Query         psy14414
Match_columns 76
No_of_seqs    14 out of 16
Neff          2.0 
Searched_HMMs 46136
Date          Fri Aug 16 19:14:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14414.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14414hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2132|consensus               97.7 2.2E-05 4.7E-10   62.9   3.1   59   16-74    281-354 (355)
  2 PF08200 Phage_1_1:  Bacterioph  80.5    0.54 1.2E-05   28.7   0.0   11   45-55      1-11  (45)
  3 PHA00453 hypothetical protein   74.4     1.1 2.4E-05   27.0   0.2   15   45-59      1-15  (41)
  4 TIGR00013 taut 4-oxalocrotonat  67.5     5.9 0.00013   22.2   2.2   26   36-61     12-37  (63)
  5 COG5404 SulA SOS-response cell  59.3      11 0.00024   28.2   2.9   40   36-75     68-114 (169)
  6 TIGR02740 TraF-like TraF-like   58.1      14  0.0003   27.3   3.3   28   45-73     83-110 (271)
  7 KOG0860|consensus               56.3     8.4 0.00018   27.0   1.8   12   42-53     42-54  (116)
  8 PTZ00397 macrophage migration   52.9      20 0.00043   22.8   3.0   28   34-61     10-37  (116)
  9 cd07921 PCA_45_Doxase_A_like S  52.1     8.4 0.00018   26.5   1.2   20   33-52     42-62  (106)
 10 PRK02220 4-oxalocrotonate taut  51.6      19 0.00041   20.1   2.4   26   36-61     12-37  (61)
 11 PF00725 3HCDH:  3-hydroxyacyl-  48.3      34 0.00074   20.5   3.4   30   42-71     52-82  (97)
 12 PF13728 TraF:  F plasmid trans  47.4      38 0.00083   24.3   4.0   49   22-71      3-62  (215)
 13 cd06154 YjgF_YER057c_UK114_lik  46.0      19 0.00042   22.9   2.1   25   38-62     43-67  (119)
 14 PF09734 Tau95:  RNA polymerase  45.3      16 0.00034   27.0   1.8   30   31-68      4-37  (310)
 15 cd07321 Extradiol_Dioxygenase_  45.2      13 0.00028   23.3   1.2   21   33-53     32-53  (77)
 16 PF01361 Tautomerase:  Tautomer  45.0      26 0.00056   19.6   2.3   25   37-61     12-36  (60)
 17 PRK07217 replication factor A;  43.7      30 0.00065   27.5   3.3   24   50-74    252-275 (311)
 18 cd07924 PCA_45_Doxase_A The A   43.7      17 0.00036   25.7   1.7   20   33-52     50-70  (121)
 19 cd06155 eu_AANH_C_1 A group of  42.9      23  0.0005   22.0   2.1   41   20-60      7-47  (101)
 20 COG0285 FolC Folylpolyglutamat  42.4      31 0.00066   28.0   3.2   29   48-76     27-78  (427)
 21 PRK02289 4-oxalocrotonate taut  42.0      26 0.00057   20.1   2.1   26   36-61     12-37  (60)
 22 cd00448 YjgF_YER057c_UK114_fam  41.5      25 0.00054   20.7   2.0   25   37-61     30-54  (107)
 23 PF07746 LigA:  Aromatic-ring-o  41.1      18 0.00038   23.6   1.4   21   33-53     27-48  (88)
 24 PF03241 HpaB:  4-hydroxyphenyl  40.5     5.1 0.00011   28.7  -1.3   54    2-64    119-172 (205)
 25 cd07925 LigA_like_1 The A subu  39.7      21 0.00046   24.6   1.7   20   33-52     42-62  (106)
 26 PRK01271 4-oxalocrotonate taut  38.8      28 0.00062   21.9   2.0   27   36-62     13-39  (76)
 27 PF07179 SseB:  SseB protein N-  38.1      41 0.00088   20.2   2.6   27   48-74      1-28  (124)
 28 PF01042 Ribonuc_L-PSP:  Endori  38.0      24 0.00052   22.3   1.6   23   38-60     42-64  (121)
 29 PF09409 PUB:  PUB domain;  Int  38.0      38 0.00082   20.6   2.5   24   39-62      4-27  (87)
 30 PRK01964 4-oxalocrotonate taut  37.8      42 0.00091   19.1   2.5   27   35-61     11-37  (64)
 31 PF13621 Cupin_8:  Cupin-like d  37.6      18 0.00039   23.9   1.0   12   17-28    238-249 (251)
 32 PF13308 YARHG:  YARHG domain    37.2      10 0.00022   23.6  -0.2   21    8-28     40-60  (81)
 33 TIGR03610 RutC pyrimidine util  37.1      30 0.00065   22.7   2.0   40   21-60     26-71  (127)
 34 PF03271 EB1:  EB1-like C-termi  37.0      20 0.00044   20.6   1.1   25   43-67     11-35  (43)
 35 PF14850 Pro_dh-DNA_bdg:  DNA-b  36.4      23 0.00049   24.7   1.4   20   32-56      8-27  (114)
 36 cd02198 YjgH_like YjgH belongs  36.3      36 0.00078   21.3   2.2   24   38-61     32-55  (111)
 37 PF03195 DUF260:  Protein of un  35.2      33 0.00072   22.7   2.0   28   41-70     35-62  (101)
 38 PRK13703 conjugal pilus assemb  33.6 1.1E+02  0.0023   23.2   4.7   32   39-71     53-85  (248)
 39 KOG0859|consensus               33.5      30 0.00064   26.8   1.8   14   40-53    137-150 (217)
 40 cd00491 4Oxalocrotonate_Tautom  33.3      46   0.001   18.0   2.1   26   36-61     11-36  (58)
 41 cd06156 eu_AANH_C_2 A group of  33.2      37  0.0008   22.1   2.0   18   38-55     32-49  (118)
 42 COG4709 Predicted membrane pro  32.6      43 0.00093   25.4   2.5   27   49-75     43-69  (195)
 43 TIGR00004 endoribonuclease L-P  32.5      43 0.00093   21.2   2.1   24   38-61     47-70  (124)
 44 PF14164 YqzH:  YqzH-like prote  30.9      32 0.00069   22.0   1.3   11   47-57      5-15  (64)
 45 TIGR03384 betaine_BetI transcr  30.7 1.1E+02  0.0023   19.4   3.8   29   44-72    130-160 (189)
 46 PRK00745 4-oxalocrotonate taut  29.2      73  0.0016   17.7   2.5   24   36-59     12-35  (62)
 47 COG0815 Lnt Apolipoprotein N-a  28.7      29 0.00063   28.4   1.1   26   19-50    415-440 (518)
 48 smart00591 RWD domain in RING   27.7      92   0.002   18.3   2.9   29   31-59     61-91  (107)
 49 PF13167 GTP-bdg_N:  GTP-bindin  27.5      34 0.00073   22.5   1.0   19   31-53     62-80  (95)
 50 cd03308 CmuA_CmuC_like CmuA_Cm  27.1   1E+02  0.0022   23.5   3.7   27   44-70    187-213 (378)
 51 TIGR02792 PCA_ligA protocatech  27.1      28 0.00062   24.5   0.7   20   33-52     47-67  (117)
 52 PF03549 Tir_receptor_M:  Trans  26.6      28  0.0006   22.7   0.5   12    7-18     19-30  (66)
 53 COG1942 Uncharacterized protei  26.3      67  0.0015   20.0   2.2   26   36-61     13-38  (69)
 54 PRK13377 protocatechuate 4,5-d  26.0      31 0.00066   24.7   0.7   20   33-52     53-73  (129)
 55 cd06150 YjgF_YER057c_UK114_lik  25.9      66  0.0014   19.9   2.1   21   38-58     28-48  (105)
 56 cd07923 Gallate_dioxygenase_C   25.9      27 0.00059   23.5   0.4   20   33-52     34-54  (94)
 57 PRK13378 protocatechuate 4,5-d  24.7      34 0.00073   24.1   0.7   20   33-52     53-73  (117)
 58 PLN02433 uroporphyrinogen deca  24.4      83  0.0018   23.5   2.7   25   46-70    154-178 (345)
 59 cd06152 YjgF_YER057c_UK114_lik  24.1      78  0.0017   20.4   2.3   24   38-61     33-57  (114)
 60 PHA02696 hypothetical protein;  23.7      47   0.001   22.3   1.2   17   37-53     56-72  (79)
 61 PRK01005 V-type ATP synthase s  23.5 1.8E+02  0.0039   21.3   4.3   24   48-71     97-120 (207)
 62 PF06744 DUF1215:  Protein of u  23.1      65  0.0014   20.9   1.8   15   60-74     41-55  (125)
 63 PRK07218 replication factor A;  23.1      94   0.002   25.3   3.0   26   48-74    357-382 (423)
 64 PF10796 Anti-adapt_IraP:  Sigm  22.9      81  0.0018   20.9   2.2   25   37-61     41-65  (87)
 65 PF03730 Ku_C:  Ku70/Ku80 C-ter  22.6      21 0.00045   22.2  -0.6   11    7-17      8-18  (96)
 66 TIGR02739 TraF type-F conjugat  22.6   2E+02  0.0043   21.8   4.5   37   36-73     57-94  (256)
 67 KOG0414|consensus               22.5   1E+02  0.0022   29.1   3.4   38   38-75    615-653 (1251)
 68 PF13524 Glyco_trans_1_2:  Glyc  22.2 1.7E+02  0.0037   16.8   3.8   30   46-75     50-82  (92)
 69 PF15397 DUF4618:  Domain of un  22.2      84  0.0018   24.3   2.5   21   31-51    112-132 (258)
 70 PF14863 Alkyl_sulf_dimr:  Alky  22.1      92   0.002   21.5   2.4   47   23-71     43-98  (141)
 71 cd00580 CHMI 5-carboxymethyl-2  22.0      96  0.0021   19.7   2.4   27   35-61     70-96  (113)
 72 COG0251 TdcF Putative translat  21.9      78  0.0017   21.0   2.0   50   13-62     19-74  (130)
 73 PF08006 DUF1700:  Protein of u  21.9      82  0.0018   21.4   2.1   18   49-66     43-60  (181)
 74 PRK00423 tfb transcription ini  21.5 1.6E+02  0.0035   22.1   3.8   21   46-66    116-136 (310)
 75 PF05069 Phage_tail_S:  Phage v  21.3 1.7E+02  0.0036   19.3   3.5   25   45-69      3-27  (148)
 76 PRK13379 protocatechuate 4,5-d  21.0      44 0.00095   23.6   0.7   20   33-52     54-74  (119)
 77 COG4598 HisP ABC-type histidin  20.8   1E+02  0.0023   24.3   2.8   37   33-70    148-196 (256)
 78 TIGR01498 folK 2-amino-4-hydro  20.8   1E+02  0.0022   20.7   2.4   24   31-54     56-79  (127)
 79 PF08546 ApbA_C:  Ketopantoate   20.8 1.4E+02   0.003   18.5   2.8   19   58-76     74-92  (125)
 80 COG0319 Predicted metal-depend  20.6      45 0.00096   23.6   0.6   18   21-38     56-73  (153)
 81 cd01645 RT_Rtv RT_Rtv: Reverse  20.6      72  0.0016   22.1   1.7   21   33-53      6-26  (213)
 82 PF15460 SAS4:  Something about  20.6 1.2E+02  0.0025   20.4   2.6   25   43-69     20-44  (101)

No 1  
>KOG2132|consensus
Probab=97.75  E-value=2.2e-05  Score=62.91  Aligned_cols=59  Identities=25%  Similarity=0.195  Sum_probs=49.2

