Query         psy14437
Match_columns 160
No_of_seqs    96 out of 98
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 19:49:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14437.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14437hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0612|consensus               99.5 5.5E-15 1.2E-19  145.8   1.3   65   10-79   1236-1300(1317)
  2 cd01242 PH_ROK Rok (Rho- assoc  98.3 2.2E-07 4.8E-12   71.7   1.0   36   34-70     75-112 (112)
  3 KOG0612|consensus               98.2 5.9E-07 1.3E-11   90.1   2.9   63   90-158  1249-1316(1317)
  4 cd01242 PH_ROK Rok (Rho- assoc  98.2 4.5E-07 9.8E-12   70.0   0.6   32  105-137    81-112 (112)
  5 PF00169 PH:  PH domain;  Inter  79.4    0.95 2.1E-05   29.9   1.0   24   45-68     80-103 (104)
  6 cd01220 PH_CDEP Chondrocyte-de  79.2     1.1 2.4E-05   33.1   1.3   28   42-69     71-98  (99)
  7 cd01235 PH_SETbf Set binding f  78.3     1.2 2.5E-05   31.1   1.2   26   43-68     76-101 (101)
  8 PF00169 PH:  PH domain;  Inter  74.5     1.9 4.1E-05   28.4   1.4   24  112-135    80-103 (104)
  9 cd01266 PH_Gab Gab (Grb2-assoc  72.2       2 4.4E-05   31.3   1.2   24   43-66     83-106 (108)
 10 cd01220 PH_CDEP Chondrocyte-de  72.0       2 4.3E-05   31.7   1.1   26  111-136    73-98  (99)
 11 cd00029 C1 Protein kinase C co  69.9     2.1 4.5E-05   26.4   0.7   20    8-27     26-45  (50)
 12 cd01219 PH_FGD FGD (faciogenit  69.8     2.9 6.3E-05   30.3   1.5   26   45-70     76-101 (101)
 13 smart00109 C1 Protein kinase C  69.5     1.6 3.4E-05   26.6   0.1   19    9-27     26-44  (49)
 14 cd01265 PH_PARIS-1 PARIS-1 ple  69.4     2.7 5.8E-05   30.2   1.3   33   34-67     61-93  (95)
 15 cd01260 PH_CNK Connector enhan  67.8     3.9 8.5E-05   28.6   1.9   23   43-65     72-94  (96)
 16 PF00130 C1_1:  Phorbol esters/  67.1     3.4 7.3E-05   26.3   1.3   28    6-36     24-51  (53)
 17 cd01243 PH_MRCK MRCK (myotonic  67.0     2.9 6.2E-05   33.1   1.1   22  111-132    95-116 (122)
 18 smart00233 PH Pleckstrin homol  66.5     3.8 8.2E-05   26.2   1.4   24   45-68     78-101 (102)
 19 cd01235 PH_SETbf Set binding f  66.2     3.3 7.1E-05   28.8   1.2   25  111-135    77-101 (101)
 20 cd01244 PH_RasGAP_CG9209 RAS_G  65.7     2.9 6.4E-05   30.9   0.9   23   44-66     75-97  (98)
 21 cd01251 PH_centaurin_alpha Cen  65.4     3.8 8.2E-05   29.9   1.4   27   43-69     75-101 (103)
 22 cd01252 PH_cytohesin Cytohesin  65.1     4.7  0.0001   29.9   1.9   24   48-71     93-116 (125)
 23 cd01266 PH_Gab Gab (Grb2-assoc  64.6     3.6 7.7E-05   30.0   1.1   23  110-132    83-105 (108)
 24 cd01260 PH_CNK Connector enhan  64.0     3.2 6.9E-05   29.1   0.8   22  111-132    73-94  (96)
 25 cd01243 PH_MRCK MRCK (myotonic  64.0     3.2 6.8E-05   32.8   0.8   22   44-65     95-116 (122)
 26 cd00821 PH Pleckstrin homology  63.1     3.8 8.3E-05   25.9   1.0   21   45-65     74-94  (96)
 27 cd01219 PH_FGD FGD (faciogenit  62.2     4.8  0.0001   29.2   1.4   25  112-136    76-100 (101)
 28 cd01222 PH_clg Clg (common-sit  61.5     6.3 0.00014   29.3   2.0   34   34-68     59-95  (97)
 29 cd01225 PH_Cool_Pix Cool (clon  60.7     4.8  0.0001   31.3   1.3   24  113-136    87-110 (111)
 30 cd01225 PH_Cool_Pix Cool (clon  60.5     4.8  0.0001   31.3   1.3   24   46-69     87-110 (111)
 31 cd01221 PH_ephexin Ephexin Ple  60.4     3.2   7E-05   32.5   0.3   21  111-131    98-118 (125)
 32 cd01244 PH_RasGAP_CG9209 RAS_G  60.3     3.6 7.8E-05   30.4   0.5   23  111-133    75-97  (98)
 33 cd01265 PH_PARIS-1 PARIS-1 ple  60.3     4.9 0.00011   28.8   1.2   24  111-134    70-93  (95)
 34 cd01238 PH_Tec Tec pleckstrin   58.5     5.2 0.00011   29.3   1.1   23   44-66     83-105 (106)
 35 cd01221 PH_ephexin Ephexin Ple  58.5     3.9 8.5E-05   32.1   0.5   24   42-65     96-119 (125)
 36 cd01250 PH_centaurin Centaurin  58.5     5.4 0.00012   26.8   1.1   21   45-65     72-92  (94)
 37 cd01236 PH_outspread Outspread  57.9     5.1 0.00011   30.1   1.0   25   42-66     78-102 (104)
 38 cd01218 PH_phafin2 Phafin2  Pl  57.8     6.3 0.00014   29.6   1.5   29   42-70     72-100 (104)
 39 cd01236 PH_outspread Outspread  57.2     5.3 0.00011   30.0   1.0   23  111-133    80-102 (104)
 40 cd01257 PH_IRS Insulin recepto  53.6     7.1 0.00015   29.0   1.2   21  112-132    79-99  (101)
 41 cd01251 PH_centaurin_alpha Cen  53.3     7.9 0.00017   28.2   1.3   26  111-136    76-101 (103)
