Diaphorina citri psyllid: psy14431

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------122

MCFLHLHGFQVDNAIPNGGQANGELKDLLERERREMSQLEERQRQLSEQYEAVSARETALRDEMGQLEKNLTILRHDLKESQRRADNESETKKKAEVNLQVISDMHEKLKTEAETATRLRKQSAELTVAKSAGEQMVVELQNILATLEMERDTLQQEVATLQAKISQERSSKTQAVNLHKELEGRLQALNTELERNKHRELQLAEDNRHLGEKVSSLEKECRLQALNTELERNKHRELQLAEDNRHLGEKVSSLEKECASLSLELKAAQAQYQQEVRAHEETQKSRMVNKEEASVEIVKELKDLMAKHRSDLSSKESLLSNGKEREVDYKKSIDQLMKDREDLQQQINLLKEGAELRQELEKSKTLQSQVEQEQAKKFSLQSDLSVQTSEAAHLKAREEQLSHEVAMLREAKRNIEEEYHKLKTKRSVEDLQMKELQDQLETEQYFSTLYKTQAHELKEELDERSRNILELEEERGDLTHRLQLAVARADSEALARSIAEETVGELEKEKTMKELELKDLMAKHRSDLSSKESLLSNGKEREVDYKKSIDQLMKDREDLQQQINLLKEGKGAYGIVYKAYDKNNKQYVAIKKIFEAFRNKTDAQRTYREILFLKSFQRHPNIITMLDIYKAVNNKDLYVVFEYMENDLNKVIRDKILKDVHIRYIMFQLCNGLSYIHACKVMHRDLKPSNILIDKSCSIKIGDLGLARSLSDSKECLTEYIATRWYRAPEILISNRRYTHHVDIWSLGCILAEMLQSKPLFPGASTSHQLQLIVNLVRPNPPHADKFYAGFKSKHEREKFNQVVVKCQKELQELQSQVVEENTSKLKLQMELDSKDSEIEQLQGKLAALGSETASLSSADVENDESYVQDSRLEGWVSIPNKQNIKRHGWKKQYVVVSSKKIIFYNSENDKQNTDPELELKDLMAKHRSDLSSKESLLSNGKEREVDYKKSIDQLMKDREDLQQQINLLKEELRKSSNSSEEMEKLHKQLKQEQLLKAQAVNKLAEIMNRKDINTTCKGKSKASSADVRKKEKECRKLQQELTQEREKFNQVVVKCQKELQELQSQVVEENTSKLKLQMELDSKDSEIEQLQGKLAALGSETASLSSADVENDESYVQDEVRSRSVTQGDVIRADAKDIPRIFQLLYAGEGEARRPEDGGAELPAVLRGGDEKPGIIALKGHEFLNISYHMPTTCEVCPKPIWHIIRPPPALECGTVLT

cccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHcccccEEEEEEEEEcccccEEEEEccHHHHccHHHHHHHHHHHHHHHHHcccccccEEcccccccccccEEEEEcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHccccccHHHHHHHHccccccccHHHHccccccHHHHHHHHHHHccccccHHHHHHcHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccccHHEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*CFLHLHGFQVDN******************************************************EKNLTILRHDL**********************VISD*******************************MVVELQNILATLE*********************************************************************************************************LEKECASLSLELKAAQ***********************************************************YKKSIDQLMKDRED***********************************************************************************************DQLETEQYFSTLYKTQAHEL********************LTHRLQLAVAR*********************************************************KKSIDQLMKDREDLQQQINLLKEGKGAYGIVYKAYDKNNKQYVAIKKIFEAFRNKTDAQRTYREILFLKSFQRHPNIITMLDIYKAVNNKDLYVVFEYMENDLNKVIRDKILKDVHIRYIMFQLCNGLSYIHACKVMHRDLKPSNILIDKSCSIKIGDLGLARSLSDSKECLTEYIATRWYRAPEILISNRRYTHHVDIWSLGCILAEMLQSKPLFPGASTSHQLQLIVNLVRPNPPHADKFYAGFKSKHEREKFNQVVVKCQKELQELQSQVVEENTSKLKLQMELDSKDSEIEQLQGKLAALGSETASLSSADVENDESYVQDSRLEGWVSIPNKQNIKRHGWKKQYVVVSSKKIIFYN****************************************************************************************LLKAQAVNKL*******************************************KFNQVVVKCQKELQ*******************************************************************GDVIRADAKDIPRIFQLLYAG**********************EKPGIIALKGHEFLNISYHMPTTCEVCPKPIWHIIRPPPALECGTVLT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MCFLHLHGFQVDNAIPNGGQAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAETATRLRKQSAELTVAKSAGEQMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELQLAEDNRHLGEKVSSLEKECRLQALNTELERNKHRELQLAEDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRMVNKEEASVEIVKELKDLMAKHRSDLSSKESLLSNGKERxxxxxxxxxxxxxxxxxxxxxxxxxxxxAExxxxxxxxxxxxxxxxxxxxxKFSLQSDLSVQTSExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRSVEDLQMKELQDQLETEQYFSTLYKTQxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQLAVARADSEALARSIAEETxxxxxxxxxxxxxxxxxxxxxHRSDLSSKESLLSNGKERxxxxxxxxxxxxxxxxxxxxxxxxxxxxKGAYGIVYKAYDKNNKQYVAIKKIFEAFRNKTDAQRTYREILFLKSFQRHPNIITMLDIYKAVNNKDLYVVFEYMENDLNKVIRDKILKDVHIRYIMFQLCNGLSYIHACKVMHRDLKPSNILIDKSCSIKIGDLGLARSLSDSKECLTEYIATRWYRAPEILISNRRYTHHVDIWSLGCILAEMLQSKPLFPGASTSHQLQLIVNLVRPNPPHADKFYAGFKSKHExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTASLSSADVENDESYVQDSRLEGWVSIPNKQNIKRHGWKKQYVVVSSKKIIFYNSENDKQNTDPELELKDLMAKHRSDLSSKESLLSNGKERxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDINTTCKGKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTASLSSADVENDESYVQDEVRSRSVTQGDVIRADAKDIPRIFQLLYAGEGEARRPEDGGAELPAVLRGGDEKPGIIALKGHEFLNISYHMPTTCEVCPKPIWHIIRPPPALECGTVLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitogen-activated protein kinase 15	Constitutively active kinase which may function as a negative regulator of cell growth. In vitro, phosphorylates FOS.	confident	Q9Z2A6
Mitogen-activated protein kinase 15	Constitutively active kinase which may function as a negative regulator of cell growth.	confident	Q80Y86
Mitogen-activated protein kinase 15	In vitro, phosphorylates MBP.	confident	Q8TD08