Q ss_pred             ccceeeeeecC-CCCC-c----------eecc-CCcchhhHHHHhHHHHH--HHHhcChhHHHHHHHHHHhccc
Q psy14414         16 KVSQVSWKPKT-KPTG-D----------IEYP-LKGHQKVAILRNIEKMV--AEALQNQEEVSHLMRALVLGRY   74 (76)
Q Consensus        16 ~~~sVnfwyk~-~P~p-~----------I~yP-L~~~QKVaImRNIEKML--~eAL~D~~EVg~Llr~lVlGRY   74 (76)
                      |+-.+.+|+.+ .+.| +          +++| |+.++|++++|+++.||  +|+|.+|.+..+++|++-.+++
T Consensus       281 k~i~l~~p~~s~~lyP~d~~~~~tsqvdvenPdlk~fp~~~k~~~l~~lL~pGe~L~iP~kwwhyvrs~d~s~s  354 (355)
T KOG2132|consen  281 KRIRLYPPEDSGALYPTDTYLLETSQVDVENPDLKAFPKFAKARFLDCLLEPGEALFIPPKWWHYVRSLDKSFS  354 (355)
T ss_pred             eEEEEecCcccCCCCCccchhhcccccccCCCChhhhhHHHHHHHHHHhcCCchhccccHHHhhhhhhcccccc
Confidence            34455667773 3334 5          8899 99999999999999999  9999999999999999987765


No 2  
>PF08200 Phage_1_1:  Bacteriophage 1.1 Protein ;  InterPro: IPR013232 Gene 1.1 in Bacteriophage T7 encodes a 42 amino acid protein, rich in basic amino acids suggesting its interaction with nucleic acids []. Many homologues are present in different T7 and T3-like bacteriophage.
Probab=80.52  E-value=0.54  Score=28.69  Aligned_cols=11  Identities=45%  Similarity=0.700  Sum_probs=9.3

Q ss_pred             HHhHHHHHHHH
Q psy14414         45 LRNIEKMVAEA   55 (76)
Q Consensus        45 mRNIEKML~eA   55 (76)
                      |||+|||--.+
T Consensus         1 MRNFEK~tkr~   11 (45)
T PF08200_consen    1 MRNFEKMTKRN   11 (45)
T ss_pred             CccHHhhhhcc
Confidence            89999998764


No 3  
>PHA00453 hypothetical protein
Probab=74.37  E-value=1.1  Score=26.95  Aligned_cols=15  Identities=40%  Similarity=0.592  Sum_probs=11.4

Q ss_pred             HHhHHHHHHHHhcCh
Q psy14414         45 LRNIEKMVAEALQNQ   59 (76)
Q Consensus        45 mRNIEKML~eAL~D~   59 (76)
                      |||.|||-..+=...
T Consensus         1 MRNFEKmtrk~nr~~   15 (41)
T PHA00453          1 MRNFEKMTKRSNRNA   15 (41)
T ss_pred             CccHHHHHHHhhhhh
Confidence            899999987754433


No 4  
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=67.47  E-value=5.9  Score=22.22  Aligned_cols=26  Identities=23%  Similarity=0.314  Sum_probs=23.2

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ++..||-++.+.|=..|.+.||-|.+
T Consensus        12 rt~eqK~~l~~~it~~l~~~lg~~~~   37 (63)
T TIGR00013        12 RTDEQKRQLIEGVTEAMAETLGANLE   37 (63)
T ss_pred             CCHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            67899999999999999999987654


No 5  
>COG5404 SulA SOS-response cell division inhibitor, blocks FtsZ ring formation [Cell division and chromosome partitioning]
Probab=59.31  E-value=11  Score=28.19  Aligned_cols=40  Identities=33%  Similarity=0.461  Sum_probs=32.1

Q ss_pred             CCcchhhHH--HH----hHHH-HHHHHhcChhHHHHHHHHHHhcccC
Q psy14414         36 LKGHQKVAI--LR----NIEK-MVAEALQNQEEVSHLMRALVLGRYT   75 (76)
Q Consensus        36 L~~~QKVaI--mR----NIEK-ML~eAL~D~~EVg~Llr~lVlGRYt   75 (76)
                      |+++||.+=  +|    |+|| |+..++....-|....+++.+|||.
T Consensus        68 ltPqqkLsreWl~~sGLp~~kv~ql~q~~p~~tle~m~~ALrtGnys  114 (169)
T COG5404          68 LTPQQKLSREWLQASGLPLTKVMQLSQLSPCHTVESMVRALRTGNYS  114 (169)
T ss_pred             hCCHHHHHHHHHHHcCCCHHHHHHHhhcCcHHHHHHHHHHHHcCCce
Confidence            577888652  11    7888 5678999999999999999999994


No 6  
>TIGR02740 TraF-like TraF-like protein. This protein is related to the F-type conjugation system pilus assembly proteins TraF (TIGR02739)and TrbB (TIGR02738) both of which exhibit a thioredoxin fold. The protein represented by this model has the same length and architecture as TraF, but lacks the CXXC-motif found in TrbB and believed to be responsible for the disulfide isomerase activity of that protein.
Probab=58.10  E-value=14  Score=27.34  Aligned_cols=28  Identities=18%  Similarity=0.235  Sum_probs=20.7

Q ss_pred             HHhHHHHHHHHhcChhHHHHHHHHHHhcc
Q psy14414         45 LRNIEKMVAEALQNQEEVSHLMRALVLGR   73 (76)
Q Consensus        45 mRNIEKML~eAL~D~~EVg~Llr~lVlGR   73 (76)
                      -+|+++.+..|+-+|++ ....+-|.+-|
T Consensus        83 ~~~~~~~~~~Ai~~Pt~-env~~y~~lq~  110 (271)
T TIGR02740        83 RENLPELRDKAIDNPTP-ENVRAYLEAQR  110 (271)
T ss_pred             HHHHHHHHHHHHhCCCH-HHHHHHHHHHH
Confidence            38999999999999985 55555554433


No 7  
>KOG0860|consensus
Probab=56.30  E-value=8.4  Score=26.98  Aligned_cols=12  Identities=50%  Similarity=0.880  Sum_probs=9.9

Q ss_pred             hHHHH-hHHHHHH
Q psy14414         42 VAILR-NIEKMVA   53 (76)
Q Consensus        42 VaImR-NIEKML~   53 (76)
                      +.||| ||||.|.
T Consensus        42 v~IMr~NV~KVlE   54 (116)
T KOG0860|consen   42 VDIMRENVEKVLE   54 (116)
T ss_pred             HHHHHHhHHHHHH
Confidence            57887 8999985


No 8  
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional
Probab=52.93  E-value=20  Score=22.77  Aligned_cols=28  Identities=25%  Similarity=0.256  Sum_probs=25.2

Q ss_pred             ccCCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         34 YPLKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        34 yPL~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      -|++..|+-+++.-+-+.|+++||-|++
T Consensus        10 ~~~~~~~~~~~~~~~~~~l~~~lgkPe~   37 (116)
T PTZ00397         10 VNATDDQADAALSDIENAIADVLGKPLS   37 (116)
T ss_pred             CCCccccHHHHHHHHHHHHHHHhCCChH
Confidence            4667788999999999999999999987


No 9  
>cd07921 PCA_45_Doxase_A_like Subunit A of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and similar enzymes. This subfamily includes the A subunit of protocatechuate (PCA) 4,5-dioxygenase (LigAB) and two subfamilies of unknown function. The A subunit is the smaller, non-catalytic subunit of LigAB. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit.
Probab=52.08  E-value=8.4  Score=26.47  Aligned_cols=20  Identities=30%  Similarity=0.532  Sum_probs=16.4

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|+|+..||-||+ |+..+|+
T Consensus        42 ~~gLTeEe~~AV~~rD~~~Li   62 (106)
T cd07921          42 KFGLTEEQKQAVLDRDWLRLL   62 (106)
T ss_pred             HcCCCHHHHHHHHhCCHHHHH
Confidence            6999999999998 4666665


No 10 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=51.56  E-value=19  Score=20.09  Aligned_cols=26  Identities=15%  Similarity=0.212  Sum_probs=22.8

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ++..||-++.+-|=..|.+++|-|.+
T Consensus        12 rs~eqk~~l~~~it~~l~~~~~~p~~   37 (61)
T PRK02220         12 RTEEQLKALVKDVTAAVSKNTGAPAE   37 (61)
T ss_pred             CCHHHHHHHHHHHHHHHHHHhCcChh
Confidence            57899999999999999999997643


No 11 
>PF00725 3HCDH:  3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;  InterPro: IPR006108 3-hydroxyacyl-CoA dehydrogenase (1.1.1.35 from EC) (HCDH) [] is an enzyme involved in fatty acid metabolism, it catalyzes the reduction of 3-hydroxyacyl-CoA to 3-oxoacyl-CoA. Most eukaryotic cells have 2 fatty-acid beta-oxidation systems, one located in mitochondria and the other in peroxisomes. In peroxisomes 3-hydroxyacyl-CoA dehydrogenase forms, with enoyl-CoA hydratase (ECH) and 3,2-trans-enoyl-CoA isomerase (ECI) a multifunctional enzyme where the N-terminal domain bears the hydratase/isomerase activities and the C-terminal domain the dehydrogenase activity. There are two mitochondrial enzymes: one which is monofunctional and the other which is, like its peroxisomal counterpart, multifunctional. In Escherichia coli (gene fadB) and Pseudomonas fragi (gene faoA) HCDH is part of a multifunctional enzyme which also contains an ECH/ECI domain as well as a 3-hydroxybutyryl-CoA epimerase domain []. There are two major region of similarities in the sequences of proteins of the HCDH family, the first one located in the N-terminal, corresponds to the NAD-binding site, the second one is located in the centre of the sequence. This represents the C-terminal domain which is also found in lambda crystallin. Some proteins include two copies of this domain.; GO: 0003857 3-hydroxyacyl-CoA dehydrogenase activity, 0016491 oxidoreductase activity, 0006631 fatty acid metabolic process, 0055114 oxidation-reduction process; PDB: 3MOG_A 2WTB_A 3ADP_A 3ADO_A 1WDL_B 2D3T_B 1WDK_A 1WDM_B 3K6J_A 1ZCJ_A ....
Probab=48.27  E-value=34  Score=20.49  Aligned_cols=30  Identities=23%  Similarity=0.335  Sum_probs=23.6

Q ss_pred             hHHHHhHHHHHHHHhcCh-hHHHHHHHHHHh
Q psy14414         42 VAILRNIEKMVAEALQNQ-EEVSHLMRALVL   71 (76)
Q Consensus        42 VaImRNIEKML~eAL~D~-~EVg~Llr~lVl   71 (76)
                      ..++.+|-+-+.++++|+ .+..++++.|+.
T Consensus        52 l~~~~~~~~~~~~~~~~~~~~~~~~l~~mv~   82 (97)
T PF00725_consen   52 LDVVYHILEYLAAALGDRAFRPSPLLKEMVE   82 (97)
T ss_dssp             HHHHHHHHHHHHHHHCCGGGSS-HHHHHHHH
T ss_pred             chHHHHHHHHHHHhcCCCcCCchHHHHHHHH
Confidence            456778888899999999 556899998874


No 12 
>PF13728 TraF:  F plasmid transfer operon protein
Probab=47.39  E-value=38  Score=24.30  Aligned_cols=49  Identities=16%  Similarity=0.245  Sum_probs=30.1

Q ss_pred             eeecCCCCC-ce---ecc------CCcchhhH-HHHhHHHHHHHHhcChhHHHHHHHHHHh
Q psy14414         22 WKPKTKPTG-DI---EYP------LKGHQKVA-ILRNIEKMVAEALQNQEEVSHLMRALVL   71 (76)
Q Consensus        22 fwyk~~P~p-~I---~yP------L~~~QKVa-ImRNIEKML~eAL~D~~EVg~Llr~lVl   71 (76)
                      |||...|.+ +.   .-|      ....+.++ +=.|+|+.+..|+-+|+ .-...+-|.+
T Consensus         3 ~WY~~~~~~~~~~~~~~p~~p~~~~~~~~~~~~~~~~~~~~~~~Ai~~PT-~eNv~~y~~l   62 (215)
T PF13728_consen    3 FWYEEPPKPKEPEPKPKPAPPAQSPSATESMEWFRENLEEALDQAIDNPT-PENVRAYLRL   62 (215)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCChhhhHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHH
Confidence            788777665 11   111      22234444 55699999999999998 4445544443


