Diaphorina citri psyllid: psy14395

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-

MTRSITTVVATLAALSIGFTYLFNKLVTSLEDSYHEAWLFRIVLNLLGYATIVLPGYILYRYVYTRHDFADAGCIGYVITACFKDNTKSYAEEKEQLAGSVKSSVKQDALLLLFCTAGLQGSYLTWGVLQEKIMTQTYTNIMLEEGKFRDSQFLVFVNRILALVVSGLSLLIINQPRHTVPLYKYGFCSFTNIMSSWCQYEALKYISFPAQVLAKSCKILAVMFMGKLVSAKPKSYEYFEYISALYISFPAQVLAKSCKILAVMFMGKLVSAKPKSYEYFEYISALVISLGMLLFMLSSLDTSDKVGKTTTLSGVILLALYLSCDSFTSNWQGVLFESYKVTSLQMMFGTNLFSCLFTAVSLLQQGGFYQSLHFMLQFPSFTLDCILLSISSAAGQLFVFFTIYKFGAIVFTIIMTVRQGLAILLSCIIYAHPISLLGILGILMVLMAVLLQAYCKLRKASLKKKLNQAEV

cccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccCCcHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcccccccccccHHEcccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

*TRSITTVVATLAALSIGFTYLFNKLVTSLEDSYHEAWLFRIVLNLLGYATIVLPGYILYRYVYTRHDFADAGCIGYVITACFKDN******************VKQDALLLLFCTAGLQGSYLTWGVLQEKIMTQTYTNIMLEEGKFRDSQFLVFVNRILALVVSGLSLLIINQPRHTVPLYKYGFCSFTNIMSSWCQYEALKYISFPAQVLAKSCKILAVMFMGKLVSAKPKSYEYFEYISALYISFPAQVLAKSCKILAVMFMGKLVSAKPKSYEYFEYISALVISLGMLLFMLSSLDTS**VGKTTTLSGVILLALYLSCDSFTSNWQGVLFESYKVTSLQMMFGTNLFSCLFTAVSLLQQGGFYQSLHFMLQFPSFTLDCILLSISSAAGQLFVFFTIYKFGAIVFTIIMTVRQGLAILLSCIIYAHPISLLGILGILMVLMAVLLQAYCKLRK************

xxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Adenosine 3'-phospho 5'-phosphosulfate transporter 1	Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. Required for the dorsoventral patterning, suggesting that it mediates the transport of the sulfate donor required for the sulfotransferase activity of pip (pipe).	confident	Q9VEI3
Adenosine 3'-phospho 5'-phosphosulfate transporter 1	Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi.	confident	Q91ZN5
Adenosine 3'-phospho 5'-phosphosulfate transporter 1	Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. May indirectly participate in activation of the NF-kappa-B and MAPK pathways.	confident	Q8TB61

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031301 [CC]	integral to organelle membrane	probable	GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044464, GO:0044422, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0031300, GO:0044424, GO:0044425, GO:0043227, GO:0043226, GO:0031224
GO:1901264 [BP]	carbohydrate derivative transport	probable	GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0000139 [CC]	Golgi membrane	probable	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:1901505 [MF]	carbohydrate derivative transporter activity	probable	GO:0005215, GO:0003674
GO:0006862 [BP]	nucleotide transport	probable	GO:0015931, GO:0015748, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015215 [MF]	nucleotide transmembrane transporter activity	probable	GO:0022891, GO:0015932, GO:0022892, GO:0005215, GO:1901677, GO:0022857, GO:0003674
GO:0008514 [MF]	organic anion transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 390-455
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 256-298
View the alignment between query and template
View the model in PyMOL