...+. .++....|+-. |+-     +                ..+.|-.|.+.|+.+..|+.||+..  ....
T Consensus       145 lqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrrin  224 (423)
T KOG2482|consen  145 LQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRIN  224 (423)
T ss_pred             eEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCcccC
Confidence            56888876654 45566666532 321     0                2367888999999999999998752  1110


Q ss_pred             ----------------------------------------------------c--eecCccCCccCCHHHHHHHHHHcCC
Q psy14386        195 ----------------------------------------------------E--YECNACGKGFQNKSYLIVHQRVHST  220 (344)
Q Consensus       195 ----------------------------------------------------~--~~C~~C~~~f~~~~~l~~H~~~h~~  220 (344)
                                                                          +  .+|-.|.....+...|..||..-+.
T Consensus       225 PknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~vHe  304 (423)
T KOG2482|consen  225 PKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIVHE  304 (423)
T ss_pred             CCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHHHH
Confidence                                                                1  5899999998889999999975332


Q ss_pred             ---------------------------CCCcccCCCccccCChHHHHHHHHHh
Q psy14386        221 ---------------------------DKPYACKTCPRSFKTKQTLLDHENRH  246 (344)
Q Consensus       221 ---------------------------~~~~~C~~C~~~f~~~~~L~~H~~~h  246 (344)
                                                 .+.-.|-.|.-.|.....|..||..+
T Consensus       305 ~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  305 FDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             hhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence                                       12346888999999999999999753


No 70 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=91.07  E-value=0.15  Score=26.79  Aligned_cols=21  Identities=38%  Similarity=0.880  Sum_probs=11.5

Q ss_pred             CCCCCCccCC--CCCcccccccC
Q psy14386        284 CPVCKKLFVS--KSCNICGQSFT  304 (344)
Q Consensus       284 C~~C~~~f~~--~~C~~C~k~f~  304 (344)
                      |+.|++....  ..|+.||..|.
T Consensus         3 CP~C~~~V~~~~~~Cp~CG~~F~   25 (26)
T PF10571_consen    3 CPECGAEVPESAKFCPHCGYDFE   25 (26)
T ss_pred             CCCCcCCchhhcCcCCCCCCCCc
Confidence            5566554322  34777776664


No 71 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=89.94  E-value=0.13  Score=43.23  Aligned_cols=92  Identities=21%  Similarity=0.404  Sum_probs=55.3

Q ss_pred             hCCCCceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHHHHHH----ccCCCc
Q psy14386        246 HMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRL----HTGERP  321 (344)
Q Consensus       246 h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~----H~~~k~  321 (344)
                      .+|.+.|+|..|+...-. ..--.|+..-.--....|+|.-|++. -.++|..|--.|=.     .|.+.    -...++
T Consensus       137 ~hGGrif~CsfC~~flCE-DDQFEHQAsCQvLe~E~~KC~SCNrl-Gq~sCLRCK~cfCd-----dHvrrKg~ky~k~k~  209 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCE-DDQFEHQASCQVLESETFKCQSCNRL-GQYSCLRCKICFCD-----DHVRRKGFKYEKGKP  209 (314)
T ss_pred             cCCCeEEEeecCCCeeec-cchhhhhhhhhhhhcccccccccccc-cchhhhheeeeehh-----hhhhhcccccccCCC
Confidence            467888888888754332 23334544332223366888888874 34456666655543     34332    123478


Q ss_pred             ccccccchhccChHHHHHHhhhC
Q psy14386        322 YSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      +.|+.||.-......|..-.|+|
T Consensus       210 ~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  210 IPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCcccccccceeeeecc
Confidence            99999998887777776555444


No 72 
>KOG4173|consensus
Probab=89.33  E-value=0.17  Score=40.91  Aligned_cols=74  Identities=27%  Similarity=0.505  Sum_probs=45.2

Q ss_pred             ccccc--ccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHH-c---------CCCCCcccC--CCcccc
Q psy14386        168 FQCFK--CEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRV-H---------STDKPYACK--TCPRSF  233 (344)
Q Consensus       168 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h---------~~~~~~~C~--~C~~~f  233 (344)
                      |.|+.  |...|.....+..|...-++.   .|..|.+.|.+.-.|..|+.- |         .|..-|.|-  .|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            67776  777777777777776554443   477888888877777777642 2         223335553  255555


Q ss_pred             CChHHHHHHHH
Q psy14386        234 KTKQTLLDHEN  244 (344)
Q Consensus       234 ~~~~~L~~H~~  244 (344)
                      .+...-+.|+-
T Consensus       157 kT~r~RkdH~I  167 (253)
T KOG4173|consen  157 KTSRDRKDHMI  167 (253)
T ss_pred             hhhhhhhhHHH
Confidence            55555555543


No 73 
>KOG2893|consensus
Probab=89.15  E-value=0.11  Score=42.91  Aligned_cols=42  Identities=26%  Similarity=0.631  Sum_probs=27.7

Q ss_pred             cCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHH
Q psy14386        226 CKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQ  271 (344)
Q Consensus       226 C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~  271 (344)
                      |.+|++.|....-|..|++.    |-|+|.+|.|..-+--.|..|-
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeeh
Confidence            67777777777777666653    4477777777666666666663


No 74 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.76  E-value=0.26  Score=36.22  Aligned_cols=13  Identities=31%  Similarity=0.812  Sum_probs=6.5

Q ss_pred             Ccccccccchhcc
Q psy14386        320 RPYSCELCNKAFV  332 (344)
Q Consensus       320 k~~~C~~C~~~f~  332 (344)
                      .|-.|+.||..|.
T Consensus        25 ~PivCP~CG~~~~   37 (108)
T PF09538_consen   25 DPIVCPKCGTEFP   37 (108)
T ss_pred             CCccCCCCCCccC
Confidence            4455555555443


No 75 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=87.75  E-value=0.41  Score=27.65  Aligned_cols=11  Identities=36%  Similarity=0.890  Sum_probs=4.8

Q ss_pred             ceeccccCccc
Q psy14386        251 PYSCEICGRGF  261 (344)
Q Consensus       251 ~~~C~~C~k~f  261 (344)
                      ..+|+.|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            44444444433


No 76 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=87.57  E-value=0.37  Score=27.92  Aligned_cols=10  Identities=30%  Similarity=0.876  Sum_probs=4.2

Q ss_pred             eeccccCccc
Q psy14386        252 YSCEICGRGF  261 (344)
Q Consensus       252 ~~C~~C~k~f  261 (344)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            3444444433


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=87.53  E-value=1.3  Score=32.72  Aligned_cols=25  Identities=28%  Similarity=0.598  Sum_probs=22.8

Q ss_pred             ccc----CCCccccCChHHHHHHHHHhCC
Q psy14386        224 YAC----KTCPRSFKTKQTLLDHENRHMG  248 (344)
Q Consensus       224 ~~C----~~C~~~f~~~~~L~~H~~~h~~  248 (344)
                      |.|    ..|+..+.+...++.|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998775


No 78 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=87.48  E-value=0.28  Score=30.57  Aligned_cols=30  Identities=23%  Similarity=0.319  Sum_probs=20.9

Q ss_pred             CCCCceeccccCcccCChhHHHHHHhhhcC
Q psy14386        247 MGVKPYSCEICGRGFITKGLCKSHQKIHSG  276 (344)
Q Consensus       247 ~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~  276 (344)
                      -|+.-+.||.||..|.....+.+|...-|+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            466667777777777777777777655443


No 79 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.10  E-value=0.14  Score=42.88  Aligned_cols=24  Identities=29%  Similarity=0.634  Sum_probs=15.4

Q ss_pred             CCceeccccCcccCChhHHHHHHh
Q psy14386        249 VKPYSCEICGRGFITKGLCKSHQK  272 (344)
Q Consensus       249 ~k~~~C~~C~k~f~~~~~L~~H~~  272 (344)
                      ++.+.||+|++.|.+..-+....+
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIR   26 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCce
Confidence            356778888888877655444443


No 80 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.01  E-value=0.31  Score=27.54  Aligned_cols=9  Identities=22%  Similarity=0.792  Sum_probs=3.8

Q ss_pred             cccCCCccc
Q psy14386        224 YACKTCPRS  232 (344)
Q Consensus       224 ~~C~~C~~~  232 (344)
                      |+|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            344444433


No 81 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=87.01  E-value=0.61  Score=47.09  Aligned_cols=24  Identities=29%  Similarity=0.729  Sum_probs=15.3

Q ss_pred             CCcCCCCCCCccCCCCCccccccc
Q psy14386        280 RQYPCPVCKKLFVSKSCNICGQSF  303 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~C~~C~k~f  303 (344)
                      ..|.|+.|+.....+.|+.||..-
T Consensus       650 ~i~fCP~CG~~~~~y~CPKCG~El  673 (1121)
T PRK04023        650 PVYRCPRCGIEVEEDECEKCGREP  673 (1121)
T ss_pred             cceeCccccCcCCCCcCCCCCCCC
Confidence            456677777666666677776543


No 82 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=86.52  E-value=0.25  Score=31.47  Aligned_cols=8  Identities=38%  Similarity=1.236  Sum_probs=4.0

Q ss_pred             eeccccCc
Q psy14386        252 YSCEICGR  259 (344)
Q Consensus       252 ~~C~~C~k  259 (344)
                      |.|+.||.
T Consensus        26 F~CPnCG~   33 (59)
T PRK14890         26 FLCPNCGE   33 (59)
T ss_pred             eeCCCCCC
Confidence            45555553


No 83 
>KOG2893|consensus
Probab=86.30  E-value=0.26  Score=40.85  Aligned_cols=33  Identities=36%  Similarity=0.890  Sum_probs=25.3

Q ss_pred             CceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCC
Q psy14386        250 KPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKK  289 (344)
Q Consensus       250 k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~  289 (344)
                      ||+ |=+|++.|.....|..|++.      +.|+|..|.|
T Consensus        10 kpw-cwycnrefddekiliqhqka------khfkchichk   42 (341)
T KOG2893|consen   10 KPW-CWYCNREFDDEKILIQHQKA------KHFKCHICHK   42 (341)
T ss_pred             Cce-eeecccccchhhhhhhhhhh------ccceeeeehh
Confidence            444 88899999999999999987      4566555544


No 84 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.16  E-value=0.57  Score=26.83  Aligned_cols=10  Identities=30%  Similarity=0.770  Sum_probs=4.1

Q ss_pred             ceeccccCcc
Q psy14386        251 PYSCEICGRG  260 (344)
Q Consensus       251 ~~~C~~C~k~  260 (344)
                      ..+|+.|+..
T Consensus        25 ~v~C~~C~~~   34 (36)
T PF13717_consen   25 KVRCSKCGHV   34 (36)
T ss_pred             EEECCCCCCE
Confidence            3444444433


No 85 
>KOG1842|consensus
Probab=86.08  E-value=0.48  Score=43.07  Aligned_cols=26  Identities=19%  Similarity=0.387  Sum_probs=21.4

Q ss_pred             CCcccCCCccccCChHHHHHHHHHhC
Q psy14386        222 KPYACKTCPRSFKTKQTLLDHENRHM  247 (344)
Q Consensus       222 ~~~~C~~C~~~f~~~~~L~~H~~~h~  247 (344)
                      .-|.|++|.+-|..-..|..|...-|
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhc
Confidence            35889999999999999999987543


No 86 
>KOG4124|consensus
Probab=85.51  E-value=0.12  Score=45.23  Aligned_cols=29  Identities=10%  Similarity=0.075  Sum_probs=20.6

Q ss_pred             HHHhcCCCCccccccccccccChHHHHHHH
Q psy14386        158 HVSNHGVDKPFQCFKCEKRFRSKLGLDEHE  187 (344)
Q Consensus       158 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  187 (344)
                      |+..-...+||+|+ |++.+.++..|..|-
T Consensus       204 ~~T~~t~~~p~k~~-~~~~~~T~~~l~~HS  232 (442)
T KOG4124|consen  204 SSTAETTGTPKKMP-ESLVMDTSSPLSDHS  232 (442)
T ss_pred             ccccccccCCccCc-ccccccccchhhhcc
Confidence            44444556788876 788888888877773


No 87 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.50  E-value=0.19  Score=42.10  Aligned_cols=43  Identities=30%  Similarity=0.612  Sum_probs=24.5

Q ss_pred             CCcccCCCccccCChHHHHHHHHH----------hCCCCc-----eeccccCcccCCh
Q psy14386        222 KPYACKTCPRSFKTKQTLLDHENR----------HMGVKP-----YSCEICGRGFITK  264 (344)
Q Consensus       222 ~~~~C~~C~~~f~~~~~L~~H~~~----------h~~~k~-----~~C~~C~k~f~~~  264 (344)
                      +.+.|++|++.|.+..-.....+.          ..+..|     ..||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            456677777766665433333221          112333     5899999988754


No 88 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.84  E-value=0.66  Score=27.96  Aligned_cols=23  Identities=26%  Similarity=0.486  Sum_probs=11.6

Q ss_pred             CCcccccccchhccCh----HHHHHHh
Q psy14386        319 ERPYSCELCNKAFVSR----STLMVHK  341 (344)
Q Consensus       319 ~k~~~C~~C~~~f~~~----~~L~~H~  341 (344)
                      ....+|.+|++.+...    +.|..|+
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            4445667776666553    6677776


No 89 
>PF01352 KRAB:  KRAB box;  InterPro: IPR001909 The Krueppel-associated box (KRAB) is a domain of around 75 amino acids that is found in the N-terminal part of about one third of eukaryotic Krueppel-type C2H2 zinc finger proteins (ZFPs) []. It is enriched in charged amino acids and can be divided into subregions A and B, which are predicted to fold into two amphipathic alpha-helices. The KRAB A and B boxes can be separated by variable spacer segments and many KRAB proteins contain only the A box []. The functions currently known for members of the KRAB-containing protein family include transcriptional repression of RNA polymerase I, II, and III promoters, binding and splicing of RNA, and control of nucleolus function. The KRAB domain functions as a transcriptional repressor when tethered to the template DNA by a DNA-binding domain. A sequence of 45 amino acids in the KRAB A subdomain has been shown to be necessary and sufficient for transcriptional repression. The B box does not repress by itself but does potentiate the repression exerted by the KRAB A subdomain [, ]. Gene silencing requires the binding of the KRAB domain to the RING-B box-coiled coil (RBCC) domain of the KAP-1/TIF1-beta corepressor. As KAP-1 binds to the heterochromatin proteins HP1, it has been proposed that the KRAB-ZFP-bound target gene could be silenced following recruitment to heterochromatin [, ]. KRAB-ZFPs probably constitute the single largest class of transcription factors within the human genome []. Although the function of KRAB-ZFPs is largely unknown, they appear to play important roles during cell differentiation and development. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B.; GO: 0003676 nucleic acid binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1V65_A.
Probab=84.81  E-value=0.34  Score=28.71  Aligned_cols=21  Identities=29%  Similarity=0.437  Sum_probs=16.6

Q ss_pred             CCCccchhHHHHHHHHhhcCC
Q psy14386         33 SEPSQDVNYILSHMETYRQMP   53 (344)
Q Consensus        33 ~ep~q~~~~~~~~~e~~~~~~   53 (344)
                      .+|+|+.+|.++|+|+|..+.
T Consensus        18 L~~~Qk~ly~dvm~Eny~~l~   38 (41)
T PF01352_consen   18 LDPAQKNLYRDVMLENYRNLV   38 (41)
T ss_dssp             S-HHHHHHHHHHHHHTTTS--
T ss_pred             ccceecccchhHHHHhhcccE
Confidence            468999999999999998774


No 90 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.62  E-value=0.45  Score=29.69  Aligned_cols=27  Identities=19%  Similarity=0.539  Sum_probs=17.7

Q ss_pred             CCCCCcccCCCccccCChHHHHHHHHH
Q psy14386        219 STDKPYACKTCPRSFKTKQTLLDHENR  245 (344)
Q Consensus       219 ~~~~~~~C~~C~~~f~~~~~L~~H~~~  245 (344)
                      .|+--++|+.||..|.....+.+|...
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            355566677777777777666666654


No 91 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=83.40  E-value=0.77  Score=45.56  Aligned_cols=15  Identities=27%  Similarity=0.498  Sum_probs=9.6

Q ss_pred             ccCCCcccccccchh
Q psy14386        316 HTGERPYSCELCNKA  330 (344)
Q Consensus       316 H~~~k~~~C~~C~~~  330 (344)
                      |....|..|+.||-.
T Consensus       470 ~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            445567777777743


No 92 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=82.64  E-value=0.97  Score=28.78  Aligned_cols=14  Identities=29%  Similarity=0.695  Sum_probs=7.5

Q ss_pred             ceeccccCcccCCh
Q psy14386        251 PYSCEICGRGFITK  264 (344)
Q Consensus       251 ~~~C~~C~k~f~~~  264 (344)
                      .|.|+.||..-..+
T Consensus        27 ~F~CPnCGe~~I~R   40 (61)
T COG2888          27 KFPCPNCGEVEIYR   40 (61)
T ss_pred             EeeCCCCCceeeeh
Confidence            36666666544443


No 93 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=81.87  E-value=0.83  Score=28.34  Aligned_cols=9  Identities=33%  Similarity=1.287  Sum_probs=4.1

Q ss_pred             CcccccccC
Q psy14386        296 CNICGQSFT  304 (344)
Q Consensus       296 C~~C~k~f~  304 (344)
                      |.+|++.+.
T Consensus        21 C~~C~~~l~   29 (50)
T smart00614       21 CKYCGKKLS   29 (50)
T ss_pred             ecCCCCEee
Confidence            444444443


No 94 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=81.82  E-value=0.78  Score=35.00  Aligned_cols=23  Identities=39%  Similarity=0.823  Sum_probs=15.2

Q ss_pred             CcccccccCChhhHHHHHHHccCCCc
Q psy14386        296 CNICGQSFTQFSPMAIHKRLHTGERP  321 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~H~~~k~  321 (344)
                      |.+||+.|..   |.+|++.|+|..|
T Consensus        75 clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   75 CLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             -TBT--EESB---HHHHHHHTT-S-H
T ss_pred             EccCCcccch---HHHHHHHccCCCH
Confidence            8899998874   5999999988765


No 95 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=81.57  E-value=0.94  Score=27.28  Aligned_cols=11  Identities=36%  Similarity=0.915  Sum_probs=4.8