 42 cd01250 PH_centaurin Centaurin  52.3     7.1 0.00015   26.3   0.9   21  112-132    72-92  (94)
 43 cd01238 PH_Tec Tec pleckstrin   51.6      12 0.00025   27.4   2.0   22  112-133    84-105 (106)
 44 PF10880 DUF2673:  Protein of u  50.5      10 0.00022   26.9   1.4   19  114-132    33-51  (65)
 45 cd01257 PH_IRS Insulin recepto  47.9     9.1  0.0002   28.4   0.9   22   44-65     78-99  (101)
 46 cd01218 PH_phafin2 Phafin2  Pl  47.3      10 0.00022   28.5   1.1   26  111-136    74-99  (104)
 47 cd01246 PH_oxysterol_bp Oxyste  46.5      11 0.00024   25.1   1.1   23   43-65     67-89  (91)
 48 cd01254 PH_PLD Phospholipase D  43.6      11 0.00025   28.2   0.9   25   41-65     95-119 (121)
 49 cd01252 PH_cytohesin Cytohesin  42.4      22 0.00048   26.3   2.3   23  115-137    93-115 (125)
 50 cd01247 PH_GPBP Goodpasture an  41.7      11 0.00024   27.0   0.6   25   42-66     66-90  (91)
 51 TIGR03504 FimV_Cterm FimV C-te  41.0      34 0.00074   22.1   2.7   29  107-135    14-44  (44)
 52 cd01228 PH_BCR-related BCR (br  40.0      13 0.00029   28.3   0.8   28  107-134    66-93  (96)
 53 PF15405 PH_5:  Pleckstrin homo  38.7      18 0.00039   28.1   1.4   36   31-66     98-133 (135)
 54 COG3965 Predicted Co/Zn/Cd cat  37.3      35 0.00076   30.8   3.1   35   42-77    218-252 (314)
 55 cd00900 PH-like Pleckstrin hom  37.2      17 0.00037   23.1   0.9   23   44-66     76-98  (99)
 56 cd01254 PH_PLD Phospholipase D  36.8      15 0.00033   27.5   0.7   25  108-132    95-119 (121)
 57 cd01233 Unc104 Unc-104 pleckst  36.7      18 0.00039   26.0   1.0   24   43-66     73-96  (100)
 58 cd01241 PH_Akt Akt pleckstrin   36.4      29 0.00064   25.1   2.1   20   48-67     82-101 (102)
 59 cd01233 Unc104 Unc-104 pleckst  36.3      16 0.00036   26.2   0.8   22  111-132    74-95  (100)
 60 COG3965 Predicted Co/Zn/Cd cat  36.1      39 0.00084   30.5   3.2   41  101-142   210-250 (314)
 61 PF13831 PHD_2:  PHD-finger; PD  36.1      10 0.00022   23.5  -0.3   20    8-27      2-21  (36)
 62 PF15410 PH_9:  Pleckstrin homo  35.2      17 0.00036   27.2   0.6   32   34-65     84-115 (119)
 63 PF15413 PH_11:  Pleckstrin hom  34.5      20 0.00042   26.6   0.9   26   41-66     86-111 (112)
 64 cd01248 PH_PLC Phospholipase C  33.1      30 0.00065   25.4   1.7   21   45-65     93-113 (115)
 65 cd01253 PH_beta_spectrin Beta-  31.7      25 0.00054   24.8   1.1   24   42-65     79-102 (104)
 66 COG1860 Uncharacterized protei  31.4      18 0.00039   29.5   0.3   35    4-38     19-61  (147)
 67 PF11939 DUF3457:  Protein of u  31.2      16 0.00034   29.5  -0.0   36    1-38     20-55  (155)
 68 cd01264 PH_melted Melted pleck  31.0      24 0.00051   26.5   0.9   24  110-133    76-99  (101)
 69 PF15413 PH_11:  Pleckstrin hom  30.8      23 0.00051   26.2   0.8   26  108-133    86-111 (112)
 70 cd01230 PH_EFA6 EFA6 Pleckstri  30.5      24 0.00052   26.9   0.9   27   42-68     85-111 (117)
 71 TIGR02753 sodN superoxide dism  30.3      23  0.0005   28.8   0.7   18  100-117   114-131 (145)
 72 cd01228 PH_BCR-related BCR (br  30.1      26 0.00056   26.7   1.0   27   41-67     67-93  (96)
 73 PF15409 PH_8:  Pleckstrin homo  30.1      43 0.00093   24.8   2.1   32   34-66     56-87  (89)
 74 cd01261 PH_SOS Son of Sevenles  28.8      36 0.00078   26.0   1.5   27   44-70     85-111 (112)
 75 cd01261 PH_SOS Son of Sevenles  28.3      37  0.0008   25.9   1.6   26  112-137    86-111 (112)
 76 PF15410 PH_9:  Pleckstrin homo  27.3      28 0.00062   25.9   0.8   24  109-132    92-115 (119)
 77 cd01264 PH_melted Melted pleck  27.1      30 0.00065   26.0   0.8   25   42-66     75-99  (101)
 78 cd01230 PH_EFA6 EFA6 Pleckstri  26.9      27 0.00059   26.6   0.6   25  110-134    86-110 (117)
 79 cd01232 PH_TRIO Trio pleckstri  26.9      65  0.0014   24.6   2.7   36   34-69     74-113 (114)
 80 cd01224 PH_Collybistin Collybi  26.5      28 0.00061   26.8   0.6   23   44-66     83-105 (109)
 81 PLN03207 stomagen; Provisional  23.5      33 0.00071   26.8   0.5   16   11-26     79-94  (113)
 82 KOG3523|consensus               22.2      39 0.00084   33.5   0.8   31  101-132   561-591 (695)
 83 PF15405 PH_5:  Pleckstrin homo  21.4      79  0.0017   24.5   2.3   35   99-133    99-133 (135)
 84 PF15408 PH_7:  Pleckstrin homo  21.3      49  0.0011   25.4   1.0   23   44-66     73-95  (104)
 85 PF15409 PH_8:  Pleckstrin homo  21.1      80  0.0017   23.3   2.1   21  113-133    67-87  (89)