No 13 
>cd06154 YjgF_YER057c_UK114_like_6 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=46.02  E-value=19  Score=22.91  Aligned_cols=25  Identities=36%  Similarity=0.250  Sum_probs=20.5

Q ss_pred             cchhhHHHHhHHHHHHHHhcChhHH
Q psy14414         38 GHQKVAILRNIEKMVAEALQNQEEV   62 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eAL~D~~EV   62 (76)
                      ..|=..+++||++.|.+|-++.+.|
T Consensus        43 ~~Q~~~~~~ni~~~L~~aG~~~~dV   67 (119)
T cd06154          43 YEQTRQCLEIIEAALAEAGASLEDV   67 (119)
T ss_pred             HHHHHHHHHHHHHHHHHcCCCHHHE
Confidence            3788899999999999987776543


No 14 
>PF09734 Tau95:  RNA polymerase III transcription factor (TF)IIIC subunit;  InterPro: IPR019136  Transcription factor IIIC (TFIIIC) is a multisubunit DNA binding factor that serves as a dynamic platform for assembly of pre-initiation complexes on class III genes. This entry represents subunit 5 (also known as the tau 95 subunit) which holds a key position in TFIIIC, exerting both upstream and downstream influence on the TFIIIC-DNA complex by rendering the complex more stable []. Once bound to tDNA-intragenic promoter elements, TFIIIC directs the assembly of TFIIIB on the DNA, which in turn recruits the RNA polymerase III (pol III) and activates multiple rounds of transcription. 
Probab=45.25  E-value=16  Score=27.00  Aligned_cols=30  Identities=33%  Similarity=0.653  Sum_probs=23.4

Q ss_pred             ceeccCCcchhhHHH----HhHHHHHHHHhcChhHHHHHHHH
Q psy14414         31 DIEYPLKGHQKVAIL----RNIEKMVAEALQNQEEVSHLMRA   68 (76)
Q Consensus        31 ~I~yPL~~~QKVaIm----RNIEKML~eAL~D~~EVg~Llr~   68 (76)
                      -||||.       +.    +|++||| ++||-...|...+..
T Consensus         4 ~VE~Pg-------~V~~~~~n~dkai-~tLGG~~~Is~~~~~   37 (310)
T PF09734_consen    4 AVEYPG-------IVSPTSKNVDKAI-ETLGGIEAISKALDS   37 (310)
T ss_pred             EEEcCc-------EecccCCCHHHHH-HHhCCHHHHHHHHcC
Confidence            378885       56    8999976 789999999887653


No 15 
>cd07321 Extradiol_Dioxygenase_3A_like Subunit A of Class III extradiol dioxygenases. Extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings.  There are two major groups of dioxygenases according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents subunit A of c
Probab=45.19  E-value=13  Score=23.27  Aligned_cols=21  Identities=33%  Similarity=0.596  Sum_probs=17.0

Q ss_pred             eccCCcchhhHHH-HhHHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMVA   53 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML~   53 (76)
                      +|+|+..||-||+ |.+++|+.
T Consensus        32 ~~~Lt~eE~~al~~rD~~~L~~   53 (77)
T cd07321          32 EYGLTPEEKAALLARDVGALYV   53 (77)
T ss_pred             HcCCCHHHHHHHHcCCHHHHHH
Confidence            6999999999987 56777653


No 16 
>PF01361 Tautomerase:  Tautomerase enzyme;  InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers. The enzyme is part of a plasmid-encoded pathway, which enables bacteria harbouring the plasmid to use various aromatic hydrocarbons as their sole sources of carbon and energy. The enzyme is a barrel-shaped hexamer, which can be viewed as a trimer of dimers. The hexamer contains a hydrophobic core formed by three beta-sheets and surrounded by three pairs of alpha-helices. Each 4-OT monomer of 62 amino acids has a relatively simple beta-alpha-beta fold as described by the structure of the enzyme from Pseudomonas putida []. The monomer begins with a conserved proline at the start of a beta-strand, followed by an alpha-helix and a 310 helix preceding a second parallel beta-strand, and ends with a beta-hairpin near the C terminus. The dimer results from antiparallel interactions between the beta-sheets and alpha-helices of the two monomers, forming a four-stranded beta-sheet with antiparallel alpha-helices on one side, creating two active sites, one at each end of the beta-sheet. Three dimers further associate to form a hexamer by the interactions of the strands of the C-terminal beta-hairpin loops with the edges of the four-stranded beta-sheets of neighbouring dimers, creating a series of cross-links that stabilise the hexamer Pro-1 of the mature protein functions as the general base while Arg-39 and an ordered water molecule each provide a hydrogen bond to the C-2 oxygen of substrate. Arg-39 plays an additional role in the binding of the C-1 carboxylate group. Arg-11 participates both in substrate binding and in catalysis. It interacts with the C-6 carboxylate group, thereby holding the substrate in place and drawing electron density to the C-5 position. The hydrophobic nature of the active site, which lowers the pKa of Pro-1 and provides a favourable environment for catalysis, is largely maintained by Phe-50. Because several Arg residues located near the active site are not conserved among all members of this family and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.; GO: 0016853 isomerase activity, 0006725 cellular aromatic compound metabolic process; PDB: 4OTA_H 4OTC_G 4OTB_J 2FM7_A 1BJP_B 1S0Y_K 3EJ9_E 3EJ7_K 3EJ3_I 3MB2_A ....
Probab=45.03  E-value=26  Score=19.59  Aligned_cols=25  Identities=28%  Similarity=0.276  Sum_probs=21.3

Q ss_pred             CcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         37 KGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        37 ~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      +..||-++.+-|=..+.++||-|.+
T Consensus        12 ~~e~K~~l~~~it~~~~~~lg~~~~   36 (60)
T PF01361_consen   12 TAEQKRELAEAITDAVVEVLGIPPE   36 (60)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHTS-GG
T ss_pred             CHHHHHHHHHHHHHHHHHHhCcCCC
Confidence            5789999999999999999998865


No 17 
>PRK07217 replication factor A; Reviewed
Probab=43.71  E-value=30  Score=27.48  Aligned_cols=24  Identities=33%  Similarity=0.570  Sum_probs=20.4

Q ss_pred             HHHHHHhcChhHHHHHHHHHHhccc
Q psy14414         50 KMVAEALQNQEEVSHLMRALVLGRY   74 (76)
Q Consensus        50 KML~eAL~D~~EVg~Llr~lVlGRY   74 (76)
                      .|-.+|| |++.|-..++..++|||
T Consensus       252 ~~a~dal-d~~vv~~~i~~~llGr~  275 (311)
T PRK07217        252 QMAMDAL-DTGVVLDELKEKLLGRY  275 (311)
T ss_pred             HHHHHhh-chhhHHHHHHHhhcCce
Confidence            4555777 88999999999999998


No 18 
>cd07924 PCA_45_Doxase_A The A subunit of Protocatechuate 4,5-dioxygenase (LigAB) is the smaller, non-catalytic subunit. The A subunit is the non-catalytic subunit of Protocatechuate (PCA) 4,5-dioxygenase (LigAB), which is composed of A and B subunits that form a tetramer. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which  play key roles in the degradation of aromatic compounds. As a member of the Class III extradiol dioxygenase family, LigAB uses a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.
Probab=43.68  E-value=17  Score=25.73  Aligned_cols=20  Identities=35%  Similarity=0.753  Sum_probs=16.3

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|||+..||-||. |+.-.||
T Consensus        50 ~~~Lteeqr~aV~~RD~~~li   70 (121)
T cd07924          50 KWPMTEEQKQAVLARDYNRML   70 (121)
T ss_pred             HcCCCHHHHHHHHHhhHHHHH
Confidence            6999999999986 5666665


No 19 
>cd06155 eu_AANH_C_1 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains. This CD contains the first of these domains. The YjgF-YER057c-UK114 protein family is a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=42.94  E-value=23  Score=22.00  Aligned_cols=41  Identities=7%  Similarity=-0.070  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCceeccCCcchhhHHHHhHHHHHHHHhcChh
Q psy14414         20 VSWKPKTKPTGDIEYPLKGHQKVAILRNIEKMVAEALQNQE   60 (76)
Q Consensus        20 Vnfwyk~~P~p~I~yPL~~~QKVaImRNIEKML~eAL~D~~   60 (76)
                      =+|+|-+|-++.-.-.=-..|=..+++||++.|.+|=.+.+
T Consensus         7 g~~v~vSG~~~~~~~~d~~~Q~~~v~~ni~~~L~~aG~~~~   47 (101)
T cd06155           7 GGLLWISNVTASESDETVEEQMESIFSKLREILQSNGLSLS   47 (101)
T ss_pred             CCEEEEecCCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCHH
Confidence            36777777665110001237999999999999999855443


No 20 
>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism]
Probab=42.38  E-value=31  Score=27.95  Aligned_cols=29  Identities=24%  Similarity=0.539  Sum_probs=22.8

Q ss_pred             HHHH--HHHHhcChh---------------HHHHHHHHHHh------cccCC
Q psy14414         48 IEKM--VAEALQNQE---------------EVSHLMRALVL------GRYTE   76 (76)
Q Consensus        48 IEKM--L~eAL~D~~---------------EVg~Llr~lVl------GRYte   76 (76)
                      +|+|  |.+.||+|+               -+..+|++|..      |+||+
T Consensus        27 L~Ri~~ll~~LGnP~~~~~vIhVaGTNGKGSt~afl~siL~~aG~~VG~yTS   78 (427)
T COG0285          27 LERISRLLERLGNPQKSPPVIHVAGTNGKGSTCAFLESILREAGYKVGVYTS   78 (427)
T ss_pred             hHHHHHHHHHcCCccccCCeEEEeCCCCchhHHHHHHHHHHHcCCCceEECC
Confidence            5666  899999994               46678888877      88885


No 21 
>PRK02289 4-oxalocrotonate tautomerase; Provisional
Probab=42.02  E-value=26  Score=20.08  Aligned_cols=26  Identities=23%  Similarity=0.323  Sum_probs=23.0

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ++..||-++++=|=+.+.+++|-|.+
T Consensus        12 rs~EqK~~L~~~it~a~~~~~~~p~~   37 (60)
T PRK02289         12 RSQEQKNALAREVTEVVSRIAKAPKE   37 (60)
T ss_pred             CCHHHHHHHHHHHHHHHHHHhCcCcc
Confidence            46789999999999999999998754


No 22 
>cd00448 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=41.49  E-value=25  Score=20.73  Aligned_cols=25  Identities=20%  Similarity=0.207  Sum_probs=20.1

Q ss_pred             CcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         37 KGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        37 ~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      -..|=..+++||++.|.++-++.+.
T Consensus        30 ~~~Q~~~~~~ni~~~L~~~g~~~~~   54 (107)
T cd00448          30 IEAQTRQALENLEAVLEAAGGSLDD   54 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCHHH
Confidence            3468889999999999999776443


No 23 
>PF07746 LigA:  Aromatic-ring-opening dioxygenase LigAB, LigA subunit;  InterPro: IPR011986  Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A (IPR004183 from INTERPRO) and B (IPR004183 from INTERPRO). LigAB is a protocatechuate 4,5-dioxygenase (1.13.11.8 from EC) that belongs to the extradiol class III enzyme family. The LigA subunit of this enzyme is multi-helical, containing a compact array of 6 short helices [].; PDB: 1BOU_A 1B4U_A.
Probab=41.05  E-value=18  Score=23.61  Aligned_cols=21  Identities=33%  Similarity=0.574  Sum_probs=14.9