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006974 [BP]	response to DNA damage stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0018107 [BP]	peptidyl-threonine phosphorylation	probable	GO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042542 [BP]	response to hydrogen peroxide	probable	GO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0043627 [BP]	response to estrogen stimulus	probable	GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006970 [BP]	response to osmotic stress	probable	GO:0009628, GO:0006950, GO:0008150, GO:0050896
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0045935 [BP]	positive regulation of nucleobase-containing compound metabolic process	probable	GO:0009893, GO:0080090, GO:0019222, GO:0019219, GO:0031325, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0009966 [BP]	regulation of signal transduction	probable	GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0002376 [BP]	immune system process	probable	GO:0008150
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0031328 [BP]	positive regulation of cellular biosynthetic process	probable	GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0032879 [BP]	regulation of localization	probable	GO:0008150, GO:0065007, GO:0050789
GO:0065009 [BP]	regulation of molecular function	probable	GO:0008150, GO:0065007
GO:0009790 [BP]	embryo development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0051403 [BP]	stress-activated MAPK cascade	probable	GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0030427 [CC]	site of polarized growth	probable	GO:0005575, GO:0044464, GO:0005623
GO:0009887 [BP]	organ morphogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0009888 [BP]	tissue development	probable	GO:0032502, GO:0048856, GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0000922 [CC]	spindle pole	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0023014 [BP]	signal transduction by phosphorylation	probable	GO:0044700, GO:0051716, GO:0008152, GO:0016310, GO:0050896, GO:0009987, GO:0044237, GO:0050794, GO:0008150, GO:0006796, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0006793, GO:0007154, GO:0050789, GO:0044699
GO:0019933 [BP]	cAMP-mediated signaling	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0019935, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0071276 [BP]	cellular response to cadmium ion	probable	GO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0046686, GO:0042221, GO:0010035, GO:0044699
GO:1901698 [BP]	response to nitrogen compound	probable	GO:0042221, GO:0050896, GO:0008150
GO:0071243 [BP]	cellular response to arsenic-containing substance	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0046685, GO:0044699
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0031663 [BP]	lipopolysaccharide-mediated signaling pathway	probable	GO:0071222, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0042221, GO:0032496, GO:0050789, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0065007, GO:0071219, GO:0071216, GO:0044700, GO:0009987, GO:0071396, GO:0050794, GO:0044763, GO:0007154, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0008150
GO:0004705 [MF]	JUN kinase activity	probable	GO:0016301, GO:0060089, GO:0016773, GO:0005057, GO:0003824, GO:0004702, GO:0016740, GO:0004674, GO:0004707, GO:0003674, GO:0004871, GO:0004672, GO:0016909, GO:0016772
GO:0005815 [CC]	microtubule organizing center	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0034614 [BP]	cellular response to reactive oxygen species	probable	GO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0006979, GO:0044699
GO:0051641 [BP]	cellular localization	probable	GO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001934 [BP]	positive regulation of protein phosphorylation	probable	GO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 34-77
View the alignment between query and template
View the model in PyMOL

Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 657-782,816-844
View the alignment between query and template
View the model in PyMOL

Template: 3OZ6, chain A
Confidence level:very confident
Coverage over the Query: 559-859
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:very confident
Coverage over the Query: 101-193,231-281
View the alignment between query and template
View the model in PyMOL

Template: 2ROW, chain A
Confidence level:very confident
Coverage over the Query: 1152-1216
View the alignment between query and template
View the model in PyMOL

Template: 2ROV, chain A
Confidence level:very confident
Coverage over the Query: 1120-1151
View the alignment between query and template
View the model in PyMOL

Template: 1M7Q, chain A
Confidence level:confident
Coverage over the Query: 540-777
View the alignment between query and template
View the model in PyMOL

Template: 1S1C, chain X
Confidence level:confident
Coverage over the Query: 948-1011
View the alignment between query and template
View the model in PyMOL

Template: 3PVU, chain A
Confidence level:confident
Coverage over the Query: 453-761
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:confident
Coverage over the Query: 124-166,177-225
View the alignment between query and template
View the model in PyMOL

Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 32-535
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 943-994,1027-1088
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3vkg, chain A		probable	Alignment \| Template Structure