No 1  
>KOG0612|consensus
Probab=99.49  E-value=5.5e-15  Score=145.78  Aligned_cols=65  Identities=52%  Similarity=0.759  Sum_probs=62.4

Q ss_pred             cccCccccccccccccccccccccCcccccCchhhhhHhhcCCChHHHHHHHHHHHHhHhhcCCCCCCCC
Q psy14437         10 NVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLS   79 (160)
Q Consensus        10 a~ecrrC~~K~Hkdh~d~ke~~i~pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~k~I~k~~~~~~s~~   79 (160)
                      ||||++||+|||+||+|+   ++.||+  ||+.+|++|||+|.+++||..||++|.++|++.++.+++.+
T Consensus      1236 ~ye~~~~~~~~~~d~~~k---~m~p~k--y~~~~a~~l~l~a~~~~dq~eWV~~l~k~~~k~~~~~~~~~ 1300 (1317)
T KOG0612|consen 1236 AYECRRCHIKCHKDHMDK---IMAPCK--YDTSSARHLLLLAESTEDQAKWVQRLVKKIPKPLPAAGSFS 1300 (1317)
T ss_pred             HHHHHHhhcccccccccc---ccCccc--ccccCCccceeccCCchHHHHHHHHHhcccCCCCCccccee
Confidence            999999999999999997   899999  99999999999999999999999999999999998877764