Q ss_pred             eccCCcchhhHHH-HhHHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMVA   53 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML~   53 (76)
                      +|+|+..||-||. |.+.+|+.
T Consensus        27 ~~~Lt~eer~av~~rD~~~L~~   48 (88)
T PF07746_consen   27 EYGLTEEERQAVLDRDWLALIA   48 (88)
T ss_dssp             CCT--HHHHHHHHCT-HHHHHH
T ss_pred             HcCCCHHHHHHHHcCCHHHHHH
Confidence            6999999999998 67877763


No 24 
>PF03241 HpaB:  4-hydroxyphenylacetate 3-hydroxylase C terminal;  InterPro: IPR024719 This C-terminal domain is found in HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli []. The enzyme is NADH-dependent and uses FAD as the redox chromophore. This domain is also found in pyoverdin chromophore biosynthetic protein PvcC, which may play a role in one of the proposed hydroxylation steps of pyoverdine chromophore biosynthesis [] and in 4-hydroxybutyryl-CoA dehydratase (4-BUDH), a key enzyme in the metabolism of gamma-aminobutyrate [].; PDB: 3HWC_D 1U8V_D 2YYM_A 2YYI_A 2YYJ_A 2YYL_A 2YYG_A 2YYK_A.
Probab=40.48  E-value=5.1  Score=28.67  Aligned_cols=54  Identities=15%  Similarity=0.268  Sum_probs=33.7

Q ss_pred             CCCCCCCCCCccccccceeeeeecCCCCCceeccCCcchhhHHHHhHHHHHHHHhcChhHHHH
Q psy14414          2 SPNFKSDFENPDLQKVSQVSWKPKTKPTGDIEYPLKGHQKVAILRNIEKMVAEALQNQEEVSH   64 (76)
Q Consensus         2 ~~~~~~~~~~~~~~~~~sVnfwyk~~P~p~I~yPL~~~QKVaImRNIEKML~eAL~D~~EVg~   64 (76)
                      .|..+ ||+||++.+.-  .=.+++.+.      ..+.+|+.++|-++.+.+.++|--.++-.
T Consensus       119 ~Ps~~-Df~npe~~~~l--~kYl~g~~~------~~aeeR~rl~rLawDl~~s~fg~r~~~ye  172 (205)
T PF03241_consen  119 LPSEA-DFDNPEIGPYL--DKYLQGANG------VSAEERVRLFRLAWDLTGSEFGGRQELYE  172 (205)
T ss_dssp             ---HH-HHH-TTTHHHH--HHHT-BTTT------C-HHHHHHHHHHHHHHHTSHHHHHHHHHH
T ss_pred             CCCHH-HhCCcchhHHH--HHHhcccCC------CCHHHHHHHHHHHHHHhcCcchhhhHhhh
Confidence            46666 99999876543  222333323      24789999999999999988876655543


No 25 
>cd07925 LigA_like_1 The A subunit of Uncharacterized proteins with similarity to Protocatechuate 4,5-dioxygenase (LigAB). The proteins of unknown function in this subfamily are similar to the A subunit of the Protocatechuate (PCA) 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds.
Probab=39.71  E-value=21  Score=24.62  Aligned_cols=20  Identities=30%  Similarity=0.522  Sum_probs=16.0

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|||+..||-||. |+.-.||
T Consensus        42 ~~~Lteeqr~av~~RD~~~li   62 (106)
T cd07925          42 KFGLTPEQKQAVRNRDVLRML   62 (106)
T ss_pred             HcCCCHHHHHHHHHhhHHHHH
Confidence            6999999999997 5565555


No 26 
>PRK01271 4-oxalocrotonate tautomerase; Provisional
Probab=38.76  E-value=28  Score=21.92  Aligned_cols=27  Identities=22%  Similarity=0.404  Sum_probs=24.1

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcChhHH
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQEEV   62 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~~EV   62 (76)
                      ++..||-++.+-|=+.+.++||-+.++
T Consensus        13 ~s~EqK~~La~~iT~a~~~~lg~~~e~   39 (76)
T PRK01271         13 LDEEQKAALAADITDVIIRHLNSKDSS   39 (76)
T ss_pred             CCHHHHHHHHHHHHHHHHHHhCcCcce
Confidence            688999999999999999999977653


No 27 
>PF07179 SseB:  SseB protein N-terminal domain;  InterPro: IPR009839 This family consists of several SseB proteins, which appear to be found exclusively in Enterobacteria. SseB is known to enhance serine-sensitivity in Escherichia coli [] and is part of the Salmonella pathogenicity island 2 (SPI-2) translocon [].
Probab=38.08  E-value=41  Score=20.23  Aligned_cols=27  Identities=19%  Similarity=0.332  Sum_probs=21.8

Q ss_pred             HHHHHHHHhcC-hhHHHHHHHHHHhccc
Q psy14414         48 IEKMVAEALQN-QEEVSHLMRALVLGRY   74 (76)
Q Consensus        48 IEKML~eAL~D-~~EVg~Llr~lVlGRY   74 (76)
                      +|+.|.++..+ +.....++++|..++|
T Consensus         1 Le~al~~~~~~~~~~~~~~~~~L~~a~~   28 (124)
T PF07179_consen    1 LEEALAAFAEETEEDEEAFLEALLKAEV   28 (124)
T ss_pred             CHHHHHHHHhCCHHHHHHHHHHHhhCeE
Confidence            47788888888 7888889999987765


No 28 
>PF01042 Ribonuc_L-PSP:  Endoribonuclease L-PSP;  InterPro: IPR006175  This domain is found in endoribonuclease, that is active on single-stranded mRNA and inhibits protein synthesis by cleavage of mRNA []. Previously it was thought to inhibit protein synthesis initiation []. This endoribonuclease may also be involved in the regulation of purine biosynthesis []. ; PDB: 3GTZ_B 3V4D_E 1J7H_A 3R0P_D 2IG8_A 1QD9_B 3L7Q_E 3VCZ_A 3QUW_A 2EWC_K ....
Probab=38.04  E-value=24  Score=22.30  Aligned_cols=23  Identities=30%  Similarity=0.345  Sum_probs=18.4

Q ss_pred             cchhhHHHHhHHHHHHHHhcChh
Q psy14414         38 GHQKVAILRNIEKMVAEALQNQE   60 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eAL~D~~   60 (76)
                      ..|=..+++||++.|.+|=.+.+
T Consensus        42 ~~Q~~~~l~ni~~~L~~~G~~~~   64 (121)
T PF01042_consen   42 EEQTRQALDNIERILAAAGASLD   64 (121)
T ss_dssp             HHHHHHHHHHHHHHHHHTTS-GG
T ss_pred             HHHHHHHHHhhhhhhhcCCCcce
Confidence            57889999999999998755543


No 29 
>PF09409 PUB:  PUB domain;  InterPro: IPR018997  The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain []. This domain is also found on other proteins linked to the ubiquitin-proteasome system. ; PDB: 2CM0_A 2CCQ_A 2D5U_A 2HPL_A 2HPJ_A.
Probab=37.98  E-value=38  Score=20.62  Aligned_cols=24  Identities=25%  Similarity=0.343  Sum_probs=19.7

Q ss_pred             chhhHHHHhHHHHHHHHhcChhHH
Q psy14414         39 HQKVAILRNIEKMVAEALQNQEEV   62 (76)
Q Consensus        39 ~QKVaImRNIEKML~eAL~D~~EV   62 (76)
                      .|+...++.++|+|.+.+.+|++-
T Consensus         4 ~~~~~al~~L~~il~NI~~~P~~~   27 (87)
T PF09409_consen    4 EAFQKALETLEKILSNILSNPNEE   27 (87)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSTT-C
T ss_pred             HHHHHHHHHHHHHHHHHccCCCcc
Confidence            467788899999999999999863


No 30 
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=37.83  E-value=42  Score=19.09  Aligned_cols=27  Identities=11%  Similarity=0.241  Sum_probs=23.2

Q ss_pred             cCCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         35 PLKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        35 PL~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ..+..||-++.+.|=+.|.+.||=|.+
T Consensus        11 grt~eqk~~l~~~it~~l~~~lg~p~~   37 (64)
T PRK01964         11 GRPEEKIKNLIREVTEAISATLDVPKE   37 (64)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHhCcChh
Confidence            357799999999999999999987654


No 31 
>PF13621 Cupin_8:  Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A ....
Probab=37.58  E-value=18  Score=23.92  Aligned_cols=12  Identities=17%  Similarity=-0.017  Sum_probs=8.5

Q ss_pred             cceeeeeecCCC
Q psy14414         17 VSQVSWKPKTKP   28 (76)
Q Consensus        17 ~~sVnfwyk~~P   28 (76)
                      --||||||+..+
T Consensus       238 sisvn~w~~~~~  249 (251)
T PF13621_consen  238 SISVNYWFRTPF  249 (251)
T ss_dssp             EEEEEEEEESS-
T ss_pred             EEEEEEEecccc
Confidence            348999998764


No 32 
>PF13308 YARHG:  YARHG domain
Probab=37.21  E-value=10  Score=23.63  Aligned_cols=21  Identities=24%  Similarity=0.059  Sum_probs=17.8

Q ss_pred             CCCCccccccceeeeeecCCC
Q psy14414          8 DFENPDLQKVSQVSWKPKTKP   28 (76)
Q Consensus         8 ~~~~~~~~~~~sVnfwyk~~P   28 (76)
                      .|.+++||..-+=.-||++.+
T Consensus        40 ~F~~~~l~~yF~~~~WY~~~~   60 (81)
T PF13308_consen   40 CFKSQDLQAYFSSKSWYKPEY   60 (81)
T ss_pred             CCCCHHHHHHHcCCCccCCCc
Confidence            588899998888777999888


No 33 
>TIGR03610 RutC pyrimidine utilization protein C. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the endoribonuclease L-PSP family defined by pfam01042.
Probab=37.15  E-value=30  Score=22.68  Aligned_cols=40  Identities=13%  Similarity=0.029  Sum_probs=27.0

Q ss_pred             eeeecCCCCC-c----eecc-CCcchhhHHHHhHHHHHHHHhcChh
Q psy14414         21 SWKPKTKPTG-D----IEYP-LKGHQKVAILRNIEKMVAEALQNQE   60 (76)
Q Consensus        21 nfwyk~~P~p-~----I~yP-L~~~QKVaImRNIEKML~eAL~D~~   60 (76)
                      ++=|-+|.++ +    +-.| =-..|=..+++||++.|.+|=++.+
T Consensus        26 ~~v~vSGq~~~d~~g~~~~~~d~~~Q~~~~l~ni~~iL~~aG~~~~   71 (127)
T TIGR03610        26 GVVYVSGTLPFDKDNNVVHVGDAAAQTRHVLETIKSVIETAGGTMD   71 (127)
T ss_pred             CEEEEeccCCcCCCCCeeCCCCHHHHHHHHHHHHHHHHHHcCCCHH
Confidence            6667666654 1    2122 2346999999999999999855443