Q ss_pred             cccCCCccccC
Q psy14386        224 YACKTCPRSFK  234 (344)
Q Consensus       224 ~~C~~C~~~f~  234 (344)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            34444444443


No 96 
>PHA00626 hypothetical protein
Probab=81.48  E-value=0.84  Score=28.61  Aligned_cols=12  Identities=25%  Similarity=0.407  Sum_probs=5.7

Q ss_pred             cccccccchhcc
Q psy14386        321 PYSCELCNKAFV  332 (344)
Q Consensus       321 ~~~C~~C~~~f~  332 (344)
                      .|+|+.||+.|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            345555554444


No 97 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=80.73  E-value=0.73  Score=28.03  Aligned_cols=9  Identities=33%  Similarity=1.010  Sum_probs=3.9

Q ss_pred             cCCCCCCCc
Q psy14386        282 YPCPVCKKL  290 (344)
Q Consensus       282 ~~C~~C~~~  290 (344)
                      |.|+.||..
T Consensus         4 y~C~~CG~~   12 (46)
T PRK00398          4 YKCARCGRE   12 (46)
T ss_pred             EECCCCCCE
Confidence            444444443


No 98 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=80.72  E-value=1.4  Score=34.54  Aligned_cols=14  Identities=21%  Similarity=0.617  Sum_probs=7.7

Q ss_pred             CceecCccCCccCC
Q psy14386        194 YEYECNACGKGFQN  207 (344)
Q Consensus       194 ~~~~C~~C~~~f~~  207 (344)
                      .-|.|+.|+..|..
T Consensus        98 ~~Y~Cp~C~~~y~~  111 (147)
T smart00531       98 AYYKCPNCQSKYTF  111 (147)
T ss_pred             cEEECcCCCCEeeH
Confidence            34556666655554


No 99 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=80.61  E-value=1  Score=34.02  Aligned_cols=14  Identities=43%  Similarity=0.895  Sum_probs=6.8

Q ss_pred             ceeccccCcccCCh
Q psy14386        251 PYSCEICGRGFITK  264 (344)
Q Consensus       251 ~~~C~~C~k~f~~~  264 (344)
                      |++|..||+.|...
T Consensus         1 PH~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    1 PHQCTKCGRVFEDG   14 (131)
T ss_pred             CcccCcCCCCcCCC
Confidence            34455555555443


No 100
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.26  E-value=0.99  Score=33.79  Aligned_cols=23  Identities=22%  Similarity=0.398  Sum_probs=11.3

Q ss_pred             CCCCCCCccCCC-----CCcccccccCC
Q psy14386        283 PCPVCKKLFVSK-----SCNICGQSFTQ  305 (344)
Q Consensus       283 ~C~~C~~~f~~~-----~C~~C~k~f~~  305 (344)
                      .|+.||+.|.-.     .|++||..|.-
T Consensus        11 ~Cp~cg~kFYDLnk~p~vcP~cg~~~~~   38 (129)
T TIGR02300        11 ICPNTGSKFYDLNRRPAVSPYTGEQFPP   38 (129)
T ss_pred             cCCCcCccccccCCCCccCCCcCCccCc
Confidence            466666555322     25555555433


No 101
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=79.62  E-value=1.7  Score=34.49  Aligned_cols=35  Identities=14%  Similarity=0.313  Sum_probs=21.7

Q ss_pred             hcCCCceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCcccc
Q psy14386        190 HTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSF  233 (344)
Q Consensus       190 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  233 (344)
                      ..+..-|.|+.|+..|+...++.         .-|.|+.||...
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            34445577777777776666653         247777777543


No 102
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=79.25  E-value=2.4  Score=33.63  Aligned_cols=35  Identities=20%  Similarity=0.448  Sum_probs=24.6

Q ss_pred             cCCCCccccccccccccChHHHHHHHHHhcCCCceecCccCCcc
Q psy14386        162 HGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGF  205 (344)
Q Consensus       162 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  205 (344)
                      .....-|.|+.|+..|+....+.         ..|.|+.||...
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            34455688888888887777664         248888888753


No 103
>KOG2807|consensus
Probab=78.37  E-value=2.9  Score=36.62  Aligned_cols=24  Identities=29%  Similarity=0.529  Sum_probs=12.1

Q ss_pred             ceeccccCcccCChhHHHHHHhhh
Q psy14386        251 PYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      .|.|..|...|-.-.+...|...|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            355555555555555554554444


No 104
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=78.33  E-value=0.75  Score=28.25  Aligned_cols=10  Identities=50%  Similarity=1.301  Sum_probs=5.5

Q ss_pred             eeccccCccc
Q psy14386        252 YSCEICGRGF  261 (344)
Q Consensus       252 ~~C~~C~k~f  261 (344)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555555


No 105
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=78.20  E-value=1.6  Score=34.75  Aligned_cols=23  Identities=30%  Similarity=0.847  Sum_probs=14.6

Q ss_pred             ceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCc
Q psy14386        195 EYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCP  230 (344)
Q Consensus       195 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  230 (344)
                      -|.|++||..             +-|+.|-+||+||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            4677777664             3356667777776


No 106
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=77.74  E-value=2  Score=44.71  Aligned_cols=21  Identities=29%  Similarity=0.724  Sum_probs=9.7

Q ss_pred             CcCCCCCCCccCCC-----CCccccc
Q psy14386        281 QYPCPVCKKLFVSK-----SCNICGQ  301 (344)
Q Consensus       281 ~~~C~~C~~~f~~~-----~C~~C~k  301 (344)
                      +|.|+.||......     .|+.||.
T Consensus       692 vy~CPsCGaev~~des~a~~CP~CGt  717 (1337)
T PRK14714        692 VYVCPDCGAEVPPDESGRVECPRCDV  717 (1337)
T ss_pred             ceeCccCCCccCCCccccccCCCCCC
Confidence            34555555433222     3555553


No 107
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=77.64  E-value=0.45  Score=37.43  Aligned_cols=12  Identities=42%  Similarity=0.971  Sum_probs=5.3

Q ss_pred             eeccccCcccCC
Q psy14386        252 YSCEICGRGFIT  263 (344)
Q Consensus       252 ~~C~~C~k~f~~  263 (344)
                      |+|+.||+.|.+
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            444444444443


No 108
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=77.27  E-value=0.85  Score=38.45  Aligned_cols=28  Identities=21%  Similarity=0.303  Sum_probs=21.5

Q ss_pred             CCCceeccccCcccCChhHHHHHHhhhc
Q psy14386        248 GVKPYSCEICGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       248 ~~k~~~C~~C~k~f~~~~~L~~H~~~h~  275 (344)
                      ..+++.||.||........|..-.|+|.
T Consensus       206 k~k~~PCPKCg~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  206 KGKPIPCPKCGYETQETKDLSMSTRSHK  233 (314)
T ss_pred             cCCCCCCCCCCCcccccccceeeeecch
Confidence            4578889999988888777777666664


No 109
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=76.35  E-value=1.9  Score=21.91  Aligned_cols=6  Identities=50%  Similarity=1.436  Sum_probs=3.4

Q ss_pred             Cccccc
Q psy14386        296 CNICGQ  301 (344)
Q Consensus       296 C~~C~k  301 (344)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            556654


No 110
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.27  E-value=1.8  Score=32.46  Aligned_cols=12  Identities=25%  Similarity=0.337  Sum_probs=6.1

Q ss_pred             CCcCCCCCCCcc
Q psy14386        280 RQYPCPVCKKLF  291 (344)
Q Consensus       280 ~~~~C~~C~~~f  291 (344)
                      .|-.|+.||..|
T Consensus        25 ~p~vcP~cg~~~   36 (129)
T TIGR02300        25 RPAVSPYTGEQF   36 (129)
T ss_pred             CCccCCCcCCcc
Confidence            445555555544


No 111
>KOG2186|consensus
Probab=74.99  E-value=2.2  Score=35.93  Aligned_cols=55  Identities=18%  Similarity=0.489  Sum_probs=38.5

Q ss_pred             ceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCccccCChHHHHHHHHHhCCCCce
Q psy14386        195 EYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPY  252 (344)
Q Consensus       195 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~  252 (344)
                      .|.|..||....- ..+.+|+...++ ..|.|-.|++.|.. ..++.|..--+....|
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            3778888877554 456678877766 67888888888877 6677887655544444


No 112
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=74.59  E-value=1.8  Score=30.04  Aligned_cols=11  Identities=27%  Similarity=0.845  Sum_probs=5.9

Q ss_pred             CCcCCCCCCCc
Q psy14386        280 RQYPCPVCKKL  290 (344)
Q Consensus       280 ~~~~C~~C~~~  290 (344)
                      ..|.|+.|++.
T Consensus        34 ~~~~Cp~C~~~   44 (89)
T COG1997          34 AKHVCPFCGRT   44 (89)
T ss_pred             cCCcCCCCCCc
Confidence            44555555554


No 113
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.49  E-value=1  Score=26.37  Aligned_cols=12  Identities=50%  Similarity=1.132  Sum_probs=6.9

Q ss_pred             eeccccCcccCC
Q psy14386        252 YSCEICGRGFIT  263 (344)
Q Consensus       252 ~~C~~C~k~f~~  263 (344)
                      |.|+.||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            556666665543


No 114
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=74.31  E-value=3.3  Score=33.62  Aligned_cols=16  Identities=31%  Similarity=0.538  Sum_probs=7.6

Q ss_pred             ccccccccccccChHH
Q psy14386        167 PFQCFKCEKRFRSKLG  182 (344)
Q Consensus       167 ~~~C~~C~~~f~~~~~  182 (344)
                      -|.|+.|+..|.....
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            3455555555444443


No 115
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=74.20  E-value=1.7  Score=24.12  Aligned_cols=11  Identities=36%  Similarity=0.851  Sum_probs=4.7

Q ss_pred             eeccccCcccC
Q psy14386        252 YSCEICGRGFI  262 (344)
Q Consensus       252 ~~C~~C~k~f~  262 (344)
                      |.|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            34444554443


No 116
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=74.15  E-value=2.4  Score=22.23  Aligned_cols=19  Identities=16%  Similarity=0.503  Sum_probs=10.6

Q ss_pred             cccccchhccChHHHHHHhh
Q psy14386        323 SCELCNKAFVSRSTLMVHKK  342 (344)
Q Consensus       323 ~C~~C~~~f~~~~~L~~H~~  342 (344)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666665 4455555553


No 117
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=73.24  E-value=1.8  Score=30.86  Aligned_cols=13  Identities=38%  Similarity=0.846  Sum_probs=6.5

Q ss_pred             ceeccccCcccCC
Q psy14386        251 PYSCEICGRGFIT  263 (344)
Q Consensus       251 ~~~C~~C~k~f~~  263 (344)
                      |+.|..||..|..
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            3445555555544


No 118
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=73.07  E-value=3  Score=33.83  Aligned_cols=33  Identities=15%  Similarity=0.407  Sum_probs=19.3

Q ss_pred             CCCceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCcccc
Q psy14386        192 GRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSF  233 (344)
Q Consensus       192 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  233 (344)
                      ...-|.|+.|+..|+....+.         .-|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            334567777776666655542         246666666543


No 119
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=72.84  E-value=4.3  Score=31.78  Aligned_cols=38  Identities=13%  Similarity=0.409  Sum_probs=21.4

Q ss_pred             CCCccccccccccccChHHHHHHHHHhcCCCceecCccCCcc
Q psy14386        164 VDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGF  205 (344)
Q Consensus       164 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  205 (344)
                      ....|.|+.|+..|.....+..-   . ....|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~---d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLL---D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhc---C-CCCcEECCCCCCEE
Confidence            33457788888777754433220   1 12337777777654


No 120
>KOG2186|consensus
Probab=72.77  E-value=2  Score=36.27  Aligned_cols=54  Identities=22%  Similarity=0.541  Sum_probs=39.6

Q ss_pred             cccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHHcCCCCCc
Q psy14386        168 FQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPY  224 (344)
Q Consensus       168 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  224 (344)
                      |.|..||.... +..+.+|+-..++ .-|.|-.|++.|.. .....|...-+....|
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            78899988765 4456778887777 56899999999988 6677787655544444


No 121
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=72.27  E-value=1.1  Score=26.61  Aligned_cols=13  Identities=46%  Similarity=1.027  Sum_probs=7.8

Q ss_pred             eeccccCcccCCh
Q psy14386        252 YSCEICGRGFITK  264 (344)
Q Consensus       252 ~~C~~C~k~f~~~  264 (344)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            5666666666544


No 122
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=72.14  E-value=0.89  Score=28.42  Aligned_cols=7  Identities=43%  Similarity=1.384  Sum_probs=2.6

Q ss_pred             eccccCc
Q psy14386        253 SCEICGR  259 (344)
Q Consensus       253 ~C~~C~k  259 (344)
                      .|..||.
T Consensus         7 ~C~~Cg~   13 (52)
T TIGR02605         7 RCTACGH   13 (52)
T ss_pred             EeCCCCC
Confidence            3333333


No 123
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=72.05  E-value=2.2  Score=33.93  Aligned_cols=13  Identities=46%  Similarity=1.155  Sum_probs=8.6

Q ss_pred             ccCCCcccccccc
Q psy14386        316 HTGERPYSCELCN  328 (344)
Q Consensus       316 H~~~k~~~C~~C~  328 (344)
                      |-|+-|-+|++||
T Consensus       144 ~~ge~P~~CPiCg  156 (166)
T COG1592         144 HEGEAPEVCPICG  156 (166)
T ss_pred             ccCCCCCcCCCCC
Confidence            5556667777776


No 124
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=71.99  E-value=2.2  Score=32.61  Aligned_cols=22  Identities=41%  Similarity=0.727  Sum_probs=10.1

Q ss_pred             eecCccCCccCCHHHHHHHHHHcCC
Q psy14386        196 YECNACGKGFQNKSYLIVHQRVHST  220 (344)
Q Consensus       196 ~~C~~C~~~f~~~~~l~~H~~~h~~  220 (344)
                      ..|-.||+.|..   |++|++.|+|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eEEccCCcccch---HHHHHHHccC
Confidence            556666666644   3556665554


No 125
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=71.53  E-value=1.4  Score=28.31  Aligned_cols=41  Identities=22%  Similarity=0.548  Sum_probs=19.2

Q ss_pred             CCcccCC--CccccCChHHHHHHHHHhCCCCceeccc----cCcccCC
Q psy14386        222 KPYACKT--CPRSFKTKQTLLDHENRHMGVKPYSCEI----CGRGFIT  263 (344)
Q Consensus       222 ~~~~C~~--C~~~f~~~~~L~~H~~~h~~~k~~~C~~----C~k~f~~  263 (344)
                      .+..|+.  |...+. +..|..|+...-..++..|++    |+..+..
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            3445555  333333 345666666555566666666    6655543


No 126
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=70.25  E-value=1.1  Score=30.10  Aligned_cols=17  Identities=29%  Similarity=0.522  Sum_probs=8.9

Q ss_pred             CCCceecc--ccCcccCCh
Q psy14386        248 GVKPYSCE--ICGRGFITK  264 (344)
Q Consensus       248 ~~k~~~C~--~C~k~f~~~  264 (344)
                      .+.-+.|.  .||..|...
T Consensus        24 ~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         24 KERYHQCQNVNCSATFITY   42 (72)
T ss_pred             heeeeecCCCCCCCEEEEE
Confidence            34455555  555555543


No 127
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=70.11  E-value=3.5  Score=27.45  Aligned_cols=34  Identities=21%  Similarity=0.584  Sum_probs=23.1

Q ss_pred             ccCCCCCcccccccCChhhHHHHHHHccCCCcccccccchhccC
Q psy14386        290 LFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVS  333 (344)
Q Consensus       290 ~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~  333 (344)
                      .+++..|+.||..-..          -...+-|.|+.||..+.+
T Consensus        25 ~~TSq~C~~CG~~~~~----------~~~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   25 AYTSQTCPRCGHRNKK----------RRSGRVFTCPNCGFEMDR   58 (69)
T ss_pred             CCCccCccCccccccc----------ccccceEEcCCCCCEECc
Confidence            3456668888865543          234567999999987654


No 128
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=69.70  E-value=0.61  Score=36.70  Aligned_cols=14  Identities=36%  Similarity=0.771  Sum_probs=8.0

Q ss_pred             cccccccccccChH
Q psy14386        168 FQCFKCEKRFRSKL  181 (344)
Q Consensus       168 ~~C~~C~~~f~~~~  181 (344)
                      ++|+.||++|.+..
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            56666666665443


No 129
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=69.25  E-value=0.82  Score=44.47  Aligned_cols=28  Identities=21%  Similarity=0.693  Sum_probs=19.8

Q ss_pred             CcccccccCChhhHHHHHHHccCCCcccccccch
Q psy14386        296 CNICGQSFTQFSPMAIHKRLHTGERPYSCELCNK  329 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~  329 (344)
                      |+.|.+.|.+..+.+-|-      .|.-|+.||=
T Consensus       154 C~~C~~EY~dP~nRRfHA------Qp~aCp~CGP  181 (750)
T COG0068         154 CPFCDKEYKDPLNRRFHA------QPIACPKCGP  181 (750)
T ss_pred             CHHHHHHhcCcccccccc------ccccCcccCC
Confidence            888888777776655542      4678888883


No 130
>PRK12496 hypothetical protein; Provisional
Probab=68.92  E-value=2.6  Score=33.66  Aligned_cols=11  Identities=18%  Similarity=0.594  Sum_probs=6.0

Q ss_pred             eeccccCcccC
Q psy14386        252 YSCEICGRGFI  262 (344)
Q Consensus       252 ~~C~~C~k~f~  262 (344)
                      |.|.-|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            55555555554


No 131
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.89  E-value=3.4  Score=29.91  Aligned_cols=13  Identities=15%  Similarity=0.383  Sum_probs=7.7

Q ss_pred             CCcccccccchhc
Q psy14386        319 ERPYSCELCNKAF  331 (344)
Q Consensus       319 ~k~~~C~~C~~~f  331 (344)
                      ..|..|++||++|
T Consensus        24 rdPiVsPytG~s~   36 (129)
T COG4530          24 RDPIVSPYTGKSY   36 (129)
T ss_pred             CCccccCcccccc
Confidence            4555666666665


No 132
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=68.80  E-value=5.3  Score=39.37  Aligned_cols=24  Identities=29%  Similarity=0.739  Sum_probs=12.4

