Query         psy14433
Match_columns 144
No_of_seqs    66 out of 68
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 19:44:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14433.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14433hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06553 BNIP3:  BNIP3;  InterP 100.0 6.6E-51 1.4E-55  329.9  -0.1  125    6-130    70-196 (197)
  2 COG3763 Uncharacterized protei  41.1     7.9 0.00017   27.9  -0.3   23  102-124     7-29  (71)
  3 PF15054 DUF4535:  Domain of un  39.0     4.9 0.00011   26.5  -1.5   18  106-123     3-20  (46)
  4 cd06418 GH25_BacA-like BacA is  37.8      20 0.00044   29.2   1.6   24   51-74    165-192 (212)
  5 KOG4481|consensus               36.9      13 0.00028   31.1   0.3   26   50-75     71-107 (194)
  6 PF07099 DUF1361:  Protein of u  35.8      10 0.00022   29.8  -0.4   14  110-123   114-127 (168)
  7 PF03672 UPF0154:  Uncharacteri  34.8     8.4 0.00018   27.1  -0.9   20  105-124     3-22  (64)
  8 PRK01844 hypothetical protein;  33.5      12 0.00027   26.9  -0.3   22  103-124     8-29  (72)
  9 KOG4452|consensus               28.8      36 0.00078   24.9   1.5   23   93-115    46-68  (79)
 10 PF10606 GluR_Homer-bdg:  Homer  27.8      20 0.00043   24.5   0.0   21    4-26      8-28  (51)
 11 PF07271 Cytadhesin_P30:  Cytad  26.4      30 0.00064   30.5   0.8   20  104-123    79-98  (279)
 12 PF11782 DUF3319:  Protein of u  24.3      14  0.0003   27.5  -1.4   39   31-72     20-58  (88)
 13 PHA00727 hypothetical protein   23.2      53  0.0012   28.5   1.7   20  104-123   217-236 (278)
 14 PF11382 DUF3186:  Protein of u  21.7      36 0.00079   29.1   0.4   16  106-121    11-26  (308)
 15 PF13042 DUF3902:  Protein of u  21.4      31 0.00067   28.3  -0.0   10   49-58     27-36  (161)
 16 PRK00523 hypothetical protein;  21.4      28 0.00061   25.1  -0.3   19  106-124    12-30  (72)
 17 PRK11677 hypothetical protein;  20.9      30 0.00064   27.1  -0.2   19  105-123     6-24  (134)

No 1  
>PF06553 BNIP3:  BNIP3;  InterPro: IPR010548 This family consists of several mammalian specific BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerisation, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterised by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation [].; GO: 0043065 positive regulation of apoptosis, 0005740 mitochondrial envelope, 0016021 integral to membrane; PDB: 2KA1_B 2KA2_A 2J5D_A.
Probab=100.00  E-value=6.6e-51  Score=329.89  Aligned_cols=125  Identities=35%  Similarity=0.621  Sum_probs=35.9

Q ss_pred             ccCCCCCCCCCCCCCCCCCCcccccccceeeeeeehhhhhhcCCCCCcceeccCCCCCCCCCCceeeecC-CCCccccee
Q psy14433          6 DLGNSFSPKSPPNSPNTELSTEDDHLKGVYINFANKDELVANFDKSTDWIWDWSSRPDQAPPKDWKFRHP-KSKSYSMRY   84 (144)
Q Consensus         6 ~~~~~~SPksppnSp~~E~~~~~~eL~~vyiny~~~~~~~~~lkKn~DWVwDWSSRPEniPPKef~frhP-~~~slSmR~   84 (144)
                      .++|+.+|++|++++|+||..+.++.++||+||.........-.||+||||||||||||+|||||+|+|| ++++||||+
T Consensus        70 ~dSP~~s~~p~~~~~~~~~~~~~~~~~~~~~qsee~~~e~~~~~k~~DWvwDWSSRPEniPPKef~f~hPkr~~~lS~r~  149 (197)
T PF06553_consen   70 CDSPPRSPSPPQNSPQIEFDVEMDESRDVSSQSEEDVGEREKEVKNADWVWDWSSRPENIPPKEFHFKHPKRSVSLSMRK  149 (197)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCCCCCCCCCcCCCccccccccCCCCccchhhccchhhhhcccccHHHHHhccCcccCCCcceEEECCCCCCCccccc
Confidence            4677778889999999999887799999999999987665532389999999999999999999999999 779999999