No 34 
>PF03271 EB1:  EB1-like C-terminal motif;  InterPro: IPR004953 A group of microtubule-associated proteins called +TIPs (plus end tracking proteins), including EB1 (end-binding protein 1) family proteins, label growing microtubules ends specifically in diverse organisms and are implicated in spindle dynamics, chromosome segregation, and directing microtubules toward cortical sites. EB1 members have a bipartite composition: the N-terminal CH domain (IPR001715 from INTERPRO) mediates microtubule plus end localization and a C-terminal cargo binding domain (EB1-C) that captures cell polarity determinants. The EB1-C domain comprises a unique EB1-like sequence motif that acts as a binding site for other +TIP proteins. It interacts with the carboxy terminus of the adenomatous polyposis coli (APC) tumor suppressor, a well conserved +TIP phosphoprotein with a pivotal function in cell cycle regulation. Another binding partner of the EB1-C domain is the well conserved +TIP protein dynactin, a component of the large cytoplasmic dynein/dynactin complex [, , ]. The ~80-residue EB1-C domain starts with a long smoothly curved helix (alpha1), which is followed by a hairpin connection leading to a short second helix (alpha2) running antiparallel to alpha1. The two parallel alpha1 helices of the EB1-C domain dimer wrap around each other in a slightly left-handed supercoil. The two alpha2 helices run antiparallel to helices alpha1 and form a similar fork in the opposite orientation and rotated by 90 degrees. As a result, two helical segments from each monomer form a four-helix bundle. The side chain forming the hydrophobic core of this bundle are highly conserved [, , ]. Some protein known to contain an EB1-C domain are listed below:  Yeast protein BIM1. Fission yeast microtubule integrity protein mal3. Vertebrate microtubule-associated protein RP/EB family member 1 (EB1). Vertebrate microtubule-associated protein RP/EB family member 2 (EB2 or RP1). Vertebrate microtubule-associated protein RP/EB family member 3 (EBF3).  ; GO: 0008017 microtubule binding; PDB: 3TQ7_B 4E61_B 2HKQ_A 1YIG_B 3GJO_B 2HL5_B 1YIB_A 1WU9_A 1TXQ_B.
Probab=36.97  E-value=20  Score=20.59  Aligned_cols=25  Identities=32%  Similarity=0.485  Sum_probs=16.9

Q ss_pred             HHHHhHHHHHHHHhcChhHHHHHHH
Q psy14414         43 AILRNIEKMVAEALQNQEEVSHLMR   67 (76)
Q Consensus        43 aImRNIEKML~eAL~D~~EVg~Llr   67 (76)
                      +-+|+||-++.++-++.++..++..
T Consensus        11 ~KLR~IE~l~q~~~~~~~~~~~~~~   35 (43)
T PF03271_consen   11 NKLRDIEILCQEANESENEPKDLIK   35 (43)
T ss_dssp             HHHHHHHHHHHHHCHHCCTC--HHH
T ss_pred             HHHHHHHHHHhhccccCcchhHHHH
Confidence            4579999999998766655544443


No 35 
>PF14850 Pro_dh-DNA_bdg:  DNA-binding domain of Proline dehydrogenase; PDB: 2FZM_A 3E2Q_A 3E2S_A 2FZN_A 1K87_A 1TJ2_A 3ITG_B 3E2R_A 1TJ1_A 1TIW_A ....
Probab=36.44  E-value=23  Score=24.70  Aligned_cols=20  Identities=45%  Similarity=0.660  Sum_probs=14.7

Q ss_pred             eeccCCcchhhHHHHhHHHHHHHHh
Q psy14414         32 IEYPLKGHQKVAILRNIEKMVAEAL   56 (76)
Q Consensus        32 I~yPL~~~QKVaImRNIEKML~eAL   56 (76)
                      -||+|+.+-=|++|.     |+|||
T Consensus         8 ~EY~Lss~EGvaLMc-----LAEAL   27 (114)
T PF14850_consen    8 QEYSLSSQEGVALMC-----LAEAL   27 (114)
T ss_dssp             HCTT--HHHHHHHHH-----HHHHH
T ss_pred             HHcCCCcHHHHHHHH-----HHHHH
Confidence            379999999999997     56665


No 36 
>cd02198 YjgH_like YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=36.28  E-value=36  Score=21.33  Aligned_cols=24  Identities=13%  Similarity=0.077  Sum_probs=19.3

Q ss_pred             cchhhHHHHhHHHHHHHHhcChhH
Q psy14414         38 GHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ..|=..+++||++.|.+|=++.+.
T Consensus        32 ~~Q~~~~~~ni~~~L~~aG~~~~d   55 (111)
T cd02198          32 EAQFRLAFQNLGAVLEAAGCSFDD   55 (111)
T ss_pred             HHHHHHHHHHHHHHHHHcCCCHHH
Confidence            368888999999999998555543


No 37 
>PF03195 DUF260:  Protein of unknown function DUF260;  InterPro: IPR004883 The lateral organ boundaries (LOB) gene is expressed at the adaxial base of initiating lateral organs and encodes a plant-specific protein of unknown function. The N-terminal one half of the LOB protein contains a conserved approximately 100-amino acid domain (the LOB domain) that is present in 42 other Arabidopsis thaliana proteins and in proteins from a variety of other plant species. Genes encoding LOB domain (LBD) proteins are expressed in a variety of temporal- and tissue-specific patterns, suggesting that they may function in diverse processes [] The LOB domain contains conserved blocks of amino acids that identify the LBD gene family. In particular, a conserved C-x(2)-C-x(6)-C-x(3)-C motif, which is defining feature of the LOB domain, is present in all LBD proteins. It is possible that this motif forms a new zinc finger [].
Probab=35.17  E-value=33  Score=22.72  Aligned_cols=28  Identities=43%  Similarity=0.477  Sum_probs=20.7

Q ss_pred             hhHHHHhHHHHHHHHhcChhHHHHHHHHHH
Q psy14414         41 KVAILRNIEKMVAEALQNQEEVSHLMRALV   70 (76)
Q Consensus        41 KVaImRNIEKML~eAL~D~~EVg~Llr~lV   70 (76)
                      ||==..||-|||.++  +|++=....++|+
T Consensus        35 kvFG~sni~k~L~~~--~~~~R~~a~~Sl~   62 (101)
T PF03195_consen   35 KVFGVSNISKMLQEL--PPEQREDAMRSLV   62 (101)
T ss_pred             HHHchhHHHHHHHhC--CccchhhHHHHHH
Confidence            344468999999987  6776677777775


No 38 
>PRK13703 conjugal pilus assembly protein TraF; Provisional
Probab=33.58  E-value=1.1e+02  Score=23.23  Aligned_cols=32  Identities=19%  Similarity=0.304  Sum_probs=22.5

Q ss_pred             chhhHHH-HhHHHHHHHHhcChhHHHHHHHHHHh
Q psy14414         39 HQKVAIL-RNIEKMVAEALQNQEEVSHLMRALVL   71 (76)
Q Consensus        39 ~QKVaIm-RNIEKML~eAL~D~~EVg~Llr~lVl   71 (76)
                      -|+++.+ +|+++-+..|+-+|++ -...+-|.+
T Consensus        53 ~e~~~~l~~~~~~~~~~Ai~~Pt~-ENv~~y~~l   85 (248)
T PRK13703         53 MEKLAVLQTATKRALYEAILYPGV-ENFVKYFRL   85 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCH-HHHHHHHHH
Confidence            3666666 7999999999999965 444444443


No 39 
>KOG0859|consensus
Probab=33.51  E-value=30  Score=26.78  Aligned_cols=14  Identities=36%  Similarity=0.522  Sum_probs=11.4

Q ss_pred             hhhHHHHhHHHHHH
Q psy14414         40 QKVAILRNIEKMVA   53 (76)
Q Consensus        40 QKVaImRNIEKML~   53 (76)
                      =|=-+|+||||.|.
T Consensus       137 vk~vM~eNIekvld  150 (217)
T KOG0859|consen  137 VKGVMMENIEKVLD  150 (217)
T ss_pred             HHHHHHHHHHHHHh
Confidence            35668999999985


No 40 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=33.27  E-value=46  Score=18.04  Aligned_cols=26  Identities=23%  Similarity=0.328  Sum_probs=22.0

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      .+..||-++.+-|=..|.+.+|-|.+
T Consensus        11 rt~eqk~~l~~~i~~~l~~~~g~~~~   36 (58)
T cd00491          11 RTDEQKRELIERVTEAVSEILGAPEA   36 (58)
T ss_pred             CCHHHHHHHHHHHHHHHHHHhCcCcc
Confidence            45789999999999999999976654


No 41 
>cd06156 eu_AANH_C_2 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains. This CD contains the second of these domains. The YjgF-YER057c-UK114 protein family is a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=33.25  E-value=37  Score=22.08  Aligned_cols=18  Identities=22%  Similarity=0.300  Sum_probs=15.4

Q ss_pred             cchhhHHHHhHHHHHHHH
Q psy14414         38 GHQKVAILRNIEKMVAEA   55 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eA   55 (76)
                      ..|=..+|+||+..|.+|
T Consensus        32 ~~Q~~qal~Ni~~vL~~a   49 (118)
T cd06156          32 TLQAVLSLQHLERVAKAM   49 (118)
T ss_pred             HHHHHHHHHHHHHHHHHc
Confidence            358888999999999886


No 42 
>COG4709 Predicted membrane protein [Function unknown]
Probab=32.61  E-value=43  Score=25.44  Aligned_cols=27  Identities=15%  Similarity=0.099  Sum_probs=21.9

Q ss_pred             HHHHHHHhcChhHHHHHHHHHHhcccC
Q psy14414         49 EKMVAEALQNQEEVSHLMRALVLGRYT   75 (76)
Q Consensus        49 EKML~eAL~D~~EVg~Llr~lVlGRYt   75 (76)
                      |--++..||||.|+..=.++=+.+|+-
T Consensus        43 E~EI~~~LG~P~eiA~ei~s~~~~k~~   69 (195)
T COG4709          43 EEEIAKDLGDPKEIAAEILSERGIKKE   69 (195)
T ss_pred             HHHHHHHhCCHHHHHHHHHHHccchHH
Confidence            566788999999999888887776653


No 43 
>TIGR00004 endoribonuclease L-PSP, putative. This protein was described initially as an inhibitor of protein synthesis intiation but is now viewed as an endoribonuclease active on single-stranded mRNA. The cleavage of mRNA is responsible for the inhibition of protein synthesis. A role in purine regulation has also been suggested.
Probab=32.51  E-value=43  Score=21.16  Aligned_cols=24  Identities=17%  Similarity=0.299  Sum_probs=19.8

Q ss_pred             cchhhHHHHhHHHHHHHHhcChhH
Q psy14414         38 GHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ..|=..+++||++.|.+|-++.+.
T Consensus        47 ~~Q~~~~~~ni~~~L~~aG~~~~d   70 (124)
T TIGR00004        47 AEQAEQVLENLKAILEAAGLSLDD   70 (124)
T ss_pred             HHHHHHHHHHHHHHHHHcCCCHHH
Confidence            368899999999999998766554


No 44 
>PF14164 YqzH:  YqzH-like protein
Probab=30.90  E-value=32  Score=21.97  Aligned_cols=11  Identities=45%  Similarity=0.646  Sum_probs=9.7

Q ss_pred             hHHHHHHHHhc
Q psy14414         47 NIEKMVAEALQ   57 (76)
Q Consensus        47 NIEKML~eAL~   57 (76)
                      =||||+..+|+
T Consensus         5 ~I~Kmi~~~l~   15 (64)
T PF14164_consen    5 LIEKMIINCLR   15 (64)
T ss_pred             HHHHHHHHHHH
Confidence            38999999997


No 45 
>TIGR03384 betaine_BetI transcriptional repressor BetI. BetI is a DNA-binding transcriptional repressor of the bet (betaine) regulon. In sequence, it is related to TetR (pfam00440). Choline, through BetI, induces the expression of the betaine biosynthesis genes betA and betB by derepression. The choline porter gene betT is also part of this regulon in Escherichia coli. Note that a different transcriptional regulator, ArcA, controls the expression of bet regulon genes in response to oxygen, as BetA is an oxygen-dependent enzyme.
Probab=30.68  E-value=1.1e+02  Score=19.37  Aligned_cols=29  Identities=21%  Similarity=0.288  Sum_probs=21.7