Q ss_pred             CCCCCCCccCC--CCCcccccccCCh
Q psy14386        283 PCPVCKKLFVS--KSCNICGQSFTQF  306 (344)
Q Consensus       283 ~C~~C~~~f~~--~~C~~C~k~f~~~  306 (344)
                      .|+.||.....  +.|+.||......
T Consensus        29 ~Cp~CG~~~~~~~~fC~~CG~~~~~~   54 (645)
T PRK14559         29 PCPQCGTEVPVDEAHCPNCGAETGTI   54 (645)
T ss_pred             cCCCCCCCCCcccccccccCCcccch
Confidence            36666655322  2366666655443


No 133
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=68.80  E-value=3.8  Score=21.42  Aligned_cols=20  Identities=35%  Similarity=0.762  Sum_probs=10.3

Q ss_pred             CCCCCCCccC--CCCCcccccc
Q psy14386        283 PCPVCKKLFV--SKSCNICGQS  302 (344)
Q Consensus       283 ~C~~C~~~f~--~~~C~~C~k~  302 (344)
                      .|+.||..-.  ...|+.||..
T Consensus         4 ~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    4 FCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCcccCCcCCcccccChhhCCC
Confidence            4566665321  1237777754


No 134
>KOG2807|consensus
Probab=68.72  E-value=8.2  Score=33.96  Aligned_cols=31  Identities=29%  Similarity=0.678  Sum_probs=25.3

Q ss_pred             CCcccCCCccccCChHHHHHHHHHhCCCCceeccccC
Q psy14386        222 KPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICG  258 (344)
Q Consensus       222 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~  258 (344)
                      -.|+|..|...|-..-+...|...|      .|+.|.
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh------cCCCcC
Confidence            4589999999998888888888877      577775


No 135
>PF14353 CpXC:  CpXC protein
Probab=68.02  E-value=2.2  Score=32.46  Aligned_cols=11  Identities=36%  Similarity=0.917  Sum_probs=6.8

Q ss_pred             eccccCcccCC
Q psy14386        253 SCEICGRGFIT  263 (344)
Q Consensus       253 ~C~~C~k~f~~  263 (344)
                      .|+.||..|..
T Consensus         3 tCP~C~~~~~~   13 (128)
T PF14353_consen    3 TCPHCGHEFEF   13 (128)
T ss_pred             CCCCCCCeeEE
Confidence            56667666643


No 136
>KOG4167|consensus
Probab=67.76  E-value=1.4  Score=42.76  Aligned_cols=24  Identities=29%  Similarity=0.600  Sum_probs=22.0

Q ss_pred             cccccccchhccChHHHHHHhhhC
Q psy14386        321 PYSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       321 ~~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      -|-|..|+|.|..-..+..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            489999999999999999999987


No 137
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=66.83  E-value=1.3  Score=29.81  Aligned_cols=18  Identities=33%  Similarity=0.689  Sum_probs=13.4

Q ss_pred             cCCCccccc--ccchhccCh
Q psy14386        317 TGERPYSCE--LCNKAFVSR  334 (344)
Q Consensus       317 ~~~k~~~C~--~C~~~f~~~  334 (344)
                      ..++-++|.  .||.+|.+.
T Consensus        23 ~~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         23 TKERYHQCQNVNCSATFITY   42 (72)
T ss_pred             hheeeeecCCCCCCCEEEEE
Confidence            445668898  899988754


No 138
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=66.10  E-value=1.7  Score=38.46  Aligned_cols=47  Identities=23%  Similarity=0.466  Sum_probs=22.4

Q ss_pred             CCcCCCCCCCc--cCCCCCcccccccCChhhHHHH-HHHc-cCCCcccccccchh
Q psy14386        280 RQYPCPVCKKL--FVSKSCNICGQSFTQFSPMAIH-KRLH-TGERPYSCELCNKA  330 (344)
Q Consensus       280 ~~~~C~~C~~~--f~~~~C~~C~k~f~~~~~L~~H-~~~H-~~~k~~~C~~C~~~  330 (344)
                      |-..|..|+-.  |....|+.||..    ..|... ...- .+.|-..|..|+.-
T Consensus       211 RyL~CslC~teW~~~R~~C~~Cg~~----~~l~y~~~~~~~~~~r~e~C~~C~~Y  261 (309)
T PRK03564        211 RYLHCNLCESEWHVVRVKCSNCEQS----GKLHYWSLDSEQAAVKAESCGDCGTY  261 (309)
T ss_pred             eEEEcCCCCCcccccCccCCCCCCC----CceeeeeecCCCcceEeeeccccccc
Confidence            33445555432  334458888852    122211 1000 23456789999743


No 139
>KOG1280|consensus
Probab=65.68  E-value=1.7  Score=38.33  Aligned_cols=36  Identities=25%  Similarity=0.372  Sum_probs=25.7

Q ss_pred             CCCCcccccccCChhhHHHHHHHccCCCcc--cccccc
Q psy14386        293 SKSCNICGQSFTQFSPMAIHKRLHTGERPY--SCELCN  328 (344)
Q Consensus       293 ~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~--~C~~C~  328 (344)
                      ++.|++|++.=-+...|..|...-+.+-++  .|++|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            445888888777778888888887776553  456665


No 140
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=65.29  E-value=3.4  Score=31.22  Aligned_cols=23  Identities=30%  Similarity=0.522  Sum_probs=19.6

Q ss_pred             CcccccccCChhhHHHHHHHccCCCc
Q psy14386        296 CNICGQSFTQFSPMAIHKRLHTGERP  321 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~H~~~k~  321 (344)
                      |..+||.|.   +|++|+.+|.|--|
T Consensus        79 cLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          79 CLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EeccCcchH---HHHHHHhcccCCCH
Confidence            888888887   79999999988654


No 141
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=64.65  E-value=6.3  Score=33.21  Aligned_cols=83  Identities=17%  Similarity=0.434  Sum_probs=48.4

Q ss_pred             CCHHHHHHHHHHcCCC-----CCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhhcCCCCC
Q psy14386        206 QNKSYLIVHQRVHSTD-----KPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNR  280 (344)
Q Consensus       206 ~~~~~l~~H~~~h~~~-----~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~  280 (344)
                      .+..+|+.+.+.+.+.     +.|.|..|....-        .+.-....--.|..|.+.|.=...  . ...  |  -.
T Consensus        90 LTe~Nlrm~d~a~~~~ip~~drqFaC~~Cd~~Ww--------Rrvp~rKeVSRCr~C~~rYDPVP~--d-kmw--G--~a  154 (278)
T PF15135_consen   90 LTEENLRMFDDAQENLIPSVDRQFACSSCDHMWW--------RRVPQRKEVSRCRKCRKRYDPVPC--D-KMW--G--IA  154 (278)
T ss_pred             chHHHHHHhhhhhhccccccceeeeccccchHHH--------hccCcccccccccccccccCCCcc--c-ccc--c--ee
Confidence            3456666666555443     7799999954321        122223334578888887754321  0 001  1  14


Q ss_pred             CcCCCCCCCccCCC-------CCccccccc
Q psy14386        281 QYPCPVCKKLFVSK-------SCNICGQSF  303 (344)
Q Consensus       281 ~~~C~~C~~~f~~~-------~C~~C~k~f  303 (344)
                      .|.|+.|+..|.-+       .|-.|+...
T Consensus       155 ef~C~~C~h~F~G~~qm~v~sPCy~C~~~v  184 (278)
T PF15135_consen  155 EFHCPKCRHNFRGFAQMGVPSPCYGCGNPV  184 (278)
T ss_pred             eeecccccccchhhhhcCCCCCccCCCCcc
Confidence            58899999988654       388887643


No 142
>KOG2272|consensus
Probab=63.81  E-value=2.5  Score=35.59  Aligned_cols=16  Identities=25%  Similarity=0.798  Sum_probs=11.9

Q ss_pred             CcccccccchhccChH
Q psy14386        320 RPYSCELCNKAFVSRS  335 (344)
Q Consensus       320 k~~~C~~C~~~f~~~~  335 (344)
                      ..|.|..|.+-|.--.
T Consensus       220 eHFvCa~CekPFlGHr  235 (332)
T KOG2272|consen  220 EHFVCAKCEKPFLGHR  235 (332)
T ss_pred             hheeehhcCCcccchh
Confidence            4589999998886543


No 143
>PF12773 DZR:  Double zinc ribbon
Probab=63.67  E-value=6.8  Score=24.04  Aligned_cols=21  Identities=33%  Similarity=0.675  Sum_probs=10.3

Q ss_pred             CCcCCCCCCCccCC--CCCcccc
Q psy14386        280 RQYPCPVCKKLFVS--KSCNICG  300 (344)
Q Consensus       280 ~~~~C~~C~~~f~~--~~C~~C~  300 (344)
                      ....|+.|+.....  ..|+.||
T Consensus        28 ~~~~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen   28 SKKICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCCCCcCCcCCCcCCcCccCccc
Confidence            44556666654322  2255554


No 144
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=62.69  E-value=4.9  Score=42.06  Aligned_cols=21  Identities=29%  Similarity=0.719  Sum_probs=9.4

Q ss_pred             cCCCCCCCccCCCCCcccccc
Q psy14386        282 YPCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       282 ~~C~~C~~~f~~~~C~~C~k~  302 (344)
                      ++|+.||..-....|+.||..
T Consensus       668 rkCPkCG~~t~~~fCP~CGs~  688 (1337)
T PRK14714        668 RRCPSCGTETYENRCPDCGTH  688 (1337)
T ss_pred             EECCCCCCccccccCcccCCc
Confidence            345555543333345555443


No 145
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=62.47  E-value=10  Score=24.34  Aligned_cols=46  Identities=9%  Similarity=0.196  Sum_probs=28.5

Q ss_pred             cCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCcccccccchhccC
Q psy14386        282 YPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVS  333 (344)
Q Consensus       282 ~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~  333 (344)
                      +.|+.|+..+......-||..|-. ..+..+.+.     ...|+.|++.++.
T Consensus         2 ~~Cpi~~~~~~~Pv~~~~G~v~~~-~~i~~~~~~-----~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMKDPVILPSGQTYER-RAIEKWLLS-----HGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCCCCEECCCCCEEeH-HHHHHHHHH-----CCCCCCCcCCCCh
Confidence            456666666655545557766643 455556554     2479999988743


No 146
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=62.43  E-value=5.5  Score=38.22  Aligned_cols=23  Identities=26%  Similarity=0.612  Sum_probs=15.6

Q ss_pred             CCcCCCCCCCccC-CCCCcccccc
Q psy14386        280 RQYPCPVCKKLFV-SKSCNICGQS  302 (344)
Q Consensus       280 ~~~~C~~C~~~f~-~~~C~~C~k~  302 (344)
                      ....|..||.... ...|+.||-.
T Consensus       239 ~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       239 GKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             CeEEcCCCcCcCCCCCCCCCCCCC
Confidence            5567888887654 4458888763


No 147
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=61.05  E-value=5.1  Score=20.59  Aligned_cols=7  Identities=29%  Similarity=1.208  Sum_probs=3.2

Q ss_pred             ccccccc
Q psy14386        322 YSCELCN  328 (344)
Q Consensus       322 ~~C~~C~  328 (344)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4444444


No 148
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=61.03  E-value=0.65  Score=41.03  Aligned_cols=34  Identities=21%  Similarity=0.344  Sum_probs=12.4

Q ss_pred             CCcccccccCChhhHHHHHHHccCCCcccccccch
Q psy14386        295 SCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNK  329 (344)
Q Consensus       295 ~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~  329 (344)
                      .|++||..-...-.... ...-.+.+-+.|..|+.
T Consensus       213 ~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~C~~C~~  246 (290)
T PF04216_consen  213 KCPYCGNTDHEKLEYFT-VEGEPAYRVEVCESCGS  246 (290)
T ss_dssp             S-TTT---SS-EEE---------SEEEEEETTTTE
T ss_pred             CCcCCCCCCCcceeeEe-cCCCCcEEEEECCcccc
Confidence            46677665433222210 11122345678888873


No 149
>COG1773 Rubredoxin [Energy production and conversion]
Probab=60.96  E-value=4.3  Score=25.65  Aligned_cols=13  Identities=23%  Similarity=0.825  Sum_probs=7.0

Q ss_pred             ceeccccCcccCC
Q psy14386        251 PYSCEICGRGFIT  263 (344)
Q Consensus       251 ~~~C~~C~k~f~~  263 (344)
                      .|+|..||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            3556666555543


No 150
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=60.09  E-value=11  Score=37.34  Aligned_cols=20  Identities=30%  Similarity=0.777  Sum_probs=12.3

Q ss_pred             CCCCCCCccCCCCCcccccc
Q psy14386        283 PCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       283 ~C~~C~~~f~~~~C~~C~k~  302 (344)
                      -|..||..+....|+.||..
T Consensus        17 FC~~CG~~l~~~~Cp~CG~~   36 (645)
T PRK14559         17 FCQKCGTSLTHKPCPQCGTE   36 (645)
T ss_pred             cccccCCCCCCCcCCCCCCC
Confidence            36666666655556666654


No 151
>KOG3362|consensus
Probab=59.36  E-value=2.9  Score=31.90  Aligned_cols=30  Identities=27%  Similarity=0.618  Sum_probs=18.4

Q ss_pred             CCCCCCccCCCCCcccccccCChhhHHHHHH
Q psy14386        284 CPVCKKLFVSKSCNICGQSFTQFSPMAIHKR  314 (344)
Q Consensus       284 C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~  314 (344)
                      |.+|| -++.+.|.-||-.+=+...|..|..
T Consensus       121 CaVCG-~~S~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  121 CAVCG-YDSKYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhhcC-CCchhHHHhcCCceeechhhhhccc
Confidence            55555 3444556677776666677776653


No 152
>KOG0717|consensus
Probab=59.16  E-value=38  Score=31.64  Aligned_cols=25  Identities=28%  Similarity=0.534  Sum_probs=19.7

Q ss_pred             CCcccccccccccCCHHHHHHHHHh
Q psy14386        137 KSLHKCDRCPKKFSSLAKYNFHVSN  161 (344)
Q Consensus       137 ~~~~~C~~C~~~f~~~~~l~~H~~~  161 (344)
                      .....|..|+..|.++..|..|+..
T Consensus       458 sa~~~C~tCr~~FdSRnkLF~Hlk~  482 (508)
T KOG0717|consen  458 SALISCTTCRESFDSRNKLFAHLKK  482 (508)
T ss_pred             chhHhhhhhhhhccchhHHHHHhhh
Confidence            3446788888888888888888764


No 153
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=59.06  E-value=2.8  Score=22.86  Aligned_cols=19  Identities=32%  Similarity=0.775  Sum_probs=8.7

Q ss_pred             CCCCCCCccCCCCCcccccc
Q psy14386        283 PCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       283 ~C~~C~~~f~~~~C~~C~k~  302 (344)
                      .|.+|+. ...+.|+.|+..
T Consensus         4 ~C~vC~~-~~kY~Cp~C~~~   22 (30)
T PF04438_consen    4 LCSVCGN-PAKYRCPRCGAR   22 (30)
T ss_dssp             EETSSSS-EESEE-TTT--E
T ss_pred             CCccCcC-CCEEECCCcCCc
Confidence            3555665 555556655544


No 154
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=58.91  E-value=9.8  Score=33.80  Aligned_cols=29  Identities=24%  Similarity=0.422  Sum_probs=20.1

Q ss_pred             HHhCCCCceeccccC-cccCChhHHHHHHh
Q psy14386        244 NRHMGVKPYSCEICG-RGFITKGLCKSHQK  272 (344)
Q Consensus       244 ~~h~~~k~~~C~~C~-k~f~~~~~L~~H~~  272 (344)
                      +.|-=.+.|.|.+|| +.+.-+..+.+|..
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhhh
Confidence            345556678888888 67777777777753


No 155
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=58.72  E-value=4.5  Score=33.79  Aligned_cols=28  Identities=18%  Similarity=0.333  Sum_probs=13.9

Q ss_pred             CCcccCCCccccCChHHHHHHHHHhCCC
Q psy14386        222 KPYACKTCPRSFKTKQTLLDHENRHMGV  249 (344)
Q Consensus       222 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~  249 (344)
                      ..|.|+.|+|.|+-..-.+.|+..-|.+
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            3456666666666665555665554443


No 156
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=57.32  E-value=6.8  Score=24.30  Aligned_cols=11  Identities=45%  Similarity=1.120  Sum_probs=6.1

Q ss_pred             eeccccCcccC
Q psy14386        252 YSCEICGRGFI  262 (344)
Q Consensus       252 ~~C~~C~k~f~  262 (344)
                      |.|..||+.+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            45556655554


No 157
>KOG2593|consensus
Probab=57.04  E-value=12  Score=34.37  Aligned_cols=15  Identities=27%  Similarity=0.707  Sum_probs=7.2

Q ss_pred             ccccccccccccChH
Q psy14386        167 PFQCFKCEKRFRSKL  181 (344)
Q Consensus       167 ~~~C~~C~~~f~~~~  181 (344)
                      .|.|+.|.+.|....
T Consensus       128 ~Y~Cp~C~kkyt~Le  142 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLE  142 (436)
T ss_pred             cccCCccccchhhhH
Confidence            355555555544433


No 158
>PRK04023 DNA polymerase II large subunit; Validated
Probab=56.87  E-value=8.5  Score=39.39  Aligned_cols=33  Identities=27%  Similarity=0.664  Sum_probs=19.0

Q ss_pred             cCCCCCCCc-cCCCCCcccccccCChhhHHHHHHHccCCCcccccccchh
Q psy14386        282 YPCPVCKKL-FVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKA  330 (344)
Q Consensus       282 ~~C~~C~~~-f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~  330 (344)
                      +.|+.||.. ...+.|+.||...                .+|.|+.||.-
T Consensus       639 frCP~CG~~Te~i~fCP~CG~~~----------------~~y~CPKCG~E  672 (1121)
T PRK04023        639 RRCPFCGTHTEPVYRCPRCGIEV----------------EEDECEKCGRE  672 (1121)
T ss_pred             ccCCCCCCCCCcceeCccccCcC----------------CCCcCCCCCCC
Confidence            466667653 2334466664432                24778888854


No 159
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=56.44  E-value=6.8  Score=34.14  Aligned_cols=26  Identities=27%  Similarity=0.583  Sum_probs=17.7