No 2  
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain. Rok (Rho- associated kinase) pleckstrin homology (PH) domain. Rok is a serine/threonine kinase that binds GTP-rho. It consists of a kinase domain, a coiled coil region and a PH domain. The Rok PH domain is interrupted by a C1 domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=98.29  E-value=2.2e-07  Score=71.74  Aligned_cols=36  Identities=50%  Similarity=0.794  Sum_probs=31.3

Q ss_pred             Ccc--cccCchhhhhHhhcCCChHHHHHHHHHHHHhHhh
Q psy14437         34 PCK--LHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQK   70 (160)
Q Consensus        34 pCk--~n~D~~~AkeLLLla~s~eeq~~WVs~L~k~I~k   70 (160)
                      ||-  +.|++. +++|||||+|.+||++||++|+|+||+
T Consensus        75 P~IF~I~~~~~-~~~lllLA~s~~ek~kWV~~L~~~~~~  112 (112)
T cd01242          75 PKIFQILYANE-ARDLLLLAPQTDEQNKWVSRLVKKIPK  112 (112)
T ss_pred             CeEEEEEeCCc-cceEEEEeCCchHHHHHHHHHHHhccC
Confidence            775  556654 699999999999999999999999986


No 3  
>KOG0612|consensus
Probab=98.23  E-value=5.9e-07  Score=90.06  Aligned_cols=63  Identities=48%  Similarity=0.660  Sum_probs=52.1

Q ss_pred             CCCCCCcccccCccccCChhhhhHHhhcCCChHHHHHHHHHHHHHhhhcCCCCCC-----CCCCCccCCCCCCC
Q psy14437         90 DHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANT-----LSDGVKISPREKTD  158 (160)
Q Consensus        90 dhldkKeprsaPCk~~~D~~tAk~lLlla~s~eeq~~WVs~L~kkIpk~~~~~~s-----~~~~~r~sp~~s~r  158 (160)
                      +|.+.   .+.||+  ||..+|++|||+|.+++||..||++|.|||++.++.+.+     ++. .+++.+++++
T Consensus      1249 d~~~k---~m~p~k--y~~~~a~~l~l~a~~~~dq~eWV~~l~k~~~k~~~~~~~~~~~s~~~-~~~~~s~~~~ 1316 (1317)
T KOG0612|consen 1249 DHMDK---IMAPCK--YDTSSARHLLLLAESTEDQAKWVQRLVKKIPKPLPAAGSFSRSSPRT-LKISLSQSIR 1316 (1317)
T ss_pred             ccccc---ccCccc--ccccCCccceeccCCchHHHHHHHHHhcccCCCCCcccceecccccc-chhhhhhhhc
Confidence            55554   589999  999999999999999999999999999999999877555     222 6677776654


No 4  
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain. Rok (Rho- associated kinase) pleckstrin homology (PH) domain. Rok is a serine/threonine kinase that binds GTP-rho. It consists of a kinase domain, a coiled coil region and a PH domain. The Rok PH domain is interrupted by a C1 domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=98.18  E-value=4.5e-07  Score=70.03  Aligned_cols=32  Identities=53%  Similarity=0.836  Sum_probs=27.9