Q ss_pred             eec-cCCcccchhhhhhhhHHHHHHHHHhhceeeeeecccchhhhhh
Q psy14433         85 AKV-GKNSLFSKEVMYTLFVTNIISILLGTGVGMWLSRRGMLIASNV  130 (144)
Q Consensus        85 s~v-~K~glFS~e~L~~flps~llShlL~~GlGiyIGKR~~l~~~~~  130 (144)
                      ++| ||+||||+|||++||||||+|||||+|||||||||++..++..
T Consensus       150 t~v~k~~glfS~e~l~~flpslllS~lL~~GlGiyIgkRl~t~s~st  196 (197)
T PF06553_consen  150 TRVMKKGGLFSAEFLKVFLPSLLLSHLLGLGLGIYIGKRLATPSAST  196 (197)
T ss_dssp             SS-----SSSTHHHHHTTHHHHHHHHHHHHHHHHHHHHHHC------
T ss_pred             cccccccccccHHHHHHHhHHHHHHHHHhcccEEEEecccccCcCCC
Confidence            999 7779999999999999999999999999999999999888754


No 2  
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.13  E-value=7.9  Score=27.91  Aligned_cols=23  Identities=22%  Similarity=0.511  Sum_probs=18.2

Q ss_pred             hHHHHHHHHHhhceeeeeecccc
Q psy14433        102 FVTNIISILLGTGVGMWLSRRGM  124 (144)
Q Consensus       102 lps~llShlL~~GlGiyIGKR~~  124 (144)
                      +.-.+++.+.|+..|+||.||.+
T Consensus         7 il~ivl~ll~G~~~G~fiark~~   29 (71)
T COG3763           7 ILLIVLALLAGLIGGFFIARKQM   29 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35567788889999999988874


No 3  
>PF15054 DUF4535:  Domain of unknown function (DUF4535)
Probab=38.99  E-value=4.9  Score=26.53  Aligned_cols=18  Identities=22%  Similarity=0.379  Sum_probs=13.7

Q ss_pred             HHHHHHhhceeeeeeccc
Q psy14433        106 IISILLGTGVGMWLSRRG  123 (144)
Q Consensus       106 llShlL~~GlGiyIGKR~  123 (144)
                      ++|.++|+..||||...-
T Consensus         3 ~fsF~~G~~~GiY~AQNY   20 (46)
T PF15054_consen    3 LFSFGAGTYTGIYVAQNY   20 (46)
T ss_pred             eEEEeeccEEEEEeeecc
Confidence            356788999999986543


No 4  
>cd06418 GH25_BacA-like BacA is a bacterial lysin from Enterococcus faecalis that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.  BacA is homologous to the YbfG and YkuG lysins of Bacillus subtilis. BacA has a C-terminal catalytic glycosyl hydrolase family 25 (GH25) domain and an N-terminal peptidoglycan-binding domain comprised of three alpha helices which is similar to a domain found in matrixins.
Probab=37.78  E-value=20  Score=29.15  Aligned_cols=24  Identities=29%  Similarity=0.540  Sum_probs=20.1

Q ss_pred             CCcceeccCCCC----CCCCCCceeeec
Q psy14433         51 STDWIWDWSSRP----DQAPPKDWKFRH   74 (144)
Q Consensus        51 n~DWVwDWSSRP----EniPPKef~frh   74 (144)
                      ..-|+.|||+.+    +..+|+.|.|..
T Consensus       165 ~~~w~a~~s~g~s~n~g~~~~~~Wa~~q  192 (212)
T cd06418         165 VVSFVADMSTGFSGNLGYPLPKDWAFDQ  192 (212)
T ss_pred             eeEEEecCCCCCcCCCCCCccccCCccc
Confidence            457999999987    577899999974