Q ss_pred             CCceeccccCcccCChhHHHHHHhhh
Q psy14386        249 VKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       249 ~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      ...|.|+.|...|-.-.+.-.|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            34577777777777777776776665


No 160
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=56.37  E-value=9.6  Score=32.16  Aligned_cols=73  Identities=12%  Similarity=0.301  Sum_probs=36.6

Q ss_pred             CHHHHHHHHHhcCCC-----CccccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHHcCCCCCcc
Q psy14386        151 SLAKYNFHVSNHGVD-----KPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYA  225 (344)
Q Consensus       151 ~~~~l~~H~~~h~~~-----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  225 (344)
                      +..+|....+.+.+.     +.|.|..|....-.        +.-....--.|..|.+.|.-.-.     ..-.|-.-|.
T Consensus        91 Te~Nlrm~d~a~~~~ip~~drqFaC~~Cd~~WwR--------rvp~rKeVSRCr~C~~rYDPVP~-----dkmwG~aef~  157 (278)
T PF15135_consen   91 TEENLRMFDDAQENLIPSVDRQFACSSCDHMWWR--------RVPQRKEVSRCRKCRKRYDPVPC-----DKMWGIAEFH  157 (278)
T ss_pred             hHHHHHHhhhhhhccccccceeeeccccchHHHh--------ccCcccccccccccccccCCCcc-----ccccceeeee
Confidence            455666555544333     56777777543211        11111223457777766543210     0122444577


Q ss_pred             cCCCccccCCh
Q psy14386        226 CKTCPRSFKTK  236 (344)
Q Consensus       226 C~~C~~~f~~~  236 (344)
                      |+.|+..|+..
T Consensus       158 C~~C~h~F~G~  168 (278)
T PF15135_consen  158 CPKCRHNFRGF  168 (278)
T ss_pred             cccccccchhh
Confidence            77777777654


No 161
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=56.28  E-value=6.8  Score=24.74  Aligned_cols=10  Identities=30%  Similarity=1.006  Sum_probs=5.1

Q ss_pred             eeccccCccc
Q psy14386        252 YSCEICGRGF  261 (344)
Q Consensus       252 ~~C~~C~k~f  261 (344)
                      |.|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4555555544


No 162
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=55.96  E-value=7.4  Score=23.15  Aligned_cols=21  Identities=33%  Similarity=0.553  Sum_probs=12.5

Q ss_pred             ccccccchhccChHHHHHHhh
Q psy14386        322 YSCELCNKAFVSRSTLMVHKK  342 (344)
Q Consensus       322 ~~C~~C~~~f~~~~~L~~H~~  342 (344)
                      |+|=.|..+..-.++|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            455556655566666666654


No 163
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=54.64  E-value=5.5  Score=24.70  Aligned_cols=13  Identities=15%  Similarity=0.460  Sum_probs=10.6

Q ss_pred             Ccccccccchhcc
Q psy14386        320 RPYSCELCNKAFV  332 (344)
Q Consensus       320 k~~~C~~C~~~f~  332 (344)
                      ..|.|..||..+.
T Consensus        36 ~r~~C~~Cgyt~~   48 (50)
T PRK00432         36 DRWHCGKCGYTEF   48 (50)
T ss_pred             CcEECCCcCCEEe
Confidence            6789999998764


No 164
>KOG4167|consensus
Probab=54.49  E-value=4.4  Score=39.56  Aligned_cols=29  Identities=24%  Similarity=0.557  Sum_probs=18.4

Q ss_pred             CCCCcccccccccccCCHHHHHHHHHhcC
Q psy14386        135 ESKSLHKCDRCPKKFSSLAKYNFHVSNHG  163 (344)
Q Consensus       135 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  163 (344)
                      .+...|.|..|++.|.....++.||++|.
T Consensus       788 ~~~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  788 DPTGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CCCceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            34455666667666666666666666664


No 165
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=54.41  E-value=6.1  Score=27.89  Aligned_cols=26  Identities=38%  Similarity=0.912  Sum_probs=14.3

Q ss_pred             CCcCCCCCCCccCC------CCCcccccccCC
Q psy14386        280 RQYPCPVCKKLFVS------KSCNICGQSFTQ  305 (344)
Q Consensus       280 ~~~~C~~C~~~f~~------~~C~~C~k~f~~  305 (344)
                      ..|.|+.|++.-..      +.|..|++.|..
T Consensus        34 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        34 AKYVCPFCGKKTVKRGSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             cCccCCCCCCCceEEEeeEEEEcCCCCCEEeC
Confidence            45677777653221      236666666643


No 166
>KOG2593|consensus
Probab=54.14  E-value=15  Score=33.72  Aligned_cols=37  Identities=19%  Similarity=0.521  Sum_probs=17.9

Q ss_pred             CCCceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCcc
Q psy14386        192 GRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPR  231 (344)
Q Consensus       192 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  231 (344)
                      ....|.|+.|.+.|.....++.   .-...-.|.|..|+-
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGG  161 (436)
T ss_pred             ccccccCCccccchhhhHHHHh---hcccCceEEEecCCC
Confidence            3345666666666655444321   111223466666654


No 167
>KOG1244|consensus
Probab=54.08  E-value=6.2  Score=33.69  Aligned_cols=13  Identities=15%  Similarity=0.153  Sum_probs=7.6

Q ss_pred             cccccccccccCh
Q psy14386        168 FQCFKCEKRFRSK  180 (344)
Q Consensus       168 ~~C~~C~~~f~~~  180 (344)
                      |.|+.+.+.....
T Consensus       194 ~~~d~~~~~~~~~  206 (336)
T KOG1244|consen  194 YVCDTGTKQTVFA  206 (336)
T ss_pred             hhhcccccccccC
Confidence            6677766654433


No 168
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=53.71  E-value=17  Score=21.41  Aligned_cols=27  Identities=26%  Similarity=0.645  Sum_probs=16.1

Q ss_pred             cCCCCCcccccccC--ChhhHHHHHHHcc
Q psy14386        291 FVSKSCNICGQSFT--QFSPMAIHKRLHT  317 (344)
Q Consensus       291 f~~~~C~~C~k~f~--~~~~L~~H~~~H~  317 (344)
                      |....|+.||..|.  ....-..|.+.|.
T Consensus        11 ~~~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   11 FGATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            33345667776664  3456677777664


No 169
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=53.68  E-value=7.1  Score=27.50  Aligned_cols=26  Identities=31%  Similarity=0.695  Sum_probs=13.3

Q ss_pred             CCcCCCCCCCccCC------CCCcccccccCC
Q psy14386        280 RQYPCPVCKKLFVS------KSCNICGQSFTQ  305 (344)
Q Consensus       280 ~~~~C~~C~~~f~~------~~C~~C~k~f~~  305 (344)
                      ..|.|+.|++.-..      +.|..|++.|..
T Consensus        35 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHAVKRQAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCceeeeeeEEEEcCCCCCEEeC
Confidence            45666666643211      126666666543


No 170
>PRK05580 primosome assembly protein PriA; Validated
Probab=52.91  E-value=9.4  Score=38.19  Aligned_cols=23  Identities=30%  Similarity=0.683  Sum_probs=14.2

Q ss_pred             CCcCCCCCCCccC-CCCCcccccc
Q psy14386        280 RQYPCPVCKKLFV-SKSCNICGQS  302 (344)
Q Consensus       280 ~~~~C~~C~~~f~-~~~C~~C~k~  302 (344)
                      +...|..||.... ...|+.||..
T Consensus       407 ~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        407 RRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             CeEECCCCcCCCCCCCCCCCCcCC
Confidence            4556777776653 3457777654


No 171
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=52.77  E-value=9.1  Score=24.10  Aligned_cols=20  Identities=45%  Similarity=1.054  Sum_probs=10.4

Q ss_pred             CCCCCCCccCCC----CCcccccc
Q psy14386        283 PCPVCKKLFVSK----SCNICGQS  302 (344)
Q Consensus       283 ~C~~C~~~f~~~----~C~~C~k~  302 (344)
                      +|+.|++.|...    .|+.||..
T Consensus         7 ~C~~Cg~~~~~~dDiVvCp~Cgap   30 (54)
T PF14446_consen    7 KCPVCGKKFKDGDDIVVCPECGAP   30 (54)
T ss_pred             cChhhCCcccCCCCEEECCCCCCc
Confidence            455666555422    26666544


No 172
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=52.47  E-value=3.9  Score=36.16  Aligned_cols=46  Identities=22%  Similarity=0.535  Sum_probs=21.9

Q ss_pred             CCcCCCCCCCc--cCCCCCcccccccCChhhHHHHHHH----ccCCCcccccccch
Q psy14386        280 RQYPCPVCKKL--FVSKSCNICGQSFTQFSPMAIHKRL----HTGERPYSCELCNK  329 (344)
Q Consensus       280 ~~~~C~~C~~~--f~~~~C~~C~k~f~~~~~L~~H~~~----H~~~k~~~C~~C~~  329 (344)
                      |-..|..|+-.  |....|++||..    ..|....--    ..+.+-..|..|+.
T Consensus       209 RyL~CslC~teW~~~R~~C~~Cg~~----~~l~y~~~e~~~~~~~~r~e~C~~C~~  260 (305)
T TIGR01562       209 RYLSCSLCATEWHYVRVKCSHCEES----KHLAYLSLEHDAEKAVLKAETCDSCQG  260 (305)
T ss_pred             eEEEcCCCCCcccccCccCCCCCCC----CceeeEeecCCCCCcceEEeecccccc
Confidence            33345555432  333458888864    122211111    12235678888873


No 173
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=52.25  E-value=2.6  Score=37.83  Aligned_cols=14  Identities=21%  Similarity=0.451  Sum_probs=5.2

Q ss_pred             cccCCCccccCChH
Q psy14386        224 YACKTCPRSFKTKQ  237 (344)
Q Consensus       224 ~~C~~C~~~f~~~~  237 (344)
                      +.|..|.+++-...
T Consensus       253 v~C~~C~yt~~~~~  266 (344)
T PF09332_consen  253 VTCKQCKYTAFKPS  266 (344)
T ss_dssp             EEETTT--EESS--
T ss_pred             EEcCCCCCcccCcc
Confidence            55666655444433


No 174
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=52.03  E-value=5  Score=24.53  Aligned_cols=13  Identities=31%  Similarity=0.966  Sum_probs=7.8

Q ss_pred             eeccccCcccCCh
Q psy14386        252 YSCEICGRGFITK  264 (344)
Q Consensus       252 ~~C~~C~k~f~~~  264 (344)
                      |.|..||..+.-.
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            5666676665443


No 175
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=51.38  E-value=6.6  Score=21.42  Aligned_cols=8  Identities=38%  Similarity=0.962  Sum_probs=3.3

Q ss_pred             ceeccccC
Q psy14386        251 PYSCEICG  258 (344)
Q Consensus       251 ~~~C~~C~  258 (344)
                      .|.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 176
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=50.79  E-value=4.2  Score=25.31  Aligned_cols=26  Identities=23%  Similarity=0.454  Sum_probs=11.8

Q ss_pred             CCceeccccCcccCChhHHHHHHhhh
Q psy14386        249 VKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       249 ~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      ...|.|+.|+..|----.+-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            34566776766666666666665554


No 178
>KOG4377|consensus
Probab=50.69  E-value=9.7  Score=34.61  Aligned_cols=19  Identities=42%  Similarity=0.649  Sum_probs=12.3

Q ss_pred             cccccCChhhHHHHHHHcc
Q psy14386        299 CGQSFTQFSPMAIHKRLHT  317 (344)
Q Consensus       299 C~k~f~~~~~L~~H~~~H~  317 (344)
                      |+..|...+++..|.|-|.
T Consensus       409 c~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  409 CEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             CceEEEehhhhhhhhhhhh
Confidence            6666666666666666664


No 179
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=50.49  E-value=23  Score=30.98  Aligned_cols=19  Identities=32%  Similarity=0.537  Sum_probs=10.5

Q ss_pred             CceeccccCcccCChhHHH
Q psy14386        250 KPYSCEICGRGFITKGLCK  268 (344)
Q Consensus       250 k~~~C~~C~k~f~~~~~L~  268 (344)
                      -|..|+.|........+|.
T Consensus       321 LPi~CP~Csl~LilsthLa  339 (421)
T COG5151         321 LPISCPICSLQLILSTHLA  339 (421)
T ss_pred             CCccCcchhHHHHHHHHHH
Confidence            3566777765555444443


No 180
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=50.11  E-value=5  Score=30.90  Aligned_cols=11  Identities=18%  Similarity=0.860  Sum_probs=5.3

Q ss_pred             cccCCCccccC
Q psy14386        224 YACKTCPRSFK  234 (344)
Q Consensus       224 ~~C~~C~~~f~  234 (344)
                      +.|..||..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            44555554443


No 181
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=49.97  E-value=5.3  Score=22.84  Aligned_cols=9  Identities=44%  Similarity=1.113  Sum_probs=3.9

Q ss_pred             ccccCcccC
Q psy14386        254 CEICGRGFI  262 (344)
Q Consensus       254 C~~C~k~f~  262 (344)
                      |+.||+.|.
T Consensus         4 C~~Cg~~Yh   12 (36)
T PF05191_consen    4 CPKCGRIYH   12 (36)
T ss_dssp             ETTTTEEEE
T ss_pred             cCCCCCccc
Confidence            444444443


No 182
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=49.96  E-value=3.5  Score=29.03  Aligned_cols=25  Identities=40%  Similarity=1.000  Sum_probs=12.9

Q ss_pred             CCcCCCCCCCccCC------CCCcccccccC
Q psy14386        280 RQYPCPVCKKLFVS------KSCNICGQSFT  304 (344)
Q Consensus       280 ~~~~C~~C~~~f~~------~~C~~C~k~f~  304 (344)
                      ..|.|+.|++.-..      +.|..|++.|.
T Consensus        34 ~ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVKRVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEEEEETTEEEETTTTEEEE
T ss_pred             CCCcCCCCCCceeEEeeeEEeecCCCCCEEe
Confidence            45667776664321      12666666554


No 183
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=49.82  E-value=11  Score=23.32  Aligned_cols=17  Identities=29%  Similarity=0.677  Sum_probs=9.3

Q ss_pred             CceeccccCcccCChhH
Q psy14386        250 KPYSCEICGRGFITKGL  266 (344)
Q Consensus       250 k~~~C~~C~k~f~~~~~  266 (344)
                      +.+.|..||..|.....
T Consensus         3 k~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             eeEEcccCCCeEEEehh
Confidence            44556666666555433


No 184
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=49.57  E-value=8.7  Score=25.44  Aligned_cols=31  Identities=32%  Similarity=0.903  Sum_probs=11.9

Q ss_pred             eccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCccccc
Q psy14386        253 SCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQ  301 (344)
Q Consensus       253 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k  301 (344)
                      .|..|++.|...              .+.+-|..||..|    |..|..
T Consensus        11 ~C~~C~~~F~~~--------------~rrhhCr~CG~~v----C~~Cs~   41 (69)
T PF01363_consen   11 NCMICGKKFSLF--------------RRRHHCRNCGRVV----CSSCSS   41 (69)
T ss_dssp             B-TTT--B-BSS--------------S-EEE-TTT--EE----ECCCS-
T ss_pred             cCcCcCCcCCCc--------------eeeEccCCCCCEE----CCchhC
Confidence            567777777431              1555666666655    445543


No 185
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=49.51  E-value=9.2  Score=38.26  Aligned_cols=35  Identities=26%  Similarity=0.642  Sum_probs=26.7

Q ss_pred             CCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCcccccccchh
Q psy14386        283 PCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKA  330 (344)
Q Consensus       283 ~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~  330 (344)
                      .|..||..+.   |+.|+-.+.          .|...+...|.+||..
T Consensus       437 ~C~~Cg~v~~---Cp~Cd~~lt----------~H~~~~~L~CH~Cg~~  471 (730)
T COG1198         437 LCRDCGYIAE---CPNCDSPLT----------LHKATGQLRCHYCGYQ  471 (730)
T ss_pred             ecccCCCccc---CCCCCcceE----------EecCCCeeEeCCCCCC
Confidence            5888888764   888887644          3666678899999976


No 186
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=49.25  E-value=8.3  Score=27.19  Aligned_cols=26  Identities=35%  Similarity=0.787  Sum_probs=14.8

Q ss_pred             CCcCCCCCCCccCC------CCCcccccccCC
Q psy14386        280 RQYPCPVCKKLFVS------KSCNICGQSFTQ  305 (344)
Q Consensus       280 ~~~~C~~C~~~f~~------~~C~~C~k~f~~  305 (344)
                      ..|.|+.|++.-..      ..|..|++.|..
T Consensus        35 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVKRVGTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceEEEEEEEEEcCCCCCEEeC
Confidence            55777777654221      236667666654


No 187
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=48.80  E-value=3.1  Score=28.05  Aligned_cols=13  Identities=15%  Similarity=0.373  Sum_probs=5.6

Q ss_pred             CcccCCCccccCC
Q psy14386        223 PYACKTCPRSFKT  235 (344)
Q Consensus       223 ~~~C~~C~~~f~~  235 (344)
                      ...|..|+..+.-
T Consensus        41 ~v~Cg~C~~~~~~   53 (71)
T PF05495_consen   41 RVICGKCRTEQPI   53 (71)
T ss_dssp             EEEETTT--EEES
T ss_pred             CeECCCCCCccCh
Confidence            4555555554443


No 188
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=48.77  E-value=8.6  Score=29.13  Aligned_cols=24  Identities=29%  Similarity=0.285  Sum_probs=14.2

Q ss_pred             eecCccCCccCCHHHHHHHHHHcCCCC
Q psy14386        196 YECNACGKGFQNKSYLIVHQRVHSTDK  222 (344)
Q Consensus       196 ~~C~~C~~~f~~~~~l~~H~~~h~~~~  222 (344)
                      ..|-.+|+.|.   +|++|+.+|.|--
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmT  100 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLT  100 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCC
Confidence            55666666663   4666666665543


No 189
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=46.56  E-value=8.2  Score=27.60  Aligned_cols=8  Identities=63%  Similarity=1.447  Sum_probs=4.0

Q ss_pred             Cccccccc
Q psy14386        296 CNICGQSF  303 (344)
Q Consensus       296 C~~C~k~f  303 (344)
                      |..||.+|
T Consensus        49 Cg~CGls~   56 (104)
T COG4888          49 CGNCGLSF   56 (104)
T ss_pred             cccCcceE
Confidence            55555444