Q ss_pred             cCChhhhhHHhhcCCChHHHHHHHHHHHHHhhh
Q psy14437        105 HCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQK  137 (160)
Q Consensus       105 ~~D~~tAk~lLlla~s~eeq~~WVs~L~kkIpk  137 (160)
                      -|+.. +++|||||.|.+||++||++|+|+|||
T Consensus        81 ~~~~~-~~~lllLA~s~~ek~kWV~~L~~~~~~  112 (112)
T cd01242          81 LYANE-ARDLLLLAPQTDEQNKWVSRLVKKIPK  112 (112)
T ss_pred             EeCCc-cceEEEEeCCchHHHHHHHHHHHhccC
Confidence            34433 599999999999999999999999986


No 5  
>PF00169 PH:  PH domain;  InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]. The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families:  Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....
Probab=79.41  E-value=0.95  Score=29.91  Aligned_cols=24  Identities=38%  Similarity=0.670  Sum_probs=21.7

Q ss_pred             hhHhhcCCChHHHHHHHHHHHHhH
Q psy14437         45 KEMLLLAPSTDDQKLWVQRLSKKI   68 (160)
Q Consensus        45 keLLLla~s~eeq~~WVs~L~k~I   68 (160)
                      +.++|.|.|.||...||..|.+-|
T Consensus        80 ~~~~~~~~s~~~~~~W~~~i~~~~  103 (104)
T PF00169_consen   80 KSYLFSAESEEERKRWIQAIQKAI  103 (104)
T ss_dssp             EEEEEEESSHHHHHHHHHHHHHHH
T ss_pred             cEEEEEcCCHHHHHHHHHHHHHHh
Confidence            689999999999999999998754


No 6  
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. CDEP consists of a Ferm domain, a rhoGEF (DH) domain followed by two PH domains.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=79.17  E-value=1.1  Score=33.05  Aligned_cols=28  Identities=21%  Similarity=0.418  Sum_probs=24.8

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHHhHh
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSKKIQ   69 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k~I~   69 (160)
                      +..|.+.|-|.|.||-..|+..|.+-|.
T Consensus        71 ~~~ks~~l~A~s~~Ek~~Wi~~i~~aI~   98 (99)
T cd01220          71 GGQCAITVAASTRAEKEKWLADLSKAIA   98 (99)
T ss_pred             cCCeEEEEECCCHHHHHHHHHHHHHHhh
Confidence            3457799999999999999999999885


No 7  
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain. Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a  myotubularin-related pseudo-phosphatase consisting of a Denn domain,  a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase .
Probab=78.28  E-value=1.2  Score=31.13  Aligned_cols=26  Identities=19%  Similarity=0.462  Sum_probs=22.4

Q ss_pred             hhhhHhhcCCChHHHHHHHHHHHHhH
Q psy14437         43 SAKEMLLLAPSTDDQKLWVQRLSKKI   68 (160)
Q Consensus        43 ~AkeLLLla~s~eeq~~WVs~L~k~I   68 (160)
                      ..|-+.|.|.|.||...||..|+..|
T Consensus        76 ~~r~~~~~a~s~~e~~~Wi~ai~~~i  101 (101)
T cd01235          76 SKRTYNFLAENINEAQRWKEKIQQCI  101 (101)
T ss_pred             CCceEEEECCCHHHHHHHHHHHHhhC
Confidence            45778888999999999999998765


No 8  
>PF00169 PH:  PH domain;  InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]. The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families:  Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....
Probab=74.53  E-value=1.9  Score=28.43  Aligned_cols=24  Identities=38%  Similarity=0.670  Sum_probs=21.3

Q ss_pred             hHHhhcCCChHHHHHHHHHHHHHh
Q psy14437        112 KEMLLLAPSTDDQKLWVQRLSKKI  135 (160)
Q Consensus       112 k~lLlla~s~eeq~~WVs~L~kkI  135 (160)
                      +.++|.|.|.||...||..|.+-|
T Consensus        80 ~~~~~~~~s~~~~~~W~~~i~~~~  103 (104)
T PF00169_consen   80 KSYLFSAESEEERKRWIQAIQKAI  103 (104)
T ss_dssp             EEEEEEESSHHHHHHHHHHHHHHH
T ss_pred             cEEEEEcCCHHHHHHHHHHHHHHh
Confidence            689999999999999999987644