No 5  
>KOG4481|consensus
Probab=36.86  E-value=13  Score=31.15  Aligned_cols=26  Identities=27%  Similarity=0.396  Sum_probs=22.4

Q ss_pred             CCCcceeccCCC----------C-CCCCCCceeeecC
Q psy14433         50 KSTDWIWDWSSR----------P-DQAPPKDWKFRHP   75 (144)
Q Consensus        50 Kn~DWVwDWSSR----------P-EniPPKef~frhP   75 (144)
                      ++.|-|..|-++          | |+-+|++|+|--|
T Consensus        71 ~SkDpV~r~q~kkaaet~q~~fp~e~r~p~~~~f~~~  107 (194)
T KOG4481|consen   71 DSKDPVSRVQVKKAAETRQEEFPKEFRLPKDYHFDEI  107 (194)
T ss_pred             cCCCchhhhhhccccchhcccchhhcCCcccccCCCc
Confidence            578999999999          5 7789999999875


No 6  
>PF07099 DUF1361:  Protein of unknown function (DUF1361);  InterPro: IPR009793 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown although some members are annotated as being putative integral membrane proteins.
Probab=35.77  E-value=10  Score=29.80  Aligned_cols=14  Identities=21%  Similarity=0.292  Sum_probs=11.0

Q ss_pred             HHhhceeeeeeccc
Q psy14433        110 LLGTGVGMWLSRRG  123 (144)
Q Consensus       110 lL~~GlGiyIGKR~  123 (144)
                      .+-.|+||||||-+
T Consensus       114 ~~Lss~GIYlGRfl  127 (168)
T PF07099_consen  114 SFLSSFGIYLGRFL  127 (168)
T ss_pred             HHHHHHHHHHHhhc
Confidence            44568999999965


No 7  
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=34.76  E-value=8.4  Score=27.05  Aligned_cols=20  Identities=25%  Similarity=0.715  Sum_probs=16.1

Q ss_pred             HHHHHHHhhceeeeeecccc
Q psy14433        105 NIISILLGTGVGMWLSRRGM  124 (144)
Q Consensus       105 ~llShlL~~GlGiyIGKR~~  124 (144)
                      .++..++|+.+|+|++|+.+
T Consensus         3 iilali~G~~~Gff~ar~~~   22 (64)
T PF03672_consen    3 IILALIVGAVIGFFIARKYM   22 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            45677889999999998863


No 8  
>PRK01844 hypothetical protein; Provisional
Probab=33.48  E-value=12  Score=26.86  Aligned_cols=22  Identities=18%  Similarity=0.685  Sum_probs=17.2

Q ss_pred             HHHHHHHHHhhceeeeeecccc
Q psy14433        103 VTNIISILLGTGVGMWLSRRGM  124 (144)
Q Consensus       103 ps~llShlL~~GlGiyIGKR~~  124 (144)
                      .-.++..++|+.+|+||.|+.+
T Consensus         8 ~l~I~~li~G~~~Gff~ark~~   29 (72)
T PRK01844          8 LVGVVALVAGVALGFFIARKYM   29 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3445678899999999998863


No 9  
>KOG4452|consensus
Probab=28.79  E-value=36  Score=24.89  Aligned_cols=23  Identities=22%  Similarity=0.573  Sum_probs=18.9

Q ss_pred             cchhhhhhhhHHHHHHHHHhhce
Q psy14433         93 FSKEVMYTLFVTNIISILLGTGV  115 (144)
Q Consensus        93 FS~e~L~~flps~llShlL~~Gl  115 (144)
                      .+++.+|-++.++..|..+|+|.
T Consensus        46 y~r~l~KELlIsl~aSvFlGFG~   68 (79)
T KOG4452|consen   46 YNRNLLKELLISLTASVFLGFGS   68 (79)
T ss_pred             hhHHHHHHHHHHHHHHHHHhhhH
Confidence            35678888999999998888885