No 190
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=46.03  E-value=6.4  Score=29.50  Aligned_cols=49  Identities=33%  Similarity=0.670  Sum_probs=28.7

Q ss_pred             ceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCcccccccch
Q psy14386        251 PYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNK  329 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~  329 (344)
                      ...|..|++.|....             +..-.|..|++.+    |..|+..             ..+...+.|.+|-+
T Consensus        54 ~~~C~~C~~~fg~l~-------------~~~~~C~~C~~~V----C~~C~~~-------------~~~~~~WlC~vC~k  102 (118)
T PF02318_consen   54 ERHCARCGKPFGFLF-------------NRGRVCVDCKHRV----CKKCGVY-------------SKKEPIWLCKVCQK  102 (118)
T ss_dssp             CSB-TTTS-BCSCTS-------------TTCEEETTTTEEE----ETTSEEE-------------TSSSCCEEEHHHHH
T ss_pred             CcchhhhCCcccccC-------------CCCCcCCcCCccc----cCccCCc-------------CCCCCCEEChhhHH
Confidence            346777777765432             1345677776643    6666654             34566788888864


No 191
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=46.03  E-value=13  Score=23.60  Aligned_cols=24  Identities=25%  Similarity=0.726  Sum_probs=17.3

Q ss_pred             CCcCCCCCCCccCCCCCccccccc
Q psy14386        280 RQYPCPVCKKLFVSKSCNICGQSF  303 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~C~~C~k~f  303 (344)
                      +.-.|+.||.......|+.||...
T Consensus         4 ~mr~C~~CgvYTLk~~CP~CG~~t   27 (56)
T PRK13130          4 KIRKCPKCGVYTLKEICPVCGGKT   27 (56)
T ss_pred             cceECCCCCCEEccccCcCCCCCC
Confidence            345688888776666788888753


No 192
>KOG1701|consensus
Probab=45.70  E-value=4.2  Score=37.11  Aligned_cols=39  Identities=21%  Similarity=0.358  Sum_probs=21.9

Q ss_pred             ccccccccccChHHHHHHHH--HhcCCCceecCccCCccCCHH
Q psy14386        169 QCFKCEKRFRSKLGLDEHEA--KHTGRYEYECNACGKGFQNKS  209 (344)
Q Consensus       169 ~C~~C~~~f~~~~~l~~H~~--~h~~~~~~~C~~C~~~f~~~~  209 (344)
                      .|-.|+|...-...-..=|.  .|.  .-|+|..|++...-.+
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv--~CFtC~~C~r~L~Gq~  316 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHV--QCFTCRTCRRQLAGQS  316 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcc--cceehHhhhhhhcccc
Confidence            57778876654443333332  232  3488888877654443


No 193
>KOG3408|consensus
Probab=45.47  E-value=13  Score=27.58  Aligned_cols=23  Identities=26%  Similarity=0.580  Sum_probs=14.2

Q ss_pred             cccccccchhccChHHHHHHhhh
Q psy14386        321 PYSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       321 ~~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      .|-|-.|.+-|.+...|..|.|+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            35666666666666666666553


No 194
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=45.41  E-value=9.1  Score=29.76  Aligned_cols=9  Identities=33%  Similarity=1.128  Sum_probs=4.0

Q ss_pred             ceecCccCCc
Q psy14386        195 EYECNACGKG  204 (344)
Q Consensus       195 ~~~C~~C~~~  204 (344)
                      +|.|. |+..
T Consensus       117 ~Y~C~-C~q~  125 (156)
T COG3091         117 PYRCQ-CQQH  125 (156)
T ss_pred             eEEee-cCCc
Confidence            34444 4444


No 195
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=45.09  E-value=21  Score=21.50  Aligned_cols=9  Identities=33%  Similarity=1.036  Sum_probs=4.0

Q ss_pred             CceeccccC
Q psy14386        250 KPYSCEICG  258 (344)
Q Consensus       250 k~~~C~~C~  258 (344)
                      ..|.|..|+
T Consensus        36 ~~~~C~~C~   44 (46)
T PF12760_consen   36 GRYRCKACR   44 (46)
T ss_pred             CeEECCCCC
Confidence            344444444


No 196
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=44.98  E-value=7.9  Score=32.34  Aligned_cols=29  Identities=21%  Similarity=0.493  Sum_probs=22.2

Q ss_pred             CCceecCccCCccCCHHHHHHHHHHcCCC
Q psy14386        193 RYEYECNACGKGFQNKSYLIVHQRVHSTD  221 (344)
Q Consensus       193 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  221 (344)
                      +..|.|+.|+|.|........|+..-+.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            44599999999999999999999876554


No 197
>PRK14873 primosome assembly protein PriA; Provisional
Probab=44.56  E-value=6.6  Score=39.03  Aligned_cols=23  Identities=22%  Similarity=0.502  Sum_probs=14.6

Q ss_pred             CCcCCCCCCCccCCCCCcccccc
Q psy14386        280 RQYPCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~C~~C~k~  302 (344)
                      ....|..||.......|+.||-.
T Consensus       409 ~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        409 GTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             CeeECCCCcCCCcCccCCCCcCC
Confidence            45667777765555567777654


No 198
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=44.38  E-value=6.9  Score=31.70  Aligned_cols=15  Identities=27%  Similarity=0.882  Sum_probs=10.4

Q ss_pred             CceeccccCcccCCh
Q psy14386        250 KPYSCEICGRGFITK  264 (344)
Q Consensus       250 k~~~C~~C~k~f~~~  264 (344)
                      -||.|.+|.+.|...
T Consensus       195 IPF~C~iCKkdy~sp  209 (259)
T COG5152         195 IPFLCGICKKDYESP  209 (259)
T ss_pred             Cceeehhchhhccch
Confidence            467777777776654


No 199
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=44.19  E-value=14  Score=28.02  Aligned_cols=21  Identities=24%  Similarity=0.548  Sum_probs=15.2

Q ss_pred             hCCCCceeccccCcccCChhH
Q psy14386        246 HMGVKPYSCEICGRGFITKGL  266 (344)
Q Consensus       246 h~~~k~~~C~~C~k~f~~~~~  266 (344)
                      -...+-|+|.+|..+.....-
T Consensus        75 F~d~~lYeCnIC~etS~ee~F   95 (140)
T PF05290_consen   75 FLDPKLYECNICKETSAEERF   95 (140)
T ss_pred             ecCCCceeccCcccccchhhc
Confidence            356688999999877766543


No 200
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=44.00  E-value=14  Score=23.32  Aligned_cols=9  Identities=22%  Similarity=0.922  Sum_probs=3.6

Q ss_pred             ccCCCcccc
Q psy14386        225 ACKTCPRSF  233 (344)
Q Consensus       225 ~C~~C~~~f  233 (344)
                      +|+.||..|
T Consensus        30 ~C~~Cgh~w   38 (55)
T PF14311_consen   30 KCPKCGHEW   38 (55)
T ss_pred             ECCCCCCee
Confidence            344443333


No 201
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=43.74  E-value=15  Score=28.63  Aligned_cols=11  Identities=55%  Similarity=1.268  Sum_probs=5.8

Q ss_pred             CcccccccCCh
Q psy14386        296 CNICGQSFTQF  306 (344)
Q Consensus       296 C~~C~k~f~~~  306 (344)
                      |+.||+.|++.
T Consensus        31 C~~C~~RFTTf   41 (156)
T COG1327          31 CLECGERFTTF   41 (156)
T ss_pred             ccccccccchh
Confidence            55555555543


No 202
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=43.12  E-value=13  Score=35.80  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=7.6

Q ss_pred             CCcccccccch
Q psy14386        319 ERPYSCELCNK  329 (344)
Q Consensus       319 ~k~~~C~~C~~  329 (344)
                      .-|..|+.||-
T Consensus       251 ~~~~~Cp~C~s  261 (505)
T TIGR00595       251 PIPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCCC
Confidence            34667888875


No 203
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=43.10  E-value=15  Score=23.09  Aligned_cols=33  Identities=33%  Similarity=0.870  Sum_probs=20.7

Q ss_pred             eccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCccccccc
Q psy14386        253 SCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSF  303 (344)
Q Consensus       253 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f  303 (344)
                      .|..|++.|...              .+.+.|..||+.|    |..|...+
T Consensus         4 ~C~~C~~~F~~~--------------~rk~~Cr~Cg~~~----C~~C~~~~   36 (57)
T cd00065           4 SCMGCGKPFTLT--------------RRRHHCRNCGRIF----CSKCSSNR   36 (57)
T ss_pred             cCcccCccccCC--------------ccccccCcCcCCc----ChHHcCCe
Confidence            577788877752              1556677777765    55555444


No 204
>PF05613 Herpes_U15:  Human herpesvirus U15 protein;  InterPro: IPR008644 U15 is an ORF present in human herpesvirus 6 (HHV-6) that was initially isolated from patients with the AIDS and lymphoproliferative disorders, but was subsequently shown to be responsible for the common childhood disease exanthema subitum (roseola). Several gene fragments of HHV-6 have been shown to activate the human immunodeficiency virus (HIV) type 1 long terminal repeat (LTR) []. The ORF U15 encodes a protein of 110 amino acids, whose function in unknown.
Probab=43.08  E-value=12  Score=25.82  Aligned_cols=24  Identities=38%  Similarity=0.488  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHhhhccccccC
Q psy14386          6 EELQEFNELCREAYAVHCTEIHSK   29 (344)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~   29 (344)
                      .+++||||||.--..+-.+|+.+.
T Consensus         7 qrlqe~relcpl~vlmslsnilsk   30 (110)
T PF05613_consen    7 QRLQECRELCPLPVLMSLSNILSK   30 (110)
T ss_pred             HHHHHHHHhCChHHHHHHHHHHhh
Confidence            468999999999888888877763


No 205
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=42.95  E-value=9.5  Score=30.62  Aligned_cols=11  Identities=36%  Similarity=0.673  Sum_probs=6.7

Q ss_pred             eeccccCcccC
Q psy14386        252 YSCEICGRGFI  262 (344)
Q Consensus       252 ~~C~~C~k~f~  262 (344)
                      |.|.-|++.|.
T Consensus       140 ~rC~GC~~~f~  150 (177)
T COG1439         140 LRCHGCKRIFP  150 (177)
T ss_pred             EEEecCceecC
Confidence            56666666665


No 206
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=42.62  E-value=14  Score=28.68  Aligned_cols=11  Identities=45%  Similarity=1.026  Sum_probs=5.4

Q ss_pred             CcccccccCCh
Q psy14386        296 CNICGQSFTQF  306 (344)
Q Consensus       296 C~~C~k~f~~~  306 (344)
                      |..||+.|++.
T Consensus        31 C~~C~~RFTTy   41 (147)
T TIGR00244        31 CLECHERFTTF   41 (147)
T ss_pred             CCccCCcccee
Confidence            55555555443


No 207
>KOG4377|consensus
Probab=42.60  E-value=10  Score=34.47  Aligned_cols=107  Identities=21%  Similarity=0.413  Sum_probs=62.3

Q ss_pred             ccccc--cccccccChHHHHHHHHHhcCCC------------ceec--CccCCccCCHHHHHHHHHHcCCC-------CC
Q psy14386        167 PFQCF--KCEKRFRSKLGLDEHEAKHTGRY------------EYEC--NACGKGFQNKSYLIVHQRVHSTD-------KP  223 (344)
Q Consensus       167 ~~~C~--~C~~~f~~~~~l~~H~~~h~~~~------------~~~C--~~C~~~f~~~~~l~~H~~~h~~~-------~~  223 (344)
                      -|.|.  .|+..+..+..+.+|..+|....            .|.|  ..|.+   +-+....|-..|+..       .-
T Consensus       271 hyhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrth  347 (480)
T KOG4377|consen  271 HYHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTH  347 (480)
T ss_pred             hhcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceecce
Confidence            46673  48877777888888888774321            2566  34777   334455565555322       12


Q ss_pred             cccCCCccccCCh--HHHHHHHHHhCCCC------------------------ceeccc--cCcccCChhHHHHHHhhhc
Q psy14386        224 YACKTCPRSFKTK--QTLLDHENRHMGVK------------------------PYSCEI--CGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       224 ~~C~~C~~~f~~~--~~L~~H~~~h~~~k------------------------~~~C~~--C~k~f~~~~~L~~H~~~h~  275 (344)
                      |.|..||-++..+  ..-..|.+-+.++.                        -|-|..  |+..|.+.+.+..|.+.|.
T Consensus       348 fhC~r~gCTdtfK~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  348 FHCQRIGCTDTFKDSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             eEEeccCCccccccccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhhhhhh
Confidence            6677766444333  22222222222211                        144543  8899999999999998885


Q ss_pred             C
Q psy14386        276 G  276 (344)
Q Consensus       276 ~  276 (344)
                      .
T Consensus       428 R  428 (480)
T KOG4377|consen  428 R  428 (480)
T ss_pred             h
Confidence            4


No 208
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=42.35  E-value=11  Score=28.08  Aligned_cols=10  Identities=20%  Similarity=0.378  Sum_probs=4.2

Q ss_pred             eecCccCCcc
Q psy14386        196 YECNACGKGF  205 (344)
Q Consensus       196 ~~C~~C~~~f  205 (344)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            3444444333


No 209
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=42.18  E-value=11  Score=22.03  Aligned_cols=12  Identities=25%  Similarity=0.891  Sum_probs=8.9

Q ss_pred             cccccccchhcc
Q psy14386        321 PYSCELCNKAFV  332 (344)
Q Consensus       321 ~~~C~~C~~~f~  332 (344)
                      ||+|..|++.|=
T Consensus        12 ~f~C~~C~~~FC   23 (39)
T smart00154       12 GFKCRHCGNLFC   23 (39)
T ss_pred             CeECCccCCccc
Confidence            777888877763


No 210
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=41.12  E-value=5.5  Score=22.78  Aligned_cols=19  Identities=21%  Similarity=0.625  Sum_probs=15.1

Q ss_pred             HHHHHHHccCCCccccccc
Q psy14386        309 MAIHKRLHTGERPYSCELC  327 (344)
Q Consensus       309 L~~H~~~H~~~k~~~C~~C  327 (344)
                      +.+|-+...|...|.|..|
T Consensus        17 v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   17 VKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             ceeCCCCCCCCEeEecCcC
Confidence            5567777778888999988


No 211
>KOG4124|consensus
Probab=41.08  E-value=5.5  Score=35.30  Aligned_cols=45  Identities=29%  Similarity=0.702  Sum_probs=32.4

Q ss_pred             cccccccCChhhHHHHHHH-cc--------------C----CCcccccccchhccChHHHHHHh
Q psy14386        297 NICGQSFTQFSPMAIHKRL-HT--------------G----ERPYSCELCNKAFVSRSTLMVHK  341 (344)
Q Consensus       297 ~~C~k~f~~~~~L~~H~~~-H~--------------~----~k~~~C~~C~~~f~~~~~L~~H~  341 (344)
                      +.|.+.+.....|..|... |.              +    .|+|.|++|.+++....+|.-|+
T Consensus       355 p~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  355 PNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             CcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            5677888777777777542 31              1    47899999999998877766553


No 212
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=40.81  E-value=11  Score=28.16  Aligned_cols=10  Identities=20%  Similarity=0.826  Sum_probs=4.3

Q ss_pred             cccCCCcccc
Q psy14386        224 YACKTCPRSF  233 (344)
Q Consensus       224 ~~C~~C~~~f  233 (344)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            3444444444


No 213
>PRK05978 hypothetical protein; Provisional
Probab=40.78  E-value=17  Score=28.40  Aligned_cols=9  Identities=56%  Similarity=1.486  Sum_probs=4.6

Q ss_pred             CcccccccC
Q psy14386        296 CNICGQSFT  304 (344)
Q Consensus       296 C~~C~k~f~  304 (344)
                      |+.||..|.
T Consensus        55 C~~CG~~~~   63 (148)
T PRK05978         55 CAACGEDFT   63 (148)
T ss_pred             ccccCCccc
Confidence            555555443


No 214
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=40.61  E-value=8.9  Score=21.60  Aligned_cols=13  Identities=31%  Similarity=0.933  Sum_probs=4.9

Q ss_pred             eccccCcccCChh
Q psy14386        253 SCEICGRGFITKG  265 (344)
Q Consensus       253 ~C~~C~k~f~~~~  265 (344)
                      .|..|++.|..+.
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            4556666665543


No 215
>KOG1280|consensus
Probab=39.43  E-value=31  Score=30.80  Aligned_cols=51  Identities=18%  Similarity=0.365  Sum_probs=29.4

Q ss_pred             CceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccc
Q psy14386        250 KPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       250 k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~  302 (344)
                      .-|.|++|++.=.+-..|..|....|.+-..-..|++|+..  ...|++|++.
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~~--~~~qp~~~~~  128 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAAN--PEMQPIHSKE  128 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccccC--cccCchhhhh
Confidence            35777777777666677777776666553222346666542  1235555554


No 216
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=39.32  E-value=16  Score=22.29  Aligned_cols=33  Identities=27%  Similarity=0.337  Sum_probs=17.4

Q ss_pred             CCCCCCccCCCCCcccccccCChhhHHHHHHHcc
Q psy14386        284 CPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHT  317 (344)
Q Consensus       284 C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~  317 (344)
                      |..|+..-..+.|..|+..+-..... .|...|.
T Consensus         2 C~~C~~~~~l~~CL~C~~~~c~~~~~-~h~~~H~   34 (50)
T smart00290        2 CSVCGTIENLWLCLTCGQVGCGRYQL-GHALEHF   34 (50)
T ss_pred             cccCCCcCCeEEecCCCCcccCCCCC-cHHHHHh
Confidence            56666544455577777666533211 2444443


No 217
>KOG2636|consensus
Probab=39.15  E-value=20  Score=33.16  Aligned_cols=30  Identities=27%  Similarity=0.568  Sum_probs=25.2

Q ss_pred             HHHccCCCcccccccc-hhccChHHHHHHhh
Q psy14386        313 KRLHTGERPYSCELCN-KAFVSRSTLMVHKK  342 (344)
Q Consensus       313 ~~~H~~~k~~~C~~C~-~~f~~~~~L~~H~~  342 (344)
                      .+.|.-..-|.|.+|| +++.-+..+.+|..
T Consensus       393 yKLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  393 YKLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             HhhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            3567778889999999 89999999998863


