Diaphorina citri psyllid: psy14414


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MSPNFKSDFENPDLQKVSQVSWKPKTKPTGDIEYPLKGHQKVAILRNIEKMVAEALQNQEEVSHLMRALVLGRYTE
ccccccccccccccccEEEEEEECcccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccc
******S**ENPDLQKVSQVSWKPKTKPTGDIEYPLKGHQKVAILRNIEKMVAEALQNQEEVSHLMRALVLGRY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPNFKSDFENPDLQKVSQVSWKPKTKPTGDIEYPLKGHQKVAILRNIEKMVAEALQNQEEVSHLMRALVLGRYTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hypoxia-inducible factor 1-alpha inhibitor Hydroxylates HIF-1 alpha at 'Asp-799' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation (By similarity). Positively regulates ASB4 activity, promoting vascular differentiation.confidentQ8BLR9
Hypoxia-inducible factor 1-alpha inhibitor Hydroxylates a specific Asn residue in the C-terminal transactivation domain (CAD) of HIF-1 alpha. The hydroxylation prevents interaction of HIF-1 with transcriptional coactivators. Also hydroxylates specific Asn, Asp and His residues within ankyrin repeat domain-containing proteins.confidentP59723
Hypoxia-inducible factor 1-alpha inhibitor Hydroxylates HIF-1 alpha at 'Asp-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation.confidentQ9NWT6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0045663 [BP]positive regulation of myoblast differentiationprobableGO:0048634, GO:0051147, GO:0051149, GO:0050789, GO:0060284, GO:0065007, GO:0048518, GO:0045661, GO:1901861, GO:0016202, GO:0050793, GO:0048742, GO:0050794, GO:0045597, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0048641, GO:0051094, GO:2000026, GO:0048522
GO:0061428 [BP]negative regulation of transcription from RNA polymerase II promoter in response to hypoxiaprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0070887, GO:0001666, GO:0061418, GO:0050789, GO:0044699, GO:0097201, GO:0051716, GO:0010605, GO:0019222, GO:0000122, GO:2000112, GO:2000113, GO:0043618, GO:0008150, GO:0019219, GO:0071453, GO:0010556, GO:0065007, GO:0071456, GO:0048519, GO:0043620, GO:0010468, GO:0045934, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0042221, GO:0070482, GO:0009628, GO:0036293, GO:0051253, GO:0051252, GO:0036294, GO:0010558, GO:0006355, GO:0006357, GO:0033554, GO:0044763, GO:0050896, GO:0048523
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042264 [BP]peptidyl-aspartic acid hydroxylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0018197, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0018126
GO:0031406 [MF]carboxylic acid bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0043167
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045746 [BP]negative regulation of Notch signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0048037 [MF]cofactor bindingprobableGO:0003674, GO:0005488
GO:0036139 [MF]peptidyl-histidine dioxygenase activityprobableGO:0051213, GO:0016706, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0036138 [BP]peptidyl-histidine hydroxylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0018202, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0043170, GO:0018126

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D8C, chain A
Confidence level:very confident
Coverage over the Query: 18-75
View the alignment between query and template
View the model in PyMOL