Diaphorina citri psyllid: psy14426


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MRLILIDIDSLNKEIIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRVDVAVS
cEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccCEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEc
MRLILIDIDSLNKEIIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRVDVAVS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLILIDIDSLNKEIIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRVDVAVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tribbles homolog 3 Disrupts insulin signaling by binding directly to Akt kinases and blocking their activation. May bind directly to and mask the 'Thr-308' phosphorylation site in AKT1. Binds to ATF4 and inhibits its transcriptional activation activity. Interacts with the NF-kappa-B transactivator p65 RELA and inhibits its phosphorylation and thus its transcriptional activation activity. Interacts with MAPK kinases and regulates activation of MAP kinases. May play a role in programmed neuronal cell death but does not appear to affect non-neuronal cells. Does not display kinase activity.confidentQ8K4K2
Tribbles homolog 1 Interacts with MAPK kinases and regulates activation of MAP kinases. May not display kinase activity.confidentQ96RU8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032436 [BP]positive regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031665 [BP]negative regulation of lipopolysaccharide-mediated signaling pathwayprobableGO:0009968, GO:0050794, GO:0009966, GO:0048583, GO:0048585, GO:0002831, GO:0031664, GO:0002832, GO:0008150, GO:0023057, GO:0043900, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0010243 [BP]response to organic nitrogenprobableGO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050321 [MF]tau-protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043405 [BP]regulation of MAP kinase activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0023051, GO:0071900, GO:0010627, GO:0050789, GO:0043408, GO:0010646, GO:0009966, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051338, GO:0001932
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031434 [MF]mitogen-activated protein kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0004679 [MF]AMP-activated protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0014912 [BP]negative regulation of smooth muscle cell migrationprobableGO:0030336, GO:0040013, GO:0030334, GO:0014910, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0007254 [BP]JNK cascadeprobableGO:0065007, GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0051403, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004860 [MF]protein kinase inhibitor activityprobableGO:0019210, GO:0019207, GO:0019887, GO:0030234, GO:0003674, GO:0004857
GO:0005816 [CC]spindle pole bodyprobableGO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0042149 [BP]cellular response to glucose starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0055106 [MF]ubiquitin-protein ligase regulator activityprobableGO:0055103, GO:0003674, GO:0030234
GO:0048662 [BP]negative regulation of smooth muscle cell proliferationprobableGO:0042127, GO:0008285, GO:0048660, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZMD, chain A
Confidence level:very confident
Coverage over the Query: 3-117
View the alignment between query and template
View the model in PyMOL