No 218
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=38.92  E-value=19  Score=22.18  Aligned_cols=14  Identities=14%  Similarity=0.375  Sum_probs=10.4

Q ss_pred             cccccccchhccCh
Q psy14386        321 PYSCELCNKAFVSR  334 (344)
Q Consensus       321 ~~~C~~C~~~f~~~  334 (344)
                      .|.|+.||..+.-.
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            68899998776543


No 219
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=38.60  E-value=18  Score=33.38  Aligned_cols=30  Identities=23%  Similarity=0.584  Sum_probs=20.9

Q ss_pred             ccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChh
Q psy14386        225 ACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKG  265 (344)
Q Consensus       225 ~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~  265 (344)
                      .|+.||.+..+.           |..-|+|+.||+.+....
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCccc
Confidence            688888766553           444788888888777653


No 220
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.64  E-value=13  Score=27.83  Aligned_cols=10  Identities=40%  Similarity=1.059  Sum_probs=4.2

Q ss_pred             eecCccCCcc
Q psy14386        196 YECNACGKGF  205 (344)
Q Consensus       196 ~~C~~C~~~f  205 (344)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            3444444333


No 221
>KOG0978|consensus
Probab=37.15  E-value=8.4  Score=37.94  Aligned_cols=21  Identities=29%  Similarity=0.529  Sum_probs=15.8

Q ss_pred             cccccccchhccChHHHHHHh
Q psy14386        321 PYSCELCNKAFVSRSTLMVHK  341 (344)
Q Consensus       321 ~~~C~~C~~~f~~~~~L~~H~  341 (344)
                      .=+||.|+.+|....-+..|+
T Consensus       678 qRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             cCCCCCCCCCCCcccccccCC
Confidence            348999999998877766653


No 222
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=36.90  E-value=11  Score=29.43  Aligned_cols=44  Identities=20%  Similarity=0.289  Sum_probs=18.2

Q ss_pred             CCcCCCCCCCccCCCCCcccccccCChhhHHHHHH-HccC-----------CCcccccccch
Q psy14386        280 RQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKR-LHTG-----------ERPYSCELCNK  329 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~-~H~~-----------~k~~~C~~C~~  329 (344)
                      --.+|..|+|.|=..    -  .=+..+.+..|+. ..+.           +..++|-.||-
T Consensus        13 ~vv~C~~c~kWFCNg----~--~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen   13 CVVKCNTCNKWFCNG----R--GNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             CEEEETTTTEEEES--------TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             cEeEcCCCCcEeecC----C--CCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            345566666665221    1  1135677777753 2222           23578988984


No 223
>KOG3408|consensus
Probab=36.67  E-value=23  Score=26.38  Aligned_cols=23  Identities=22%  Similarity=0.469  Sum_probs=13.2

Q ss_pred             CceecCccCCccCCHHHHHHHHH
Q psy14386        194 YEYECNACGKGFQNKSYLIVHQR  216 (344)
Q Consensus       194 ~~~~C~~C~~~f~~~~~l~~H~~  216 (344)
                      ..|.|-.|.+.|.+...|..|.+
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHh
Confidence            34556666666666666655544


No 224
>PF12907 zf-met2:  Zinc-binding
Probab=36.13  E-value=9.9  Score=22.33  Aligned_cols=20  Identities=25%  Similarity=0.703  Sum_probs=13.7

Q ss_pred             ccccccchhccCh---HHHHHHh
Q psy14386        322 YSCELCNKAFVSR---STLMVHK  341 (344)
Q Consensus       322 ~~C~~C~~~f~~~---~~L~~H~  341 (344)
                      +.|.+|-.+|...   ..|..|.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~   24 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHA   24 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHH
Confidence            5788888666544   5577775


No 225
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=35.80  E-value=20  Score=33.15  Aligned_cols=16  Identities=13%  Similarity=0.453  Sum_probs=10.9

Q ss_pred             CCcccccccchhccCh
Q psy14386        319 ERPYSCELCNKAFVSR  334 (344)
Q Consensus       319 ~k~~~C~~C~~~f~~~  334 (344)
                      .+-|+|+.||+.+...
T Consensus       365 ~~g~rC~kCg~~~~~~  380 (421)
T COG1571         365 RNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCcccccccccCCcc
Confidence            3467888888776654


No 226
>PRK14873 primosome assembly protein PriA; Provisional
Probab=35.64  E-value=17  Score=36.27  Aligned_cols=44  Identities=14%  Similarity=0.321  Sum_probs=21.6

Q ss_pred             CCCCCCCccCCCCCcccccccCC---hhhHHHHHHHccCCCcccccccchh
Q psy14386        283 PCPVCKKLFVSKSCNICGQSFTQ---FSPMAIHKRLHTGERPYSCELCNKA  330 (344)
Q Consensus       283 ~C~~C~~~f~~~~C~~C~k~f~~---~~~L~~H~~~H~~~k~~~C~~C~~~  330 (344)
                      .|..||..+.   |+.|+-....   ...|.-|.=-+. ..|+.|+.||-.
T Consensus       385 ~C~~Cg~~~~---C~~C~~~L~~h~~~~~l~Ch~CG~~-~~p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRTPAR---CRHCTGPLGLPSAGGTPRCRWCGRA-APDWRCPRCGSD  431 (665)
T ss_pred             EhhhCcCeeE---CCCCCCceeEecCCCeeECCCCcCC-CcCccCCCCcCC
Confidence            5777776543   6666654332   112222221122 246777777753


No 227
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=35.61  E-value=12  Score=37.53  Aligned_cols=26  Identities=31%  Similarity=0.682  Sum_probs=0.0

Q ss_pred             CCcCCCCCCCccCCCCCcccccccCC
Q psy14386        280 RQYPCPVCKKLFVSKSCNICGQSFTQ  305 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~C~~C~k~f~~  305 (344)
                      ..|.|+.|+.......|+.||.....
T Consensus       679 ~~~~Cp~C~~~~~~~~C~~C~~~~~~  704 (900)
T PF03833_consen  679 PVYVCPDCGIEVEEDECPKCGRETTS  704 (900)
T ss_dssp             --------------------------
T ss_pred             cceeccccccccCccccccccccCcc
Confidence            45777777777766677777766443


No 228
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=35.59  E-value=12  Score=22.23  Aligned_cols=12  Identities=42%  Similarity=1.237  Sum_probs=7.2

Q ss_pred             Ccccccccchhc
Q psy14386        320 RPYSCELCNKAF  331 (344)
Q Consensus       320 k~~~C~~C~~~f  331 (344)
                      -||.|..|++.|
T Consensus        12 ~~~~C~~C~~~F   23 (43)
T PF01428_consen   12 LPFKCKHCGKSF   23 (43)
T ss_dssp             SHEE-TTTS-EE
T ss_pred             CCeECCCCCccc
Confidence            367788877776


No 229
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=35.09  E-value=22  Score=24.92  Aligned_cols=14  Identities=36%  Similarity=0.885  Sum_probs=10.2

Q ss_pred             CceeccccCcccCC
Q psy14386        250 KPYSCEICGRGFIT  263 (344)
Q Consensus       250 k~~~C~~C~k~f~~  263 (344)
                      +|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            46677777777766


No 230
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=35.08  E-value=6.9  Score=24.10  Aligned_cols=9  Identities=22%  Similarity=0.689  Sum_probs=5.1

Q ss_pred             CCcCCCCCC
Q psy14386        280 RQYPCPVCK  288 (344)
Q Consensus       280 ~~~~C~~C~  288 (344)
                      ..|+|..|.
T Consensus        14 ~r~~C~~C~   22 (49)
T cd02335          14 IRIKCAECP   22 (49)
T ss_pred             cEEECCCCC
Confidence            445666664


No 231
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=34.44  E-value=21  Score=20.88  Aligned_cols=22  Identities=14%  Similarity=0.234  Sum_probs=15.1

Q ss_pred             CCCcccccccchhccChHHHHH
Q psy14386        318 GERPYSCELCNKAFVSRSTLMV  339 (344)
Q Consensus       318 ~~k~~~C~~C~~~f~~~~~L~~  339 (344)
                      +..-+.|+.|+-.+.....|.+
T Consensus        16 ~~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   16 DVEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             CEEEEECCCCCeEEccHHHHHH
Confidence            3455678888877777776654


No 232
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=33.88  E-value=7.4  Score=23.84  Aligned_cols=9  Identities=44%  Similarity=1.202  Sum_probs=4.9

Q ss_pred             Ccccccccc
Q psy14386        320 RPYSCELCN  328 (344)
Q Consensus       320 k~~~C~~C~  328 (344)
                      +-|.|.-|+
T Consensus        40 eYY~CksC~   48 (57)
T PF14445_consen   40 EYYTCKSCN   48 (57)
T ss_pred             hHhHHHhhh
Confidence            445666554


No 233
>KOG4317|consensus
Probab=33.84  E-value=13  Score=32.64  Aligned_cols=16  Identities=44%  Similarity=1.059  Sum_probs=9.2

Q ss_pred             CCcCCCCCCCccCCCC
Q psy14386        280 RQYPCPVCKKLFVSKS  295 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~  295 (344)
                      +.|.|+.|+..|-+.+
T Consensus        18 ~~YtCPRCn~~YCsl~   33 (383)
T KOG4317|consen   18 REYTCPRCNLLYCSLK   33 (383)
T ss_pred             ccccCCCCCccceeee
Confidence            3467777766554433


No 234
>KOG2906|consensus
Probab=33.56  E-value=2.3  Score=30.14  Aligned_cols=15  Identities=27%  Similarity=0.605  Sum_probs=11.4

Q ss_pred             CceeccccCcccCCh
Q psy14386        250 KPYSCEICGRGFITK  264 (344)
Q Consensus       250 k~~~C~~C~k~f~~~  264 (344)
                      ..|.|.-|++.|.-.
T Consensus        20 ~rf~C~tCpY~~~I~   34 (105)
T KOG2906|consen   20 NRFSCRTCPYVFPIS   34 (105)
T ss_pred             eeEEcCCCCceeeEe
Confidence            468888898887654


No 235
>KOG2071|consensus
Probab=33.49  E-value=22  Score=34.15  Aligned_cols=26  Identities=23%  Similarity=0.474  Sum_probs=21.2

Q ss_pred             CCcccccccchhccChHHHHHHhhhC
Q psy14386        319 ERPYSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       319 ~k~~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      .+|.+|..||.+|.......+||-.|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            35678999999999988888887665


No 236
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.34  E-value=8.3  Score=32.18  Aligned_cols=9  Identities=33%  Similarity=0.707  Sum_probs=5.9

Q ss_pred             eeccccCcc
Q psy14386        252 YSCEICGRG  260 (344)
Q Consensus       252 ~~C~~C~k~  260 (344)
                      ..||.|+.+
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            467777754


No 237
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.22  E-value=3.9  Score=31.86  Aligned_cols=17  Identities=29%  Similarity=0.610  Sum_probs=12.6

Q ss_pred             CCcccccccchhccChH
Q psy14386        319 ERPYSCELCNKAFVSRS  335 (344)
Q Consensus       319 ~k~~~C~~C~~~f~~~~  335 (344)
                      +.|.-|..||+.|....
T Consensus        66 ~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCChhHHhCCCCCchHH
Confidence            46778888888887644


No 238
>PRK00420 hypothetical protein; Validated
Probab=32.86  E-value=26  Score=25.91  Aligned_cols=8  Identities=25%  Similarity=1.024  Sum_probs=4.7

Q ss_pred             Cccccccc
Q psy14386        296 CNICGQSF  303 (344)
Q Consensus       296 C~~C~k~f  303 (344)
                      |+.||...
T Consensus        43 Cp~Cg~~~   50 (112)
T PRK00420         43 CPVHGKVY   50 (112)
T ss_pred             CCCCCCee
Confidence            66666643


No 239
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=32.82  E-value=18  Score=23.78  Aligned_cols=8  Identities=50%  Similarity=1.464  Sum_probs=4.2

Q ss_pred             eeccccCc
Q psy14386        252 YSCEICGR  259 (344)
Q Consensus       252 ~~C~~C~k  259 (344)
                      |.|+.||.
T Consensus         1 y~C~KCg~    8 (64)
T PF09855_consen    1 YKCPKCGN    8 (64)
T ss_pred             CCCCCCCC
Confidence            45555553


No 240
>COG4640 Predicted membrane protein [Function unknown]
Probab=32.78  E-value=29  Score=31.56  Aligned_cols=28  Identities=32%  Similarity=0.644  Sum_probs=16.5

Q ss_pred             CCCCCC--ccCCCCCcccccccCChhhHHH
Q psy14386        284 CPVCKK--LFVSKSCNICGQSFTQFSPMAI  311 (344)
Q Consensus       284 C~~C~~--~f~~~~C~~C~k~f~~~~~L~~  311 (344)
                      |+.||.  .-....|+.||..|...+.+..
T Consensus         4 C~kcG~qk~Ed~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640           4 CPKCGSQKAEDDVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             ccccccccccccccccccCCcCCchhhhhh
Confidence            555552  1222347788888877766555


No 241
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=32.07  E-value=5.4  Score=23.38  Aligned_cols=8  Identities=50%  Similarity=1.447  Sum_probs=3.3

Q ss_pred             eeccccCc
Q psy14386        252 YSCEICGR  259 (344)
Q Consensus       252 ~~C~~C~k  259 (344)
                      |.|..||.
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            44444443


No 242
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=31.98  E-value=15  Score=27.20  Aligned_cols=12  Identities=25%  Similarity=0.844  Sum_probs=5.6

Q ss_pred             cccCCCccccCC
Q psy14386        224 YACKTCPRSFKT  235 (344)
Q Consensus       224 ~~C~~C~~~f~~  235 (344)
                      +.|..||..|.-
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            445555555544


No 243
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=31.75  E-value=6.5  Score=39.40  Aligned_cols=36  Identities=22%  Similarity=0.358  Sum_probs=18.6

Q ss_pred             cccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChh
Q psy14386        224 YACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKG  265 (344)
Q Consensus       224 ~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~  265 (344)
                      -.|+.|-+-+..+.+-+      -.----.|..||-.|.-..
T Consensus        69 a~C~~Cl~E~~dp~~Rr------y~YpF~nCt~CGPr~~i~~  104 (711)
T TIGR00143        69 ATCSDCLEEMLDKNDRR------YLYPFISCTHCGPRFTIIE  104 (711)
T ss_pred             hhHHHHHHHhcCCCccc------ccCCcccccCCCCCeEEee
Confidence            45777766555443310      0011126777887776543


No 244
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=31.63  E-value=26  Score=22.37  Aligned_cols=21  Identities=29%  Similarity=0.958  Sum_probs=13.1

Q ss_pred             cCCCCCCCccCCCCCcccccc
Q psy14386        282 YPCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       282 ~~C~~C~~~f~~~~C~~C~k~  302 (344)
                      .+|+.|+.---.-.|+.||..
T Consensus         6 rkC~~cg~YTLke~Cp~CG~~   26 (59)
T COG2260           6 RKCPKCGRYTLKEKCPVCGGD   26 (59)
T ss_pred             hcCcCCCceeecccCCCCCCc
Confidence            457777664444468888754


No 245
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=31.54  E-value=14  Score=21.95  Aligned_cols=8  Identities=38%  Similarity=1.082  Sum_probs=3.8

Q ss_pred             eeccccCc
Q psy14386        252 YSCEICGR  259 (344)
Q Consensus       252 ~~C~~C~k  259 (344)
                      |.|+.||.
T Consensus         1 m~Cp~Cg~    8 (43)
T PF08271_consen    1 MKCPNCGS    8 (43)
T ss_dssp             ESBTTTSS
T ss_pred             CCCcCCcC
Confidence            34555554


No 246
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=31.50  E-value=23  Score=27.41  Aligned_cols=20  Identities=25%  Similarity=0.893  Sum_probs=13.9

Q ss_pred             CCCCCCCccCCC--CCcccccc
Q psy14386        283 PCPVCKKLFVSK--SCNICGQS  302 (344)
Q Consensus       283 ~C~~C~~~f~~~--~C~~C~k~  302 (344)
                      +|..||..|-..  .|+.|+..
T Consensus        31 kC~~CG~v~~PPr~~Cp~C~~~   52 (140)
T COG1545          31 KCKKCGRVYFPPRAYCPKCGSE   52 (140)
T ss_pred             EcCCCCeEEcCCcccCCCCCCC
Confidence            588888877544  38888765


No 247
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=31.43  E-value=16  Score=28.56  Aligned_cols=9  Identities=44%  Similarity=1.080  Sum_probs=5.5

Q ss_pred             eeccccCcc
Q psy14386        252 YSCEICGRG  260 (344)
Q Consensus       252 ~~C~~C~k~  260 (344)
                      |.|..||..
T Consensus       113 l~C~~Cg~~  121 (146)
T PF07295_consen  113 LVCENCGHE  121 (146)
T ss_pred             EecccCCCE
Confidence            666666643


No 248
>PRK05580 primosome assembly protein PriA; Validated
Probab=31.35  E-value=24  Score=35.34  Aligned_cols=46  Identities=22%  Similarity=0.406  Sum_probs=23.9

Q ss_pred             cCCCCCCCccCCCCCcccccccCC---hhhHHHHHHHccCCCcccccccchh
Q psy14386        282 YPCPVCKKLFVSKSCNICGQSFTQ---FSPMAIHKRLHTGERPYSCELCNKA  330 (344)
Q Consensus       282 ~~C~~C~~~f~~~~C~~C~k~f~~---~~~L~~H~~~H~~~k~~~C~~C~~~  330 (344)
                      ..|..||...   .|+.|+-.+..   ...|.-|.=-++...|..|+.||..
T Consensus       382 ~~C~~Cg~~~---~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        382 LLCRDCGWVA---ECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             eEhhhCcCcc---CCCCCCCceeEECCCCeEECCCCcCCCCCCCCCCCCcCC
Confidence            3477777654   36677654431   2222333222334456678888654


No 249
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=31.06  E-value=22  Score=21.13  Aligned_cols=10  Identities=20%  Similarity=0.896  Sum_probs=5.2

Q ss_pred             CCcccccccc
Q psy14386        319 ERPYSCELCN  328 (344)
Q Consensus       319 ~k~~~C~~C~  328 (344)
                      .+...|++|+
T Consensus        34 ~~~~~CP~C~   43 (44)
T PF14634_consen   34 GKSVKCPICR   43 (44)
T ss_pred             CCCCCCcCCC
Confidence            3445566554