No 9  
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain. Gab (Grb2-associated binder) pleckstrin homology (PH) domain. The Gab subfamily includes several Gab proteins, Drosophila DOS and C. elegans SOC-1. They are scaffolding adaptor proteins, which possess N-terminal PH domains and a C-terminus with proline-rich regions and multiple phosphorylation sites. Following activation of growth factor receptors, Gab proteins are tyrosine phosphorylated and activate PI3K, which generates 3-phosphoinositide lipids. By binding to these lipids via the PH domain, Gab proteins remain in proximity to the receptor, leading to further signaling. While not all Gab proteins depend on the PH domain for recruitment, it is required for Gab activity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display str
Probab=72.23  E-value=2  Score=31.26  Aligned_cols=24  Identities=25%  Similarity=0.634  Sum_probs=21.2

Q ss_pred             hhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         43 SAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        43 ~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      ..|-++|.|.|.||...||..+.+
T Consensus        83 ~~r~y~l~A~s~ee~~~Wi~~I~~  106 (108)
T cd01266          83 IVRDLYLVAKNEEEMTLWVNCICK  106 (108)
T ss_pred             CCccEEEEECCHHHHHHHHHHHHh
Confidence            468899999999999999999854


No 10 
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. CDEP consists of a Ferm domain, a rhoGEF (DH) domain followed by two PH domains.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=72.04  E-value=2  Score=31.70  Aligned_cols=26  Identities=23%  Similarity=0.440  Sum_probs=23.2

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHHHhh
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSKKIQ  136 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~kkIp  136 (160)
                      .|.+.|-|.|++|...|+..|.+-|.
T Consensus        73 ~ks~~l~A~s~~Ek~~Wi~~i~~aI~   98 (99)
T cd01220          73 QCAITVAASTRAEKEKWLADLSKAIA   98 (99)
T ss_pred             CeEEEEECCCHHHHHHHHHHHHHHhh
Confidence            46799999999999999999998774


No 11 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=69.93  E-value=2.1  Score=26.39  Aligned_cols=20  Identities=20%  Similarity=0.376  Sum_probs=18.0

Q ss_pred             cccccCcccccccccccccc
Q psy14437          8 NFNVTPIRCRIKVHKDHLNG   27 (160)
Q Consensus         8 ~~a~ecrrC~~K~Hkdh~d~   27 (160)
                      .++|+|..|.+.+|+.-.++
T Consensus        26 ~~~~~C~~C~~~~H~~C~~~   45 (50)
T cd00029          26 KQGLRCSWCKVKCHKKCADK   45 (50)
T ss_pred             cceeEcCCCCCchhhhhhcc
Confidence            68999999999999998774


No 12 
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD has a RhoGEF (DH) domain, followed by a PH domain, a FYVE domain and a C-terminal PH domain. FGD is a guanine nucleotide exchange factor that activates the Rho GTPase Cdc42. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=69.75  E-value=2.9  Score=30.30  Aligned_cols=26  Identities=23%  Similarity=0.391  Sum_probs=23.6

Q ss_pred             hhHhhcCCChHHHHHHHHHHHHhHhh
Q psy14437         45 KEMLLLAPSTDDQKLWVQRLSKKIQK   70 (160)
Q Consensus        45 keLLLla~s~eeq~~WVs~L~k~I~k   70 (160)
                      |-+.|.|.|+||...||..|..-|.+
T Consensus        76 rsf~l~A~s~eEk~~W~~ai~~~i~~  101 (101)
T cd01219          76 RCLELQARTQKEKNDWVQAIFSIIDE  101 (101)
T ss_pred             cEEEEEcCCHHHHHHHHHHHHHHhhC
Confidence            88899999999999999999988753


No 13 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=69.54  E-value=1.6  Score=26.59  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=17.0

Q ss_pred             ccccCcccccccccccccc
Q psy14437          9 FNVTPIRCRIKVHKDHLNG   27 (160)
Q Consensus         9 ~a~ecrrC~~K~Hkdh~d~   27 (160)
                      ++++|..|.+.+|+.-+.+
T Consensus        26 ~~~~C~~C~~~~H~~C~~~   44 (49)
T smart00109       26 QGLRCSWCKVKCHKKCAEK   44 (49)
T ss_pred             CCcCCCCCCchHHHHHHhh
Confidence            6999999999999987774


No 14 
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain. PARIS-1 pleckstrin homology (PH) domain. PARIS-1 contains a  PH domain and a TBC-type GTPase catalytic domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=69.39  E-value=2.7  Score=30.18  Aligned_cols=33  Identities=21%  Similarity=0.381  Sum_probs=25.0