Q ss_pred             HHHhHHHHHHHHhc--ChhHHHHHHHHHHhc
Q psy14414         44 ILRNIEKMVAEALQ--NQEEVSHLMRALVLG   72 (76)
Q Consensus        44 ImRNIEKML~eAL~--D~~EVg~Llr~lVlG   72 (76)
                      +..++++.+.+.+.  |+..+..++.+++.|
T Consensus       130 ~~~~l~~~l~~~~~~~~~~~~a~~~~~~~~G  160 (189)
T TIGR03384       130 LHSNLMSELRQLLPREQAERAAEGLAALIDG  160 (189)
T ss_pred             HHHHHHHHHHhhcCcchHHHHHHHHHHHHHH
Confidence            44577777776654  788899888888877


No 46 
>PRK00745 4-oxalocrotonate tautomerase; Provisional
Probab=29.24  E-value=73  Score=17.69  Aligned_cols=24  Identities=21%  Similarity=0.250  Sum_probs=21.3

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcCh
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQ   59 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~   59 (76)
                      .+..||-++.+-|=..|.+.||=|
T Consensus        12 rs~eqk~~l~~~it~~l~~~~~~p   35 (62)
T PRK00745         12 RTVEQKRKLVEEITRVTVETLGCP   35 (62)
T ss_pred             CCHHHHHHHHHHHHHHHHHHcCCC
Confidence            578899999999999999999933


No 47 
>COG0815 Lnt Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane]
Probab=28.75  E-value=29  Score=28.41  Aligned_cols=26  Identities=15%  Similarity=-0.139  Sum_probs=19.5

Q ss_pred             eeeeeecCCCCCceeccCCcchhhHHHHhHHH
Q psy14414         19 QVSWKPKTKPTGDIEYPLKGHQKVAILRNIEK   50 (76)
Q Consensus        19 sVnfwyk~~P~p~I~yPL~~~QKVaImRNIEK   50 (76)
                      |=+=||..+..|      .-|..+|.||+||-
T Consensus       415 SNDAWf~~s~~p------~QH~~~a~~RAiE~  440 (518)
T COG0815         415 SNDAWFGGSWGP------YQHFQQARVRAVEL  440 (518)
T ss_pred             ccccccCCCcch------HHHHHHHHHHHHhc
Confidence            445688887776      35788999999993


No 48 
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain.
Probab=27.70  E-value=92  Score=18.31  Aligned_cols=29  Identities=21%  Similarity=0.358  Sum_probs=21.4

Q ss_pred             ceecc--CCcchhhHHHHhHHHHHHHHhcCh
Q psy14414         31 DIEYP--LKGHQKVAILRNIEKMVAEALQNQ   59 (76)
Q Consensus        31 ~I~yP--L~~~QKVaImRNIEKML~eAL~D~   59 (76)
                      .++-+  |...|+-.+.+.+.+++.+-+|.+
T Consensus        61 ~~~~~~~l~~~~~~~l~~~l~~~~~e~~g~~   91 (107)
T smart00591       61 SLLNSEGLSDEQLAELLKKLEEIAEENLGEV   91 (107)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHhCCCE
Confidence            44444  777888888888888888877664


No 49 
>PF13167 GTP-bdg_N:  GTP-binding GTPase N-terminal
Probab=27.52  E-value=34  Score=22.52  Aligned_cols=19  Identities=32%  Similarity=0.387  Sum_probs=15.5

Q ss_pred             ceeccCCcchhhHHHHhHHHHHH
Q psy14414         31 DIEYPLKGHQKVAILRNIEKMVA   53 (76)
Q Consensus        31 ~I~yPL~~~QKVaImRNIEKML~   53 (76)
                      .+-.+|++.|    .||+||.++
T Consensus        62 vfd~~Lsp~Q----~rNLe~~~~   80 (95)
T PF13167_consen   62 VFDNELSPSQ----QRNLEKALG   80 (95)
T ss_pred             EECCCCCHHH----HHHHHHHHC
Confidence            4567999999    499999875


No 50 
>cd03308 CmuA_CmuC_like CmuA_CmuC_like: uncharacterized protein family similar to uroporphyrinogen decarboxylase (URO-D) and the methyltransferases CmuA and CmuC.
Probab=27.14  E-value=1e+02  Score=23.53  Aligned_cols=27  Identities=19%  Similarity=0.289  Sum_probs=25.0

Q ss_pred             HHHhHHHHHHHHhcChhHHHHHHHHHH
Q psy14414         44 ILRNIEKMVAEALQNQEEVSHLMRALV   70 (76)
Q Consensus        44 ImRNIEKML~eAL~D~~EVg~Llr~lV   70 (76)
                      .+|.+|+++.....+|++|-.||..+.
T Consensus       187 ~l~g~~~~~~~l~~~Pe~v~~ll~~~t  213 (378)
T cd03308         187 YLRGFKGISIDLRRRPEKVAEACEAVT  213 (378)
T ss_pred             HHhCHHHHHHHHHHCHHHHHHHHHHHH
Confidence            789999999999999999999998765


No 51 
>TIGR02792 PCA_ligA protocatechuate 4,5-dioxygenase, alpha subunit. Protocatechuate (PCA) 4,5-dioxygenase is the first enzyme in the PCA 4,5-cleavage pathway that is an alternative to PCA 3,4-cleavage and PCA 2,3 cleavage pathways. PCA is an intermediate in the breakdown of lignin (hence the gene symbol ligA) and other compounds. Members of this family are the alpha chain of PCA 4,5-dioxygenase, or the equivalent domain of a fusion protein.
Probab=27.13  E-value=28  Score=24.49  Aligned_cols=20  Identities=35%  Similarity=0.581  Sum_probs=15.6

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|||+..||-+|. |+.=.||
T Consensus        47 ~~~Lt~eqk~av~~RD~~~li   67 (117)
T TIGR02792        47 EWNLTPAQKQAVLARDLNACI   67 (117)
T ss_pred             HcCCCHHHHHHHHhhhHHHHH
Confidence            6999999999997 4555554


No 52 
>PF03549 Tir_receptor_M:  Translocated intimin receptor (Tir) intimin-binding domain;  InterPro: IPR003536 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior. There have been four secretion systems described in animal enteropathogens, such as Salmonella and Yersinia, with further sequence similarities in plant pathogens like Ralstonia and Erwinia []. The type III secretion system is of great interest, as it is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host. The protein subunits of the system are very similar to those of bacterial flagellar biosynthesis. However, while the latter forms a ring structure to allow secretion of flagellin and is an integral part of the flagellum itself [], type III subunits in the outer membrane translocate secreted proteins through a channel-like structure. Exotoxins secreted by the type III system do not possess a secretion signal, and are considered unique for this reason []. Enteropathogenic and entero- haemorrhagic Escherichia coli secrete the bacterial adhesion mediation molecule intimin [], which targets the translocated intimin receptor, Tir. Tir is secreted by the bacteria and is embedded in the target cell's plasma membrane []. This facilitates bacterial cell attachment to the host. ; GO: 0005515 protein binding; PDB: 2ZWK_F 2ZQK_D 1F02_T.
Probab=26.63  E-value=28  Score=22.67  Aligned_cols=12  Identities=58%  Similarity=0.886  Sum_probs=9.9

Q ss_pred             CCCCCccccccc
Q psy14414          7 SDFENPDLQKVS   18 (76)
Q Consensus         7 ~~~~~~~~~~~~   18 (76)
                      .-|.|||-|||.
T Consensus        19 eafqnp~nqkvn   30 (66)
T PF03549_consen   19 EAFQNPDNQKVN   30 (66)
T ss_dssp             HHCTSGGGEEEE
T ss_pred             HHhcCcccceec
Confidence            458999999975


No 53 
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only]
Probab=26.25  E-value=67  Score=20.02  Aligned_cols=26  Identities=19%  Similarity=0.341  Sum_probs=22.5

Q ss_pred             CCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         36 LKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        36 L~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ++.+||-+|-.-|=.++.+.||-+.+
T Consensus        13 ~~~~~K~~la~~vT~~~~~~lg~~~~   38 (69)
T COG1942          13 LDEEQKAELAAEVTEVTVETLGKDPS   38 (69)
T ss_pred             CCHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            56788999999999999999997654


No 54 
>PRK13377 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=25.99  E-value=31  Score=24.72  Aligned_cols=20  Identities=35%  Similarity=0.786  Sum_probs=15.7

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|||+..||-||. |+.=.||
T Consensus        53 e~~Lteeqr~aV~~RD~~~li   73 (129)
T PRK13377         53 EWPMTEEQKQAVLARDLNRCI   73 (129)
T ss_pred             HcCCCHHHHHHHHhhhHHHHH
Confidence            6999999999986 5555554


No 55 
>cd06150 YjgF_YER057c_UK114_like_2 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=25.89  E-value=66  Score=19.92  Aligned_cols=21  Identities=29%  Similarity=0.362  Sum_probs=17.2

Q ss_pred             cchhhHHHHhHHHHHHHHhcC
Q psy14414         38 GHQKVAILRNIEKMVAEALQN   58 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eAL~D   58 (76)
                      ..|=-.+++||++.|.++=.+
T Consensus        28 ~~Q~~~~~~nl~~~L~~~G~~   48 (105)
T cd06150          28 TGQTRQVLAKIDALLAEAGSD   48 (105)
T ss_pred             HHHHHHHHHHHHHHHHHcCCC
Confidence            478889999999999987433


No 56 
>cd07923 Gallate_dioxygenase_C The C-terminal domain of Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of the PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. This model represents the C-terminal domain, which is similar to the A subunit of PCA 4,5-dioxygenase (or LigAB). The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. Since enzymes in this subfamily have fused A and B subunits, the dimer interface may resemble the tetramer interface of classical LigAB enzymes. This enzyme belongs to the class III extradiol dioxygenase family, composed of enzymes whi
Probab=25.88  E-value=27  Score=23.49  Aligned_cols=20  Identities=20%  Similarity=0.215  Sum_probs=15.5

Q ss_pred             eccCCcchhhHHHH-hHHHHH
Q psy14414         33 EYPLKGHQKVAILR-NIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaImR-NIEKML   52 (76)
                      +|+|+..||-+|++ ++=+|+
T Consensus        34 e~gLt~Ee~~av~~rD~~~li   54 (94)
T cd07923          34 EAGLTEEERTLIRNRDWIGMI   54 (94)
T ss_pred             HcCCCHHHHHHHHcchHHHHH
Confidence            69999999999984 554444


No 57 
>PRK13378 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=24.69  E-value=34  Score=24.10  Aligned_cols=20  Identities=35%  Similarity=0.556  Sum_probs=15.3

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|||+..||-+|. |+.=.||
T Consensus        53 ~~~Lteeqk~aV~~RD~~~mi   73 (117)
T PRK13378         53 KYGLNEEQKEAIRNRDVLQLL   73 (117)
T ss_pred             HcCCCHHHHHHHHhhhHHHHH
Confidence            6999999999997 4444444


No 58 
>PLN02433 uroporphyrinogen decarboxylase
Probab=24.42  E-value=83  Score=23.52  Aligned_cols=25  Identities=20%  Similarity=0.271  Sum_probs=20.2

Q ss_pred             HhHHHHHHHHhcChhHHHHHHHHHH
Q psy14414         46 RNIEKMVAEALQNQEEVSHLMRALV   70 (76)
Q Consensus        46 RNIEKML~eAL~D~~EVg~Llr~lV   70 (76)
                      |++|+++.....||+.|..+|..+.
T Consensus       154 ~~~~~~~~~l~~~Pe~v~~ll~~it  178 (345)
T PLN02433        154 KNYKVIKKMAFTAPEVLHALLDKLT  178 (345)
T ss_pred             ccHHHHHHHHHhCHHHHHHHHHHHH
Confidence            3488888888889999998887664


No 59 
>cd06152 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=24.08  E-value=78  Score=20.42  Aligned_cols=24  Identities=17%  Similarity=0.122  Sum_probs=19.1