No 250
>KOG0320|consensus
Probab=30.87  E-value=42  Score=26.98  Aligned_cols=17  Identities=24%  Similarity=0.442  Sum_probs=11.6

Q ss_pred             CCCCcccccccccccCC
Q psy14386        135 ESKSLHKCDRCPKKFSS  151 (344)
Q Consensus       135 ~~~~~~~C~~C~~~f~~  151 (344)
                      .....|.|++|-..|..
T Consensus       127 ~~~~~~~CPiCl~~~se  143 (187)
T KOG0320|consen  127 RKEGTYKCPICLDSVSE  143 (187)
T ss_pred             ccccccCCCceecchhh
Confidence            34456889998776654


No 251
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=30.77  E-value=25  Score=31.50  Aligned_cols=28  Identities=29%  Similarity=0.726  Sum_probs=18.8

Q ss_pred             cCCCCCcccccccCChhhHHHHHHHccCCCcccccccchhccC
Q psy14386        291 FVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVS  333 (344)
Q Consensus       291 f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~  333 (344)
                      +++..|+.||.               -..+.|.|+.||..+.+
T Consensus       307 ~tS~~C~~cg~---------------~~~r~~~C~~cg~~~~r  334 (364)
T COG0675         307 YTSKTCPCCGH---------------LSGRLFKCPRCGFVHDR  334 (364)
T ss_pred             CCcccccccCC---------------ccceeEECCCCCCeehh
Confidence            44566888887               22466888888876543


No 252
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=30.76  E-value=15  Score=25.38  Aligned_cols=9  Identities=33%  Similarity=1.372  Sum_probs=2.3

Q ss_pred             CCcCCCCCC
Q psy14386        280 RQYPCPVCK  288 (344)
Q Consensus       280 ~~~~C~~C~  288 (344)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            445666665


No 253
>PTZ00448 hypothetical protein; Provisional
Probab=30.56  E-value=30  Score=31.27  Aligned_cols=23  Identities=17%  Similarity=0.440  Sum_probs=18.3

Q ss_pred             cccccccchhccChHHHHHHhhh
Q psy14386        321 PYSCELCNKAFVSRSTLMVHKKK  343 (344)
Q Consensus       321 ~~~C~~C~~~f~~~~~L~~H~~~  343 (344)
                      .|.|..|+-.|.+...-+.|+|+
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57888888888888888888775


No 254
>KOG1813|consensus
Probab=29.93  E-value=26  Score=30.52  Aligned_cols=43  Identities=28%  Similarity=0.702  Sum_probs=24.6

Q ss_pred             CceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCc-cCC-CCCcccccc
Q psy14386        250 KPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKL-FVS-KSCNICGQS  302 (344)
Q Consensus       250 k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~-f~~-~~C~~C~k~  302 (344)
                      -||.|.+|.+.|.+.-      ++-.    ..|-|..|... |.. ..|.+|++.
T Consensus       240 ~Pf~c~icr~~f~~pV------vt~c----~h~fc~~ca~~~~qk~~~c~vC~~~  284 (313)
T KOG1813|consen  240 LPFKCFICRKYFYRPV------VTKC----GHYFCEVCALKPYQKGEKCYVCSQQ  284 (313)
T ss_pred             CCccccccccccccch------hhcC----CceeehhhhccccccCCcceecccc
Confidence            4788888888777652      2221    45666666533 221 247777664


No 255
>KOG0782|consensus
Probab=29.65  E-value=26  Score=33.53  Aligned_cols=34  Identities=35%  Similarity=0.743  Sum_probs=16.6

Q ss_pred             CcccccccCChhhHHHHHHHccCC-CcccccccchhccChH
Q psy14386        296 CNICGQSFTQFSPMAIHKRLHTGE-RPYSCELCNKAFVSRS  335 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~H~~~-k~~~C~~C~~~f~~~~  335 (344)
                      |..|||.|..+-.+      |..+ -...|.-|.++|..+.
T Consensus       256 C~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  256 CNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            56666655543322      2222 1345666666665543


No 256
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=29.50  E-value=18  Score=36.45  Aligned_cols=11  Identities=27%  Similarity=0.718  Sum_probs=0.0

Q ss_pred             cccccchhccC
Q psy14386        323 SCELCNKAFVS  333 (344)
Q Consensus       323 ~C~~C~~~f~~  333 (344)
                      .|+.|+.-...
T Consensus       694 ~C~~C~~~~~~  704 (900)
T PF03833_consen  694 ECPKCGRETTS  704 (900)
T ss_dssp             -----------
T ss_pred             ccccccccCcc
Confidence            67777765443


No 257
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=29.46  E-value=15  Score=28.83  Aligned_cols=9  Identities=44%  Similarity=1.161  Sum_probs=4.3

Q ss_pred             eeccccCcc
Q psy14386        252 YSCEICGRG  260 (344)
Q Consensus       252 ~~C~~C~k~  260 (344)
                      |.|..|+-.
T Consensus       144 ~~C~~C~~~  152 (157)
T PF10263_consen  144 YRCGRCGGP  152 (157)
T ss_pred             EECCCCCCE
Confidence            455555433


No 258
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=28.34  E-value=59  Score=26.30  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=9.6

Q ss_pred             cCCCceecCccCCccCCH
Q psy14386        191 TGRYEYECNACGKGFQNK  208 (344)
Q Consensus       191 ~~~~~~~C~~C~~~f~~~  208 (344)
                      .+..-|.|+.|.-.|+.-
T Consensus       109 ~~~~~y~C~~~~~r~sfd  126 (176)
T COG1675         109 TENNYYVCPNCHVKYSFD  126 (176)
T ss_pred             ccCCceeCCCCCCcccHH
Confidence            344456666665555433


No 259
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=27.74  E-value=34  Score=22.24  Aligned_cols=19  Identities=26%  Similarity=0.912  Sum_probs=10.5

Q ss_pred             CCCCCCCccCCCCCccccc
Q psy14386        283 PCPVCKKLFVSKSCNICGQ  301 (344)
Q Consensus       283 ~C~~C~~~f~~~~C~~C~k  301 (344)
                      .|..|+..-....|+.||-
T Consensus         5 AC~~C~~i~~~~~CP~Cgs   23 (61)
T PRK08351          5 ACRHCHYITTEDRCPVCGS   23 (61)
T ss_pred             hhhhCCcccCCCcCCCCcC
Confidence            3555555544445666664


No 260
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=27.59  E-value=38  Score=26.43  Aligned_cols=17  Identities=18%  Similarity=0.442  Sum_probs=9.3

Q ss_pred             ceeccccCcccCChhHH
Q psy14386        251 PYSCEICGRGFITKGLC  267 (344)
Q Consensus       251 ~~~C~~C~k~f~~~~~L  267 (344)
                      -+.|+.||+.|-.-+++
T Consensus       124 f~~C~~C~kiyW~GsH~  140 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHW  140 (147)
T ss_pred             EEECCCCCCEecccccH
Confidence            45566666665554443


No 261
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=27.56  E-value=26  Score=26.05  Aligned_cols=10  Identities=30%  Similarity=0.627  Sum_probs=5.0

Q ss_pred             eeccccCccc
Q psy14386        252 YSCEICGRGF  261 (344)
Q Consensus       252 ~~C~~C~k~f  261 (344)
                      +.|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4555555433


No 262
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=27.48  E-value=31  Score=20.11  Aligned_cols=15  Identities=20%  Similarity=0.829  Sum_probs=9.0

Q ss_pred             ccCCCcccccccchh
Q psy14386        316 HTGERPYSCELCNKA  330 (344)
Q Consensus       316 H~~~k~~~C~~C~~~  330 (344)
                      ..+.+.+.|.+|+..
T Consensus        19 ~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen   19 DDGGKTWICNFCGTK   33 (40)
T ss_dssp             ETTTTEEEETTT--E
T ss_pred             cCCCCEEECcCCCCc
Confidence            445567888888753


No 263
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=27.47  E-value=34  Score=19.09  Aligned_cols=7  Identities=29%  Similarity=0.852  Sum_probs=3.2

Q ss_pred             cCCCCCC
Q psy14386        282 YPCPVCK  288 (344)
Q Consensus       282 ~~C~~C~  288 (344)
                      +.|..|+
T Consensus         4 ~~C~~C~   10 (33)
T PF08792_consen    4 KKCSKCG   10 (33)
T ss_pred             eEcCCCC
Confidence            3444444


No 264
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=27.46  E-value=29  Score=27.00  Aligned_cols=12  Identities=33%  Similarity=0.927  Sum_probs=6.1

Q ss_pred             CceeccccCccc
Q psy14386        250 KPYSCEICGRGF  261 (344)
Q Consensus       250 k~~~C~~C~k~f  261 (344)
                      ..|.|..|+-.+
T Consensus       132 ~~y~C~~C~g~l  143 (146)
T smart00731      132 SRYRCGKCGGKL  143 (146)
T ss_pred             ceEEcCCCCCEE
Confidence            445555555443


No 265
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=27.31  E-value=49  Score=20.99  Aligned_cols=12  Identities=17%  Similarity=0.481  Sum_probs=6.2

Q ss_pred             Ccccccccchhc
Q psy14386        320 RPYSCELCNKAF  331 (344)
Q Consensus       320 k~~~C~~C~~~f  331 (344)
                      -.|.|+.||-.+
T Consensus        13 v~~~Cp~cGipt   24 (55)
T PF13824_consen   13 VNFECPDCGIPT   24 (55)
T ss_pred             cCCcCCCCCCcC
Confidence            345566555433


No 266
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=27.27  E-value=27  Score=20.52  Aligned_cols=12  Identities=33%  Similarity=1.018  Sum_probs=8.2

Q ss_pred             CceeccccCccc
Q psy14386        250 KPYSCEICGRGF  261 (344)
Q Consensus       250 k~~~C~~C~k~f  261 (344)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            456777777666


No 267
>KOG0978|consensus
Probab=26.83  E-value=23  Score=35.06  Aligned_cols=16  Identities=19%  Similarity=0.532  Sum_probs=9.0

Q ss_pred             CceeccccCcccCChh
Q psy14386        250 KPYSCEICGRGFITKG  265 (344)
Q Consensus       250 k~~~C~~C~k~f~~~~  265 (344)
                      +.-+||.|+.+|.-..
T Consensus       677 RqRKCP~Cn~aFganD  692 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGAND  692 (698)
T ss_pred             hcCCCCCCCCCCCccc
Confidence            3345666666665543


No 268
>KOG3214|consensus
Probab=26.80  E-value=16  Score=26.07  Aligned_cols=10  Identities=50%  Similarity=1.245  Sum_probs=5.7

Q ss_pred             CcccccccCC
Q psy14386        296 CNICGQSFTQ  305 (344)
Q Consensus       296 C~~C~k~f~~  305 (344)
                      |.+|+.+|..
T Consensus        50 C~iC~esFqt   59 (109)
T KOG3214|consen   50 CRICEESFQT   59 (109)
T ss_pred             eeehhhhhcc
Confidence            5556665544


No 269
>KOG0717|consensus
Probab=26.79  E-value=35  Score=31.87  Aligned_cols=22  Identities=41%  Similarity=0.830  Sum_probs=19.8

Q ss_pred             cccCCCccccCChHHHHHHHHH
Q psy14386        224 YACKTCPRSFKTKQTLLDHENR  245 (344)
Q Consensus       224 ~~C~~C~~~f~~~~~L~~H~~~  245 (344)
                      +-|.+|+++|++...|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999764


No 270
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=26.44  E-value=24  Score=35.18  Aligned_cols=41  Identities=32%  Similarity=0.629  Sum_probs=26.1

Q ss_pred             eeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCC
Q psy14386        252 YSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQ  305 (344)
Q Consensus       252 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~  305 (344)
                      -.|..|++.|.....+.       +  .|..-|..||..|    |..|...+..
T Consensus       461 dtC~~C~kkFfSlsK~L-------~--~RKHHCRkCGrVF----C~~CSSnRs~  501 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPL-------G--TRAHHCRSCGIRL----CVFCITKRAH  501 (1374)
T ss_pred             CcccCcCCccccccccc-------c--cccccccCCcccc----CccccCCccc
Confidence            46999999986541100       1  1455688888876    7777766554


No 271
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=26.10  E-value=14  Score=19.83  Aligned_cols=8  Identities=38%  Similarity=1.111  Sum_probs=3.3

Q ss_pred             ccccCccc
Q psy14386        254 CEICGRGF  261 (344)
Q Consensus       254 C~~C~k~f  261 (344)
                      |-.|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            33344444


No 272
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=25.78  E-value=27  Score=25.34  Aligned_cols=7  Identities=43%  Similarity=1.293  Sum_probs=3.3

Q ss_pred             eeccccC
Q psy14386        252 YSCEICG  258 (344)
Q Consensus       252 ~~C~~C~  258 (344)
                      |.|..|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            4444444


No 273
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.73  E-value=38  Score=21.77  Aligned_cols=36  Identities=22%  Similarity=0.495  Sum_probs=16.3

Q ss_pred             ccCCCccc-cCChHHHHHHHHHhCCCCceeccccCcc
Q psy14386        225 ACKTCPRS-FKTKQTLLDHENRHMGVKPYSCEICGRG  260 (344)
Q Consensus       225 ~C~~C~~~-f~~~~~L~~H~~~h~~~k~~~C~~C~k~  260 (344)
                      +|.+|++. +.....+..-+......+.|.|+.|.-.
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~R   40 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHR   40 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhh
Confidence            45555432 2333333333333444555666666543


No 274
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=25.39  E-value=12  Score=22.77  Aligned_cols=36  Identities=25%  Similarity=0.478  Sum_probs=18.7

Q ss_pred             CcccccccCChhhHHHHHHHccCCCcccccc--cchhccC
Q psy14386        296 CNICGQSFTQFSPMAIHKRLHTGERPYSCEL--CNKAFVS  333 (344)
Q Consensus       296 C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~--C~~~f~~  333 (344)
                      ||.||....-..+...+..  ..+.-|+|..  ||.+|..
T Consensus         2 CP~Cg~~a~ir~S~~~s~~--~~~~Y~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLSPL--TRELYCQCTNPECGHTFVA   39 (47)
T ss_pred             cCCCCCeeEEEEchhhCcc--eEEEEEEECCCcCCCEEEE
Confidence            5556554433333332211  1234478877  9988864


No 275
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=25.15  E-value=45  Score=29.86  Aligned_cols=29  Identities=24%  Similarity=0.534  Sum_probs=24.5

Q ss_pred             HHHccCCCcccccccc-hhccChHHHHHHh
Q psy14386        313 KRLHTGERPYSCELCN-KAFVSRSTLMVHK  341 (344)
Q Consensus       313 ~~~H~~~k~~~C~~C~-~~f~~~~~L~~H~  341 (344)
                      .+.|.-.+-|.|.+|| +.+.-+..+.+|.
T Consensus       366 ~klhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         366 CKLHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HHhcCCCcceeeeecccccccchHHHHhhh
Confidence            3568888899999999 8888888888885


No 276
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=24.99  E-value=40  Score=19.98  Aligned_cols=11  Identities=45%  Similarity=1.171  Sum_probs=5.8

Q ss_pred             CCcccccccCC
Q psy14386        295 SCNICGQSFTQ  305 (344)
Q Consensus       295 ~C~~C~k~f~~  305 (344)
                      .|++||+.|+.
T Consensus        10 ~C~~C~rpf~W   20 (42)
T PF10013_consen   10 ICPVCGRPFTW   20 (42)
T ss_pred             cCcccCCcchH
Confidence            35555555543


No 277
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=24.96  E-value=40  Score=21.89  Aligned_cols=19  Identities=37%  Similarity=1.083  Sum_probs=10.8

Q ss_pred             CCCCCCccCCCC--Ccccccc
Q psy14386        284 CPVCKKLFVSKS--CNICGQS  302 (344)
Q Consensus       284 C~~C~~~f~~~~--C~~C~k~  302 (344)
                      |..|.+......  |+.||-.
T Consensus         7 C~~Ck~l~~~d~e~CP~Cgs~   27 (64)
T COG2093           7 CKNCKRLTPEDTEICPVCGST   27 (64)
T ss_pred             HhhccccCCCCCccCCCCCCc
Confidence            555655544444  7777654


No 278
>KOG2071|consensus
Probab=24.78  E-value=47  Score=32.05  Aligned_cols=28  Identities=29%  Similarity=0.501  Sum_probs=21.4

Q ss_pred             CCCceeccccCcccCChhHHHHHHhhhc
Q psy14386        248 GVKPYSCEICGRGFITKGLCKSHQKIHS  275 (344)
Q Consensus       248 ~~k~~~C~~C~k~f~~~~~L~~H~~~h~  275 (344)
                      ...|-.|..||..|.+......|+..|-
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3566888888888888888777777664


No 279
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=24.70  E-value=35  Score=24.54  Aligned_cols=12  Identities=42%  Similarity=0.982  Sum_probs=5.9

Q ss_pred             CCcccCCCcccc
Q psy14386        222 KPYACKTCPRSF  233 (344)
Q Consensus       222 ~~~~C~~C~~~f  233 (344)
                      ++++|..||.-|
T Consensus        78 ~~~rC~eCG~~f   89 (97)
T cd00924          78 KPKRCPECGHVF   89 (97)
T ss_pred             CceeCCCCCcEE
Confidence            455555555443


No 280
>KOG1512|consensus
Probab=24.52  E-value=28  Score=30.08  Aligned_cols=16  Identities=31%  Similarity=0.885  Sum_probs=10.7

Q ss_pred             CCcCCCCCCCccCCCCCccccc
Q psy14386        280 RQYPCPVCKKLFVSKSCNICGQ  301 (344)
Q Consensus       280 ~~~~C~~C~~~f~~~~C~~C~k  301 (344)
                      .+|+|..|..      |.+|++
T Consensus       307 Y~W~C~~C~l------C~IC~~  322 (381)
T KOG1512|consen  307 YFWKCSSCEL------CRICLG  322 (381)
T ss_pred             cchhhcccHh------hhccCC
Confidence            7778877764      556654


No 281
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=24.51  E-value=43  Score=21.09  Aligned_cols=8  Identities=50%  Similarity=1.273  Sum_probs=4.5