No 10 
>PF10606 GluR_Homer-bdg:  Homer-binding domain of metabotropic glutamate receptor ;  InterPro: IPR019588  This entry represents the proline-rich region of metabotropic glutamate receptor proteins that bind Homer-related synaptic proteins.  Metabotropic glutamate receptors function as receptors for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. The Homer proteins form a physical tether linking mGluRs with the inositol trisphosphate receptors (IP3R) that appears to be due to the proline-rich Homer ligand (PPXXFr). Activation of PI turnover triggers intracellular calcium release []. Metabotropic glutamate receptor (MGluR) function is altered in the mouse model of human Fragile X syndrome mental retardation, a disorder caused by loss of function mutations in the Fragile X mental retardation gene Fmr1. Homer 3 (and to a lesser extent Homer 1b/c) has been shown to form a multimeric complex with mGlu1a and the IP3 receptor, indicating that Homers may play a role in the localisation of receptors to their signalling partners []. ; PDB: 1DDV_B.
Probab=27.80  E-value=20  Score=24.46  Aligned_cols=21  Identities=43%  Similarity=0.559  Sum_probs=0.0

Q ss_pred             ccccCCCCCCCCCCCCCCCCCCc
Q psy14433          4 FRDLGNSFSPKSPPNSPNTELST   26 (144)
Q Consensus         4 ~r~~~~~~SPksppnSp~~E~~~   26 (144)
                      |||  .-.|.-++++||.+|..-
T Consensus         8 FRD--sv~sg~s~~~SPvsEs~l   28 (51)
T PF10606_consen    8 FRD--SVCSGSSSPSSPVSESML   28 (51)
T ss_dssp             -----------------------
T ss_pred             ccc--ccCCCCCCCCCccccccc
Confidence            777  556777888999999543


No 11 
>PF07271 Cytadhesin_P30:  Cytadhesin P30/P32;  InterPro: IPR009896 This family consists of several Mycoplasma species specific Cytadhesin P32 and P30 proteins. P30 has been found to be membrane associated and localised on the tip organelle. It is thought that it is important in cytadherence and virulence [].; GO: 0007157 heterophilic cell-cell adhesion, 0009405 pathogenesis, 0016021 integral to membrane
Probab=26.44  E-value=30  Score=30.52  Aligned_cols=20  Identities=20%  Similarity=0.482  Sum_probs=15.8

Q ss_pred             HHHHHHHHhhceeeeeeccc
Q psy14433        104 TNIISILLGTGVGMWLSRRG  123 (144)
Q Consensus       104 s~llShlL~~GlGiyIGKR~  123 (144)
                      -+++..|||+|||+-|-||-
T Consensus        79 ~~~v~liLgl~ig~p~~krk   98 (279)
T PF07271_consen   79 LLAVALILGLAIGIPIYKRK   98 (279)
T ss_pred             HHHHHHHHHHhhcchhhhhh
Confidence            34567899999999888764


No 12 
>PF11782 DUF3319:  Protein of unknown function (DUF3319);  InterPro: IPR021753  This is a family of short bacterial proteins, a few of which are annotated as being minor tail protein. Otherwise the function is unknown. 
Probab=24.30  E-value=14  Score=27.55  Aligned_cols=39  Identities=26%  Similarity=0.259  Sum_probs=29.4

Q ss_pred             ccceeeeeeehhhhhhcCCCCCcceeccCCCCCCCCCCceee
Q psy14433         31 LKGVYINFANKDELVANFDKSTDWIWDWSSRPDQAPPKDWKF   72 (144)
Q Consensus        31 L~~vyiny~~~~~~~~~lkKn~DWVwDWSSRPEniPPKef~f   72 (144)
                      .=+|-|.=....|.+..++|+.||--|=.|=   |+|+||-=
T Consensus        20 ~Wk~~Ik~~~~~GsL~~vKksIdww~dt~si---I~P~efss   58 (88)
T PF11782_consen   20 IWKVTIKNHVLSGSLFEVKKSIDWWCDTGSI---IDPKEFSS   58 (88)
T ss_pred             eeEEEECCeEEeeEHHHHHHHHHHHHhcccc---cCchhhcc
Confidence            3445565556667788889999998888765   99999854