Q ss_pred             CcccccCchhhhhHhhcCCChHHHHHHHHHHHHh
Q psy14437         34 PCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKK   67 (160)
Q Consensus        34 pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~k~   67 (160)
                      ++.+... +..|-..|.|.|.||...||.-|..+
T Consensus        61 ~~~F~i~-t~~r~y~l~A~s~~e~~~Wi~al~~~   93 (95)
T cd01265          61 KGRFEIH-SNNEVIALKASSDKQMNYWLQALQSK   93 (95)
T ss_pred             CCEEEEE-cCCcEEEEECCCHHHHHHHHHHHHhh
Confidence            4444432 34577899999999999999998865


No 15 
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. CNK is believed to regulate the activity and the subcellular localization of RAS activated RAF. CNK is composed of N-terminal SAM and PDZ domains along with a central or C-terminal PH domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskelet
Probab=67.84  E-value=3.9  Score=28.59  Aligned_cols=23  Identities=30%  Similarity=0.466  Sum_probs=20.4

Q ss_pred             hhhhHhhcCCChHHHHHHHHHHH
Q psy14437         43 SAKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        43 ~AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      ..+.++|-|.|.||+++||..|.
T Consensus        72 ~~~~~~f~a~s~~e~~~Wi~ai~   94 (96)
T cd01260          72 VYKSFYFAAETLDDLSQWVNHLI   94 (96)
T ss_pred             CCcEEEEEeCCHHHHHHHHHHHH
Confidence            44789999999999999999885


No 16 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=67.12  E-value=3.4  Score=26.27  Aligned_cols=28  Identities=18%  Similarity=0.247  Sum_probs=21.4

Q ss_pred             cccccccCccccccccccccccccccccCcc
Q psy14437          6 VLNFNVTPIRCRIKVHKDHLNGKEEAIAPCK   36 (160)
Q Consensus         6 ~~~~a~ecrrC~~K~Hkdh~d~ke~~i~pCk   36 (160)
                      +...+|+|..|.+.+|++-+++   +...|.
T Consensus        24 ~~~~g~~C~~C~~~~H~~C~~~---~~~~C~   51 (53)
T PF00130_consen   24 LGKQGYRCSWCGLVCHKKCLSK---VPPSCG   51 (53)
T ss_dssp             SSSCEEEETTTT-EEETTGGCT---SSSBSS
T ss_pred             CCCCeEEECCCCChHhhhhhhh---cCCCCC
Confidence            4577999999999999999885   445554


No 17 
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase)  pleckstrin homology (PH) domain. MRCK (myotonic dystrophy-related Cdc42-binding kinase)  pleckstrin homology (PH) domain. MRCK consists of a serine/threonine kinase domain, a cysteine rich (C1) region, a PH domain and a p21 binding motif. It has been shown to promote cytoskeletal reorganization, which affects many biological processes.  The MRCK PH domain is responsible for its targeting to cell to cell junctions. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=67.00  E-value=2.9  Score=33.07  Aligned_cols=22  Identities=32%  Similarity=0.567  Sum_probs=19.8

Q ss_pred             hhHHhhcCCChHHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~  132 (160)
                      -.-|||||.|-.|-++||.-|.
T Consensus        95 ~~~~~~lA~s~~eK~kWV~aL~  116 (122)
T cd01243          95 KCSTLMLADTEEEKSKWVGALS  116 (122)
T ss_pred             ccEEEEEeCCchHHHHHHHHHH
Confidence            4678999999999999999886


No 18 
>smart00233 PH Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
Probab=66.55  E-value=3.8  Score=26.17  Aligned_cols=24  Identities=38%  Similarity=0.652  Sum_probs=20.6

Q ss_pred             hhHhhcCCChHHHHHHHHHHHHhH
Q psy14437         45 KEMLLLAPSTDDQKLWVQRLSKKI   68 (160)
Q Consensus        45 keLLLla~s~eeq~~WVs~L~k~I   68 (160)
                      +.+++.|.|.+|.+.|+..|..-+
T Consensus        78 ~~~~f~~~s~~~~~~W~~~i~~~~  101 (102)
T smart00233       78 RSYLLQAESEEEREEWVDALRKAI  101 (102)
T ss_pred             ceEEEEcCCHHHHHHHHHHHHHhh
Confidence            578889999999999999987643