Q ss_pred             eeccccCc
Q psy14386        252 YSCEICGR  259 (344)
Q Consensus       252 ~~C~~C~k  259 (344)
                      ..||.||.
T Consensus         5 i~CP~Cgn   12 (55)
T PF14205_consen    5 ILCPICGN   12 (55)
T ss_pred             EECCCCCC
Confidence            45666664


No 282
>PLN02294 cytochrome c oxidase subunit Vb
Probab=24.24  E-value=37  Score=27.09  Aligned_cols=13  Identities=31%  Similarity=0.902  Sum_probs=6.3

Q ss_pred             CceeccccCcccC
Q psy14386        250 KPYSCEICGRGFI  262 (344)
Q Consensus       250 k~~~C~~C~k~f~  262 (344)
                      +|+.|+.||..|.
T Consensus       140 kp~RCpeCG~~fk  152 (174)
T PLN02294        140 KSFECPVCTQYFE  152 (174)
T ss_pred             CceeCCCCCCEEE
Confidence            4445555554443


No 283
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=23.86  E-value=63  Score=18.63  Aligned_cols=10  Identities=40%  Similarity=1.178  Sum_probs=2.2

Q ss_pred             ccccccchhc
Q psy14386        322 YSCELCNKAF  331 (344)
Q Consensus       322 ~~C~~C~~~f  331 (344)
                      |=|++|+..|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            3344444444


No 284
>PHA02942 putative transposase; Provisional
Probab=23.75  E-value=37  Score=31.32  Aligned_cols=32  Identities=25%  Similarity=0.578  Sum_probs=21.0

Q ss_pred             ccCCCCCcccccccCChhhHHHHHHHccCCCcccccccchhcc
Q psy14386        290 LFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFV  332 (344)
Q Consensus       290 ~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~  332 (344)
                      .|++..|+.||..-..           .+.+.|.|+.||....
T Consensus       322 ~yTSq~Cs~CG~~~~~-----------l~~r~f~C~~CG~~~d  353 (383)
T PHA02942        322 SYSSVSCPKCGHKMVE-----------IAHRYFHCPSCGYEND  353 (383)
T ss_pred             CCCCccCCCCCCccCc-----------CCCCEEECCCCCCEeC
Confidence            3556668899864221           1346799999997654


No 285
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=23.55  E-value=36  Score=19.36  Aligned_cols=15  Identities=40%  Similarity=0.975  Sum_probs=8.9

Q ss_pred             eccccCcccCChhHH
Q psy14386        253 SCEICGRGFITKGLC  267 (344)
Q Consensus       253 ~C~~C~k~f~~~~~L  267 (344)
                      .|+.|++.|...+.-
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            578888888776553


No 286
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=23.44  E-value=34  Score=24.72  Aligned_cols=8  Identities=38%  Similarity=1.223  Sum_probs=4.4

Q ss_pred             ceeccccC
Q psy14386        251 PYSCEICG  258 (344)
Q Consensus       251 ~~~C~~C~  258 (344)
                      .|.|+.||
T Consensus        21 ~f~CP~Cg   28 (99)
T PRK14892         21 IFECPRCG   28 (99)
T ss_pred             EeECCCCC
Confidence            35555555


No 287
>PRK04351 hypothetical protein; Provisional
Probab=23.26  E-value=38  Score=26.56  Aligned_cols=13  Identities=31%  Similarity=0.741  Sum_probs=6.7

Q ss_pred             CCceeccccCccc
Q psy14386        249 VKPYSCEICGRGF  261 (344)
Q Consensus       249 ~k~~~C~~C~k~f  261 (344)
                      ...|.|..|+-.+
T Consensus       130 ~~~yrCg~C~g~L  142 (149)
T PRK04351        130 TKRYRCGKCRGKL  142 (149)
T ss_pred             CCcEEeCCCCcEe
Confidence            3455555555443


No 288
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=23.20  E-value=68  Score=20.00  Aligned_cols=16  Identities=31%  Similarity=0.735  Sum_probs=7.2

Q ss_pred             CCCceeccccCcccCCh
Q psy14386        248 GVKPYSCEICGRGFITK  264 (344)
Q Consensus       248 ~~k~~~C~~C~k~f~~~  264 (344)
                      +... .||.|++.|..-
T Consensus        18 ~~~~-~CPlC~r~l~~e   33 (54)
T PF04423_consen   18 EAKG-CCPLCGRPLDEE   33 (54)
T ss_dssp             T-SE-E-TTT--EE-HH
T ss_pred             cCCC-cCCCCCCCCCHH
Confidence            3444 788888888753


No 289
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=23.15  E-value=46  Score=27.25  Aligned_cols=26  Identities=23%  Similarity=0.598  Sum_probs=17.3

Q ss_pred             CCCcCCCCCCCccCCCC------CcccccccC
Q psy14386        279 NRQYPCPVCKKLFVSKS------CNICGQSFT  304 (344)
Q Consensus       279 ~~~~~C~~C~~~f~~~~------C~~C~k~f~  304 (344)
                      .++-+|.+|+..|....      |+.|+..+.
T Consensus         4 ~k~rKCKvCg~~F~P~~s~q~vCSpeCa~a~~   35 (189)
T PF05766_consen    4 PKRRKCKVCGEWFVPARSNQKVCSPECAIALA   35 (189)
T ss_pred             CCCCcCcccCCccccCCCceeeeCHHHHhHHH
Confidence            35667777777776543      677885443


No 290
>KOG0782|consensus
Probab=23.07  E-value=31  Score=33.01  Aligned_cols=27  Identities=30%  Similarity=0.607  Sum_probs=12.8

Q ss_pred             HHHHHHHHhCCCCceeccccCcccCCh
Q psy14386        238 TLLDHENRHMGVKPYSCEICGRGFITK  264 (344)
Q Consensus       238 ~L~~H~~~h~~~k~~~C~~C~k~f~~~  264 (344)
                      .|.+|--.|.....=+|..|||+|.++
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQK  266 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQK  266 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhh
Confidence            444444444433344455555555444


No 291
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.05  E-value=13  Score=25.14  Aligned_cols=12  Identities=42%  Similarity=1.046  Sum_probs=8.3

Q ss_pred             ceeccccCcccC
Q psy14386        251 PYSCEICGRGFI  262 (344)
Q Consensus       251 ~~~C~~C~k~f~  262 (344)
                      .|.|..||..|.
T Consensus        12 ~Y~c~~cg~~~d   23 (82)
T COG2331          12 SYECTECGNRFD   23 (82)
T ss_pred             EEeecccchHHH
Confidence            478888886554


No 292
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=22.96  E-value=42  Score=25.58  Aligned_cols=8  Identities=38%  Similarity=1.082  Sum_probs=4.9

Q ss_pred             Cccccccc
Q psy14386        296 CNICGQSF  303 (344)
Q Consensus       296 C~~C~k~f  303 (344)
                      |++||..+
T Consensus        47 CPvC~~~~   54 (131)
T COG1645          47 CPVCGYRE   54 (131)
T ss_pred             CCCCCceE
Confidence            77777443


No 293
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=22.87  E-value=42  Score=24.71  Aligned_cols=12  Identities=25%  Similarity=0.639  Sum_probs=6.5

Q ss_pred             CceeccccCccc
Q psy14386        250 KPYSCEICGRGF  261 (344)
Q Consensus       250 k~~~C~~C~k~f  261 (344)
                      ....||.|+|..
T Consensus        68 v~V~CP~C~K~T   79 (114)
T PF11023_consen   68 VQVECPNCGKQT   79 (114)
T ss_pred             eeeECCCCCChH
Confidence            445566666543


No 294
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.82  E-value=37  Score=25.90  Aligned_cols=16  Identities=25%  Similarity=0.802  Sum_probs=13.1

Q ss_pred             CCcccccccchhccCh
Q psy14386        319 ERPYSCELCNKAFVSR  334 (344)
Q Consensus       319 ~k~~~C~~C~~~f~~~  334 (344)
                      ...|+|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            5679999999999754


No 295
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.81  E-value=50  Score=22.49  Aligned_cols=34  Identities=18%  Similarity=0.384  Sum_probs=23.3

Q ss_pred             CCCCCCCccCCC--------CCcccccccCChhhHHHHHHHc
Q psy14386        283 PCPVCKKLFVSK--------SCNICGQSFTQFSPMAIHKRLH  316 (344)
Q Consensus       283 ~C~~C~~~f~~~--------~C~~C~k~f~~~~~L~~H~~~H  316 (344)
                      .|+.|+......        .|+.|+-..-..+.|.+=+..-
T Consensus         3 lCP~C~v~l~~~~rs~vEiD~CPrCrGVWLDrGELdKli~r~   44 (88)
T COG3809           3 LCPICGVELVMSVRSGVEIDYCPRCRGVWLDRGELDKLIERS   44 (88)
T ss_pred             ccCcCCceeeeeeecCceeeeCCccccEeecchhHHHHHHHh
Confidence            366666554332        2999998888888888876543


No 296
>PRK07218 replication factor A; Provisional
Probab=22.69  E-value=47  Score=31.05  Aligned_cols=21  Identities=24%  Similarity=0.656  Sum_probs=12.1

Q ss_pred             cCCCCCCCccCCCCCcccccc
Q psy14386        282 YPCPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       282 ~~C~~C~~~f~~~~C~~C~k~  302 (344)
                      ..|+.|++......|+.||+.
T Consensus       298 ~rCP~C~r~v~~~~C~~hG~v  318 (423)
T PRK07218        298 ERCPECGRVIQKGQCRSHGAV  318 (423)
T ss_pred             ecCcCccccccCCcCCCCCCc
Confidence            346666665555556666653


No 297
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.18  E-value=32  Score=22.25  Aligned_cols=19  Identities=26%  Similarity=0.326  Sum_probs=11.5

Q ss_pred             HHHHhCCCCceeccccCcc
Q psy14386        242 HENRHMGVKPYSCEICGRG  260 (344)
Q Consensus       242 H~~~h~~~k~~~C~~C~k~  260 (344)
                      |..++.+..++.|+-=+-.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p   33 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPP   33 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCC
Confidence            4555667777777654433


No 298
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.17  E-value=65  Score=17.29  Aligned_cols=8  Identities=38%  Similarity=0.933  Sum_probs=3.6

Q ss_pred             cccccccc
Q psy14386        321 PYSCELCN  328 (344)
Q Consensus       321 ~~~C~~C~  328 (344)
                      -|.|..|+
T Consensus        15 ~Y~C~~c~   22 (30)
T PF03107_consen   15 FYHCSECC   22 (30)
T ss_pred             eEEeCCCC
Confidence            34444444


No 299
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=21.99  E-value=57  Score=30.02  Aligned_cols=20  Identities=30%  Similarity=0.765  Sum_probs=9.8

Q ss_pred             cCCCCCCCccCCC--CCccccc
Q psy14386        282 YPCPVCKKLFVSK--SCNICGQ  301 (344)
Q Consensus       282 ~~C~~C~~~f~~~--~C~~C~k  301 (344)
                      |.|..||..+..+  .|+.|+.
T Consensus         1 ~~c~~cg~~~~~~~g~cp~c~~   22 (372)
T cd01121           1 YVCSECGYVSPKWLGKCPECGE   22 (372)
T ss_pred             CCCCCCCCCCCCccEECcCCCC
Confidence            4455555444333  2666654


No 300
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=21.67  E-value=56  Score=21.46  Aligned_cols=19  Identities=37%  Similarity=0.905  Sum_probs=11.2

Q ss_pred             CCCCCCccCCCCCcccccc
Q psy14386        284 CPVCKKLFVSKSCNICGQS  302 (344)
Q Consensus       284 C~~C~~~f~~~~C~~C~k~  302 (344)
                      |..|+..-....|+.||-.
T Consensus         8 C~~C~~i~~~~~Cp~Cgs~   26 (64)
T PRK06393          8 CKKCKRLTPEKTCPVHGDE   26 (64)
T ss_pred             HhhCCcccCCCcCCCCCCC
Confidence            5566555544456666654


No 301
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=21.49  E-value=31  Score=28.25  Aligned_cols=7  Identities=43%  Similarity=1.507  Sum_probs=3.2

Q ss_pred             eccccCc
Q psy14386        253 SCEICGR  259 (344)
Q Consensus       253 ~C~~C~k  259 (344)
                      .||.||.
T Consensus        16 ~CPvCg~   22 (201)
T COG1779          16 DCPVCGG   22 (201)
T ss_pred             cCCcccc
Confidence            4444443


No 302
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.29  E-value=18  Score=27.00  Aligned_cols=13  Identities=31%  Similarity=0.644  Sum_probs=6.7

Q ss_pred             cccccccchhccC
Q psy14386        321 PYSCELCNKAFVS  333 (344)
Q Consensus       321 ~~~C~~C~~~f~~  333 (344)
                      |--|..||+.|..
T Consensus        68 psfchncgs~fpw   80 (160)
T COG4306          68 PSFCHNCGSRFPW   80 (160)
T ss_pred             cchhhcCCCCCCc
Confidence            3445555555543


No 303
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=21.28  E-value=36  Score=19.48  Aligned_cols=10  Identities=40%  Similarity=1.012  Sum_probs=4.9

Q ss_pred             Ccccccccch
Q psy14386        320 RPYSCELCNK  329 (344)
Q Consensus       320 k~~~C~~C~~  329 (344)
                      +-|+|..||.
T Consensus         5 ~~YkC~~CGn   14 (36)
T PF06397_consen    5 EFYKCEHCGN   14 (36)
T ss_dssp             EEEE-TTT--
T ss_pred             cEEEccCCCC
Confidence            3578888875


No 304
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=21.19  E-value=53  Score=20.21  Aligned_cols=10  Identities=20%  Similarity=0.777  Sum_probs=8.2

Q ss_pred             cccccccchh
Q psy14386        321 PYSCELCNKA  330 (344)
Q Consensus       321 ~~~C~~C~~~  330 (344)
                      .+.|..||++
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            7889999875


No 305
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=21.13  E-value=25  Score=21.54  Aligned_cols=9  Identities=33%  Similarity=1.110  Sum_probs=5.7

Q ss_pred             CCcCCCCCC
Q psy14386        280 RQYPCPVCK  288 (344)
Q Consensus       280 ~~~~C~~C~  288 (344)
                      ..|.|.+|.
T Consensus        14 ~R~~C~~C~   22 (48)
T cd02341          14 TRYHCSECD   22 (48)
T ss_pred             ceEECCCCC
Confidence            456676665


No 306
>KOG0402|consensus
Probab=20.95  E-value=32  Score=23.68  Aligned_cols=10  Identities=40%  Similarity=1.095  Sum_probs=5.2

Q ss_pred             CcCCCCCCCc
Q psy14386        281 QYPCPVCKKL  290 (344)
Q Consensus       281 ~~~C~~C~~~  290 (344)
                      .|.|+.||+.
T Consensus        36 ky~CsfCGK~   45 (92)
T KOG0402|consen   36 KYTCSFCGKK   45 (92)
T ss_pred             hhhhhhcchh
Confidence            3555555543


No 307
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.71  E-value=56  Score=26.67  Aligned_cols=49  Identities=18%  Similarity=0.321  Sum_probs=28.5

Q ss_pred             CcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHHHHHHccCCCcccccccch
Q psy14386        258 GRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNK  329 (344)
Q Consensus       258 ~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~  329 (344)
                      --.|.+...|.+.+...-   -....            |..||-.|....        |.....|.|+.|.-
T Consensus       114 ~Ls~tRAw~LvRf~~s~~---L~l~~------------C~~Cgg~fv~~~--------~e~~~~f~CplC~~  162 (187)
T PRK12722        114 LLSLTRAWTLVRFVDSGM---LQLSS------------CNCCGGHFVTHA--------HDPVGSFVCGLCQP  162 (187)
T ss_pred             eecHHHHHHHHHHHhcCc---Eeecc------------CCCCCCCeeccc--------cccCCCCcCCCCCC
Confidence            456777788887765531   12333            555555554222        34446799999963


No 308
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=20.69  E-value=78  Score=22.35  Aligned_cols=15  Identities=20%  Similarity=0.707  Sum_probs=8.9

Q ss_pred             CcccccccCChhhHH
Q psy14386        296 CNICGQSFTQFSPMA  310 (344)
Q Consensus       296 C~~C~k~f~~~~~L~  310 (344)
                      |+.||..|.+...+.
T Consensus        38 C~~CGe~y~~dev~~   52 (89)
T TIGR03829        38 CSHCGMEYQDDTTVK   52 (89)
T ss_pred             ccCCCcEeecHHHHH
Confidence            666776666554433


No 309
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=20.66  E-value=43  Score=25.34  Aligned_cols=11  Identities=27%  Similarity=0.658  Sum_probs=6.9

Q ss_pred             eeccccCcccCC
Q psy14386        252 YSCEICGRGFIT  263 (344)
Q Consensus       252 ~~C~~C~k~f~~  263 (344)
                      +.| .||..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            667 67766554


No 310
>PF14369 zf-RING_3:  zinc-finger
Probab=20.42  E-value=56  Score=18.46  Aligned_cols=7  Identities=29%  Similarity=0.994  Sum_probs=2.7

Q ss_pred             ccccchh
Q psy14386        324 CELCNKA  330 (344)
Q Consensus       324 C~~C~~~  330 (344)
                      |+.|+-.
T Consensus        24 CP~C~~g   30 (35)
T PF14369_consen   24 CPRCHGG   30 (35)
T ss_pred             CcCCCCc
Confidence            3333333


No 311
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=20.32  E-value=34  Score=21.83  Aligned_cols=8  Identities=25%  Similarity=0.970  Sum_probs=3.8

Q ss_pred             Cccccccc
Q psy14386        296 CNICGQSF  303 (344)
Q Consensus       296 C~~C~k~f  303 (344)
                      |+.|.+.|
T Consensus        47 CP~Ck~iy   54 (58)
T PF11238_consen   47 CPECKEIY   54 (58)
T ss_pred             CcCHHHHH
Confidence            55554433


No 312
>PLN02748 tRNA dimethylallyltransferase
Probab=20.01  E-value=61  Score=30.82  Aligned_cols=24  Identities=25%  Similarity=0.529  Sum_probs=20.1

Q ss_pred             Ccccccccch-hccChHHHHHHhhh
Q psy14386        320 RPYSCELCNK-AFVSRSTLMVHKKK  343 (344)
Q Consensus       320 k~~~C~~C~~-~f~~~~~L~~H~~~  343 (344)
                      +.|.|++|++ .+........|+++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            6688999997 79989889888854


Done!