No 13 
>PHA00727 hypothetical protein
Probab=23.20  E-value=53  Score=28.51  Aligned_cols=20  Identities=25%  Similarity=0.408  Sum_probs=15.3

Q ss_pred             HHHHHHHHhhceeeeeeccc
Q psy14433        104 TNIISILLGTGVGMWLSRRG  123 (144)
Q Consensus       104 s~llShlL~~GlGiyIGKR~  123 (144)
                      -+++--|+|+|+|+.||=-+
T Consensus       217 mliig~imgigigvaigfgi  236 (278)
T PHA00727        217 MLIIGAIMGIGIGVAIGFGI  236 (278)
T ss_pred             HHHHHHHHhcccceeeeecc
Confidence            35667789999999998544


No 14 
>PF11382 DUF3186:  Protein of unknown function (DUF3186);  InterPro: IPR021522  This bacterial family of proteins has no known function. 
Probab=21.69  E-value=36  Score=29.12  Aligned_cols=16  Identities=25%  Similarity=0.542  Sum_probs=10.2

Q ss_pred             HHHHHHhhceeeeeec
Q psy14433        106 IISILLGTGVGMWLSR  121 (144)
Q Consensus       106 llShlL~~GlGiyIGK  121 (144)
                      |.+-.||+|+||.||=
T Consensus        11 l~aVFlALavGI~lG~   26 (308)
T PF11382_consen   11 LAAVFLALAVGIVLGS   26 (308)
T ss_pred             HHHHHHHHHHHHHhcc
Confidence            4455667777777764


No 15 
>PF13042 DUF3902:  Protein of unknown function (DUF3902)
Probab=21.39  E-value=31  Score=28.28  Aligned_cols=10  Identities=40%  Similarity=1.069  Sum_probs=9.2

Q ss_pred             CCCCcceecc
Q psy14433         49 DKSTDWIWDW   58 (144)
Q Consensus        49 kKn~DWVwDW   58 (144)
                      +.+.||+|+|
T Consensus        27 ~g~~dwil~w   36 (161)
T PF13042_consen   27 MGGGDWILSW   36 (161)
T ss_pred             cCCCcchHHH
Confidence            7789999999


No 16 
>PRK00523 hypothetical protein; Provisional
Probab=21.38  E-value=28  Score=25.08  Aligned_cols=19  Identities=21%  Similarity=0.497  Sum_probs=14.9

Q ss_pred             HHHHHHhhceeeeeecccc
Q psy14433        106 IISILLGTGVGMWLSRRGM  124 (144)
Q Consensus       106 llShlL~~GlGiyIGKR~~  124 (144)
                      ++-.++|+.+|+||.|+.+
T Consensus        12 i~~li~G~~~Gffiark~~   30 (72)
T PRK00523         12 IPLLIVGGIIGYFVSKKMF   30 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4447889999999998863


No 17 
>PRK11677 hypothetical protein; Provisional
Probab=20.88  E-value=30  Score=27.06  Aligned_cols=19  Identities=26%  Similarity=0.469  Sum_probs=15.1

Q ss_pred             HHHHHHHhhceeeeeeccc
Q psy14433        105 NIISILLGTGVGMWLSRRG  123 (144)
Q Consensus       105 ~llShlL~~GlGiyIGKR~  123 (144)
                      .++..|+|+.+|+.|+|-+
T Consensus         6 a~i~livG~iiG~~~~R~~   24 (134)
T PRK11677          6 ALIGLVVGIIIGAVAMRFG   24 (134)
T ss_pred             HHHHHHHHHHHHHHHHhhc
Confidence            4577888999999988854


Done!