Q ss_pred             cchhhHHHHhHHHHHHHHh-cChhH
Q psy14414         38 GHQKVAILRNIEKMVAEAL-QNQEE   61 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eAL-~D~~E   61 (76)
                      ..|=-.+++||++.|.+|= .+.+.
T Consensus        33 ~~Q~~~~~~Nl~~~L~~aG~~~~~d   57 (114)
T cd06152          33 EEEIDQAFDNVELALKAAGGKGWEQ   57 (114)
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCHHH
Confidence            4788899999999999885 45443


No 60 
>PHA02696 hypothetical protein; Provisional
Probab=23.68  E-value=47  Score=22.26  Aligned_cols=17  Identities=47%  Similarity=0.767  Sum_probs=14.0

Q ss_pred             CcchhhHHHHhHHHHHH
Q psy14414         37 KGHQKVAILRNIEKMVA   53 (76)
Q Consensus        37 ~~~QKVaImRNIEKML~   53 (76)
                      -++|-||+|||+-+..+
T Consensus        56 DgkQvVaLlR~vsrvva   72 (79)
T PHA02696         56 DGKQVVALLRAVSRVVA   72 (79)
T ss_pred             cHHHHHHHHHHhHHHhc
Confidence            47899999999977654


No 61 
>PRK01005 V-type ATP synthase subunit E; Provisional
Probab=23.49  E-value=1.8e+02  Score=21.26  Aligned_cols=24  Identities=25%  Similarity=0.405  Sum_probs=21.6

Q ss_pred             HHHHHHHHhcChhHHHHHHHHHHh
Q psy14414         48 IEKMVAEALQNQEEVSHLMRALVL   71 (76)
Q Consensus        48 IEKML~eAL~D~~EVg~Llr~lVl   71 (76)
                      ++++|.++|.||+=+..|+..+|.
T Consensus        97 ~~~lv~~~~~d~~~l~~lI~~~v~  120 (207)
T PRK01005         97 LGEWLEHVLTDPEVSAKLIQALVQ  120 (207)
T ss_pred             HHHHHHHHhcCHHHHHHHHHHHHH
Confidence            789999999999999999988875


No 62 
>PF06744 DUF1215:  Protein of unknown function (DUF1215);  InterPro: IPR010623 This domain represents a conserved region situated towards the C-terminal end of several hypothetical bacterial proteins of unknown function. A few members resemble the ImcF protein, which has been proposed [] to be involved in Vibrio cholerae cell surface reorganisation that results in increased adherence to epithelial cells line and increased conjugation frequency.
Probab=23.12  E-value=65  Score=20.92  Aligned_cols=15  Identities=40%  Similarity=0.654  Sum_probs=14.0

Q ss_pred             hHHHHHHHHHHhccc
Q psy14414         60 EEVSHLMRALVLGRY   74 (76)
Q Consensus        60 ~EVg~Llr~lVlGRY   74 (76)
                      .||.+..+..+.|||
T Consensus        41 ~~V~~~~~~~i~gRY   55 (125)
T PF06744_consen   41 AEVYPFCRQAIAGRY   55 (125)
T ss_pred             HHHHHHHHHHhcCCC
Confidence            579999999999999


No 63 
>PRK07218 replication factor A; Provisional
Probab=23.07  E-value=94  Score=25.25  Aligned_cols=26  Identities=27%  Similarity=0.484  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcChhHHHHHHHHHHhccc
Q psy14414         48 IEKMVAEALQNQEEVSHLMRALVLGRY   74 (76)
Q Consensus        48 IEKML~eAL~D~~EVg~Llr~lVlGRY   74 (76)
                      +.+|..+|| |.+.|-..++..++|||
T Consensus       357 a~~~~~~~~-d~~~v~~~i~~~llG~~  382 (423)
T PRK07218        357 AEELAREAM-DKDVVAEDIRERLVGRE  382 (423)
T ss_pred             HHHHHHhhh-cchhhHHHHHHhhcCcE
Confidence            346777776 77888889999999998


No 64 
>PF10796 Anti-adapt_IraP:  Sigma-S stabilisation anti-adaptor protein ;  InterPro: IPR019732  This entry is conserved in Enterobacteriaceae. It is one of a series of proteins, expressed by these bacteria in response to stress, that help to regulate Sigma-S, the stationary phase sigma factor of Escherichia coli and Salmonella. IraP is essential for Sigma-S stabilisation in some but not all starvation conditions []. ; GO: 0005737 cytoplasm
Probab=22.87  E-value=81  Score=20.86  Aligned_cols=25  Identities=16%  Similarity=0.306  Sum_probs=21.1

Q ss_pred             CcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         37 KGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        37 ~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ...|.-+|..|||+-+..|+.+.++
T Consensus        41 ~~~~~~~~i~~I~~Ai~~a~~~~~~   65 (87)
T PF10796_consen   41 DQGGRQEMIESIEKAIEDASPSSDV   65 (87)
T ss_pred             CcchHHHHHHHHHHHHHHhcccCCc
Confidence            5677888999999999999987654


No 65 
>PF03730 Ku_C:  Ku70/Ku80 C-terminal arm;  InterPro: IPR005160 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway. This is the C-terminal arm. This alpha helical region embraces the beta-barrel domain IPR006164 from INTERPRO of the opposite subunit [].; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0006303 double-strand break repair via nonhomologous end joining; PDB: 1JEY_B 1JEQ_B 1RW2_A 3RZ9_B 3RZX_B.
Probab=22.64  E-value=21  Score=22.23  Aligned_cols=11  Identities=45%  Similarity=0.812  Sum_probs=7.2

Q ss_pred             CCCCCcccccc
Q psy14414          7 SDFENPDLQKV   17 (76)
Q Consensus         7 ~~~~~~~~~~~   17 (76)
                      +.|+||-||+.
T Consensus         8 ~~~~NP~LQ~h   18 (96)
T PF03730_consen    8 DKFPNPSLQRH   18 (96)
T ss_dssp             CCS--HHHHHH
T ss_pred             CCcCCchHHHH
Confidence            57999999974


No 66 
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm. Unlike the related protein TrbB (TIGR02738), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. Even more closely related than TrbB is a clade of genes (TIGR02740) which do contain the CXXC motif, but it is unclear whether these genes are involved in type-F conjugation systems per se.
Probab=22.64  E-value=2e+02  Score=21.81  Aligned_cols=37  Identities=19%  Similarity=0.355  Sum_probs=26.1

Q ss_pred             CCcchhhHHH-HhHHHHHHHHhcChhHHHHHHHHHHhcc
Q psy14414         36 LKGHQKVAIL-RNIEKMVAEALQNQEEVSHLMRALVLGR   73 (76)
Q Consensus        36 L~~~QKVaIm-RNIEKML~eAL~D~~EVg~Llr~lVlGR   73 (76)
                      +++-|+++.+ +|+++.+..|+-+|++ ....+-|.+-|
T Consensus        57 ~~~~~~~~~l~~~~~~~~~~Ai~~Pt~-ENv~~y~~lq~   94 (256)
T TIGR02739        57 LSPTEQMKLLRQETKEALNQAILNPSV-ENFARYMRLQR   94 (256)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHhCCCH-HHHHHHHHHHH
Confidence            4555666655 5899999999999984 55555555433


No 67 
>KOG0414|consensus
Probab=22.47  E-value=1e+02  Score=29.10  Aligned_cols=38  Identities=18%  Similarity=0.384  Sum_probs=34.1

Q ss_pred             cchhhHHHHhHHHHHHHH-hcChhHHHHHHHHHHhcccC
Q psy14414         38 GHQKVAILRNIEKMVAEA-LQNQEEVSHLMRALVLGRYT   75 (76)
Q Consensus        38 ~~QKVaImRNIEKML~eA-L~D~~EVg~Llr~lVlGRYt   75 (76)
                      .|-+.+|-+|.=|.+.+| .||-.-+-.+|..+|.+||-
T Consensus       615 ~~e~~~ia~NL~~l~~~~s~~d~~slE~vl~~lv~~~~I  653 (1251)
T KOG0414|consen  615 ASEASSIAQNLSKLLIDASIGDLTSLEEVLCELVARGYI  653 (1251)
T ss_pred             hhHHHHHHHHHHHHHhcccccchhhHHHHHHHHHhCCCc
Confidence            345588999999999999 99999999999999999984


No 68 
>PF13524 Glyco_trans_1_2:  Glycosyl transferases group 1
Probab=22.24  E-value=1.7e+02  Score=16.80  Aligned_cols=30  Identities=30%  Similarity=0.385  Sum_probs=20.5

Q ss_pred             HhHHHHHHHHhcChhH---HHHHHHHHHhcccC
Q psy14414         46 RNIEKMVAEALQNQEE---VSHLMRALVLGRYT   75 (76)
Q Consensus        46 RNIEKML~eAL~D~~E---Vg~Llr~lVlGRYt   75 (76)
                      ..+...+...|.||++   ++.-.+..|+-+||
T Consensus        50 ~el~~~i~~ll~~~~~~~~ia~~a~~~v~~~~t   82 (92)
T PF13524_consen   50 EELAEKIEYLLENPEERRRIAKNARERVLKRHT   82 (92)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHhCC
Confidence            4566677888899987   44555666766665


No 69 
>PF15397 DUF4618:  Domain of unknown function (DUF4618)
Probab=22.21  E-value=84  Score=24.32  Aligned_cols=21  Identities=33%  Similarity=0.702  Sum_probs=18.3

Q ss_pred             ceeccCCcchhhHHHHhHHHH
Q psy14414         31 DIEYPLKGHQKVAILRNIEKM   51 (76)
Q Consensus        31 ~I~yPL~~~QKVaImRNIEKM   51 (76)
                      +=+||+++-|=..++|||+..
T Consensus       112 D~EYPvK~vqIa~L~rqlq~l  132 (258)
T PF15397_consen  112 DHEYPVKAVQIANLVRQLQQL  132 (258)
T ss_pred             hhhhhHHHHHHHHHHHHHHHH
Confidence            458999999999999999864


No 70 
>PF14863 Alkyl_sulf_dimr:  Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A.
Probab=22.10  E-value=92  Score=21.52  Aligned_cols=47  Identities=21%  Similarity=0.361  Sum_probs=21.8

Q ss_pred             eecCCCCCceeccCCcchh----hHHHHhHHHHHHHH---h--cChhHHHHHHHHHHh
Q psy14414         23 KPKTKPTGDIEYPLKGHQK----VAILRNIEKMVAEA---L--QNQEEVSHLMRALVL   71 (76)
Q Consensus        23 wyk~~P~p~I~yPL~~~QK----VaImRNIEKML~eA---L--~D~~EVg~Llr~lVl   71 (76)
                      ||-|-|+ .+ +||.+.++    |+.|--.+++|..|   +  ||...+..|+..++.
T Consensus        43 WfDgnP~-~L-~pl~p~~~A~~~v~l~GG~d~vl~~A~~~~~~gd~~wA~~L~d~l~~   98 (141)
T PF14863_consen   43 WFDGNPA-NL-NPLPPEEEAKRYVELAGGADKVLERAQAALAAGDYQWAAELLDHLVF   98 (141)
T ss_dssp             S--S-GG-GT-S---HHHHHHHHHHHTTCHHHHHHHHHHHHHCT-HHHHHHHHHHHHH
T ss_pred             ccCCCcc-cc-CCCChHHHHHHHHHHcCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            8999998 47 88887765    44443444444332   2  455555555555543


No 71 
>cd00580 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate. This is one step in the homoprotocatechuate pathway, one of the microbial meta-fission pathways that degrade aromatic carbon sources to citric acid cycle intermediates.  Despite the structural similarity of CHMI with 4-oxalocrotonate tautomerase (4-OT) and macrophage migration inhibitory factor (MIF), there is no significant sequence similarity among these protein families, and therefore, they are not combined in one hierarchy.
Probab=21.95  E-value=96  Score=19.69  Aligned_cols=27  Identities=11%  Similarity=-0.023  Sum_probs=23.4

Q ss_pred             cCCcchhhHHHHhHHHHHHHHhcChhH
Q psy14414         35 PLKGHQKVAILRNIEKMVAEALQNQEE   61 (76)
Q Consensus        35 PL~~~QKVaImRNIEKML~eAL~D~~E   61 (76)
                      ..+..||-++.+.|-..|.+.|+.+-+
T Consensus        70 GRs~eqK~~l~~~i~~~l~~~~~~~~~   96 (113)
T cd00580          70 GRSEEQKQELSEALLAALRAHLAPVFA   96 (113)
T ss_pred             CCCHHHHHHHHHHHHHHHHHhhhhhhh
Confidence            467789999999999999999988744


No 72 
>COG0251 TdcF Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis]
Probab=21.88  E-value=78  Score=20.98  Aligned_cols=50  Identities=18%  Similarity=0.004  Sum_probs=34.1

Q ss_pred             cccccceeeeeecCCCCC-c----eecc-CCcchhhHHHHhHHHHHHHHhcChhHH
Q psy14414         13 DLQKVSQVSWKPKTKPTG-D----IEYP-LKGHQKVAILRNIEKMVAEALQNQEEV   62 (76)
Q Consensus        13 ~~~~~~sVnfwyk~~P~p-~----I~yP-L~~~QKVaImRNIEKML~eAL~D~~EV   62 (76)
                      --|-+..-+|=|-+|..| +    +.-+ =-..|=...+.||+..|.+|..+.+.|
T Consensus        19 yS~av~~~~~vfvSGQi~~~~~g~~v~~~d~~~Q~~~~l~ni~a~L~~aG~~~~~V   74 (130)
T COG0251          19 YSQAVVAGGLVFVSGQIPLDPTGELVGGEDIEAQTRQALANIKAVLEAAGSTLDDV   74 (130)
T ss_pred             ccceEEECCEEEEeCcCCcCCCCcccCCCCHHHHHHHHHHHHHHHHHHcCCCHHHE
Confidence            334455566778888776 1    2122 234677889999999999999876654


No 73 
>PF08006 DUF1700:  Protein of unknown function (DUF1700);  InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT).
Probab=21.88  E-value=82  Score=21.36  Aligned_cols=18  Identities=17%  Similarity=0.337  Sum_probs=12.6

Q ss_pred             HHHHHHHhcChhHHHHHH
Q psy14414         49 EKMVAEALQNQEEVSHLM   66 (76)
Q Consensus        49 EKML~eAL~D~~EVg~Ll   66 (76)
                      |.-+.+.||||+|+..=+
T Consensus        43 Eeeii~~LG~P~~iA~~i   60 (181)
T PF08006_consen   43 EEEIIAELGSPKEIAREI   60 (181)
T ss_pred             HHHHHHHcCCHHHHHHHH
Confidence            455667899999876533


No 74 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=21.51  E-value=1.6e+02  Score=22.09  Aligned_cols=21  Identities=19%  Similarity=0.284  Sum_probs=14.1

Q ss_pred             HhHHHHHHHHhcChhHHHHHH
Q psy14414         46 RNIEKMVAEALQNQEEVSHLM   66 (76)
Q Consensus        46 RNIEKML~eAL~D~~EVg~Ll   66 (76)
                      .+-|+.|..|+..-.+++..|
T Consensus       116 ~~~er~l~~a~~~I~~~~~~L  136 (310)
T PRK00423        116 NAAERNLAFALSELDRIASQL  136 (310)
T ss_pred             ChHhHHHHHHHHHHHHHHHHc
Confidence            355888888886655555543


No 75 
>PF05069 Phage_tail_S:  Phage virion morphogenesis family ;  InterPro: IPR006522 This entry represents a number of known and suspected phage virion morphogenesis proteins. The S protein from phage P2 is thought to act in tail completion and stable head joining [].
Probab=21.32  E-value=1.7e+02  Score=19.26  Aligned_cols=25  Identities=12%  Similarity=0.351  Sum_probs=18.8

Q ss_pred             HHhHHHHHHHHhcChhHHHHHHHHH
Q psy14414         45 LRNIEKMVAEALQNQEEVSHLMRAL   69 (76)
Q Consensus        45 mRNIEKML~eAL~D~~EVg~Llr~l   69 (76)
                      +..|+++|..+...+.+..+|++.+
T Consensus         3 ~~~l~~~L~~L~~~~~~~~~l~~~i   27 (148)
T PF05069_consen    3 LEQLQRALERLAAQPKDRRPLLRKI   27 (148)
T ss_pred             HHHHHHHHHHHHhChHhHHHHHHHH
Confidence            3567888888777788887777765


No 76 
>PRK13379 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=21.00  E-value=44  Score=23.63  Aligned_cols=20  Identities=30%  Similarity=0.257  Sum_probs=15.3

Q ss_pred             eccCCcchhhHHH-HhHHHHH
Q psy14414         33 EYPLKGHQKVAIL-RNIEKMV   52 (76)
Q Consensus        33 ~yPL~~~QKVaIm-RNIEKML   52 (76)
                      +|||+..||-+|. |+.=.||
T Consensus        54 ~~~Lt~eqk~aV~~RDw~~mi   74 (119)
T PRK13379         54 EAGLTEQEKELIRARDWLGLV   74 (119)
T ss_pred             HcCCCHHHHHHHHhccHHHHH
Confidence            6999999999987 4554444


No 77 
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=20.82  E-value=1e+02  Score=24.34  Aligned_cols=37  Identities=35%  Similarity=0.579  Sum_probs=24.5

Q ss_pred             eccCC----cchhhHHHHhH----HHHHH----HHhcChhHHHHHHHHHH
Q psy14414         33 EYPLK----GHQKVAILRNI----EKMVA----EALQNQEEVSHLMRALV   70 (76)
Q Consensus        33 ~yPL~----~~QKVaImRNI----EKML~----eAL~D~~EVg~Llr~lV   70 (76)
                      .||-.    -||++||-|-+    +-||-    .|| ||+-||..|+-|.
T Consensus       148 ~YP~~LSGGQQQR~aIARaLameP~vmLFDEPTSAL-DPElVgEVLkv~~  196 (256)
T COG4598         148 AYPAHLSGGQQQRVAIARALAMEPEVMLFDEPTSAL-DPELVGEVLKVMQ  196 (256)
T ss_pred             cCccccCchHHHHHHHHHHHhcCCceEeecCCcccC-CHHHHHHHHHHHH
Confidence            57743    47999998864    22332    233 8999999887663


No 78 
>TIGR01498 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase. This model describes the folate biosynthesis enzyme 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase. Alternate names include 6-hydroxymethyl-7,8-dihydropterin diphosphokinase and 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (HPPK). The extreme C-terminal region, of typically eight to thirty residues, is not included in the model. This enzyme may be found as a fusion protein with other enzymes of folate biosynthesis.
Probab=20.77  E-value=1e+02  Score=20.65  Aligned_cols=24  Identities=25%  Similarity=0.416  Sum_probs=20.2

Q ss_pred             ceeccCCcchhhHHHHhHHHHHHH
Q psy14414         31 DIEYPLKGHQKVAILRNIEKMVAE   54 (76)
Q Consensus        31 ~I~yPL~~~QKVaImRNIEKML~e   54 (76)
                      .++--|++++=.+++++||+-++.
T Consensus        56 ~~~T~l~p~~Ll~~l~~IE~~~GR   79 (127)
T TIGR01498        56 EVETTLAPRELLALLQAIEAELGR   79 (127)
T ss_pred             EEEeCCCHHHHHHHHHHHHHHhCC
Confidence            366678999999999999998774


No 79 
>PF08546 ApbA_C:  Ketopantoate reductase PanE/ApbA C terminal;  InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1.1.1.169 from EC. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) = 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway []. ApbA and PanE are allelic []. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway []. ; GO: 0016491 oxidoreductase activity, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 1YJQ_A 1KS9_A 2OFP_A 1YON_A 2EW2_B 3EGO_B 3HN2_D 3GHY_B 3G17_E 3HWR_B ....
Probab=20.76  E-value=1.4e+02  Score=18.50  Aligned_cols=19  Identities=26%  Similarity=0.434  Sum_probs=12.3

Q ss_pred             ChhHHHHHHHHHHhcccCC
Q psy14414         58 NQEEVSHLMRALVLGRYTE   76 (76)
Q Consensus        58 D~~EVg~Llr~lVlGRYte   76 (76)
                      .+.....+++++..||.||
T Consensus        74 ~~~~~~SM~~D~~~gr~tE   92 (125)
T PF08546_consen   74 TPDNRSSMLQDIEAGRPTE   92 (125)
T ss_dssp             TTTT--HHHHHHHTTB--S
T ss_pred             cCCccccHHHHHHHccccc
Confidence            4556888999999999886


No 80 
>COG0319 Predicted metal-dependent hydrolase [General function prediction only]
Probab=20.63  E-value=45  Score=23.61  Aligned_cols=18  Identities=28%  Similarity=0.645  Sum_probs=13.1

Q ss_pred             eeeecCCCCCceeccCCc
Q psy14414         21 SWKPKTKPTGDIEYPLKG   38 (76)
Q Consensus        21 nfwyk~~P~p~I~yPL~~   38 (76)
                      .|+-|-+||.+|+||+-.
T Consensus        56 ~yR~kD~pTDVLSFp~~e   73 (153)
T COG0319          56 EYRGKDKPTDVLSFPYNE   73 (153)
T ss_pred             HHcCCCCCCceEEecCCC
Confidence            355666777799999874


No 81 
>cd01645 RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from retroviruses (Rtvs). RTs catalyze the conversion of single-stranded RNA into double-stranded viral DNA for integration into host chromosomes. Proteins in this subfamily contain long terminal repeats (LTRs) and are multifunctional enzymes with RNA-directed DNA polymerase, DNA directed DNA polymerase, and ribonuclease hybrid (RNase H) activities. The viral RNA genome enters the cytoplasm as part of a nucleoprotein complex, and the process of reverse transcription generates in the cytoplasm forming a linear DNA duplex via an intricate series of steps. This duplex DNA is colinear with its RNA template, but contains terminal duplications known as LTRs that are not present in viral RNA. It has been proposed that two specialized template switches, known as strand-transfer reactions or "jumps", are required to generate the LTRs.
Probab=20.60  E-value=72  Score=22.06  Aligned_cols=21  Identities=14%  Similarity=0.327  Sum_probs=19.2

Q ss_pred             eccCCcchhhHHHHhHHHHHH
Q psy14414         33 EYPLKGHQKVAILRNIEKMVA   53 (76)
Q Consensus        33 ~yPL~~~QKVaImRNIEKML~   53 (76)
                      .||++..|+-++-+=|+++|.
T Consensus         6 ~~p~~~~~~~~~~~~i~~ll~   26 (213)
T cd01645           6 QWPLTEEKLEALTELVTEQLK   26 (213)
T ss_pred             ccCCCHHHHHHHHHHHHHHHH
Confidence            599999999999999999885


No 82 
>PF15460 SAS4:  Something about silencing, SAS, complex subunit 4
Probab=20.58  E-value=1.2e+02  Score=20.40  Aligned_cols=25  Identities=32%  Similarity=0.515  Sum_probs=15.5

Q ss_pred             HHHHhHHHHHHHHhcChhHHHHHHHHH
Q psy14414         43 AILRNIEKMVAEALQNQEEVSHLMRAL   69 (76)
Q Consensus        43 aImRNIEKML~eAL~D~~EVg~Llr~l   69 (76)
                      .-|||+||.  .|+.....+..+|..|
T Consensus        20 krm~n~ek~--r~~~E~d~L~~lle~L   44 (101)
T PF15460_consen   20 KRMRNIEKE--RAQHEKDRLQRLLEKL   44 (101)
T ss_pred             HHHHHHHHH--HHHHHHHHHHHHHHHH
Confidence            369999984  4555555555555443


Done!