No 19 
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain. Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a  myotubularin-related pseudo-phosphatase consisting of a Denn domain,  a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase .
Probab=66.24  E-value=3.3  Score=28.84  Aligned_cols=25  Identities=16%  Similarity=0.452  Sum_probs=20.8

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHHHh
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSKKI  135 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~kkI  135 (160)
                      .|-+.|.|.|.||...||..|..-|
T Consensus        77 ~r~~~~~a~s~~e~~~Wi~ai~~~i  101 (101)
T cd01235          77 KRTYNFLAENINEAQRWKEKIQQCI  101 (101)
T ss_pred             CceEEEECCCHHHHHHHHHHHHhhC
Confidence            4667778999999999999987544


No 20 
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. This protein consists of two C2 domains, followed by a RasGAP domain, a PH domain and a BTK domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=65.67  E-value=2.9  Score=30.91  Aligned_cols=23  Identities=22%  Similarity=0.332  Sum_probs=20.6

Q ss_pred             hhhHhhcCCChHHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      .+-+.|-|.+.+|++.||+-|.+
T Consensus        75 ~r~~yi~a~s~~E~~~Wi~al~k   97 (98)
T cd01244          75 DDTMQLQFEAPVEATDWLNALEK   97 (98)
T ss_pred             CCeEEEECCCHHHHHHHHHHHhc
Confidence            46799999999999999999875


No 21 
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha is a phophatidlyinositide binding protein consisting of an N-terminal ArfGAP domain and two PH domains. In response to growth factor activation, PI3K phosphorylates phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 1 is recruited to the plasma membrane following growth factor stimulation by specific binding of its PH domain to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 2 is constitutively bound to the plasma membrane since it binds phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate with equal affinity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specifici
Probab=65.45  E-value=3.8  Score=29.87  Aligned_cols=27  Identities=11%  Similarity=0.493  Sum_probs=24.0

Q ss_pred             hhhhHhhcCCChHHHHHHHHHHHHhHh
Q psy14437         43 SAKEMLLLAPSTDDQKLWVQRLSKKIQ   69 (160)
Q Consensus        43 ~AkeLLLla~s~eeq~~WVs~L~k~I~   69 (160)
                      ..|-.+|-|.|.||...||..|.+.|.
T Consensus        75 ~~Rty~l~a~s~~e~~~Wi~ai~~v~~  101 (103)
T cd01251          75 PERKFLFACETEQDRREWIAAFQNVLS  101 (103)
T ss_pred             CCeEEEEECCCHHHHHHHHHHHHHHhc
Confidence            367889999999999999999998874


No 22 
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain. Cytohesin Pleckstrin homology (PH) domain. Cytohesin is an ARF-Guanine nucleotide Exchange Factor (GEF), which has a Sec7-type Arf-GEFdomain and a pleckstrin homology domain. It specifically binds phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4, 5)P3) via its PH domain and it acts as a PI 3-kinase effector mediating biological responses such as cell adhesion and membrane trafficking.  PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=65.11  E-value=4.7  Score=29.91  Aligned_cols=24  Identities=13%  Similarity=0.379  Sum_probs=20.3

Q ss_pred             hhcCCChHHHHHHHHHHHHhHhhc
Q psy14437         48 LLLAPSTDDQKLWVQRLSKKIQKC   71 (160)
Q Consensus        48 LLla~s~eeq~~WVs~L~k~I~k~   71 (160)
                      .|-|.+.||.+.||..|..-|..+
T Consensus        93 ~~~A~s~~e~~~Wi~al~~~~~~~  116 (125)
T cd01252          93 RISAANDEEMDEWIKSIKASISPN  116 (125)
T ss_pred             EEECCCHHHHHHHHHHHHHHHhcC
Confidence            377999999999999999887433


No 23 
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain. Gab (Grb2-associated binder) pleckstrin homology (PH) domain. The Gab subfamily includes several Gab proteins, Drosophila DOS and C. elegans SOC-1. They are scaffolding adaptor proteins, which possess N-terminal PH domains and a C-terminus with proline-rich regions and multiple phosphorylation sites. Following activation of growth factor receptors, Gab proteins are tyrosine phosphorylated and activate PI3K, which generates 3-phosphoinositide lipids. By binding to these lipids via the PH domain, Gab proteins remain in proximity to the receptor, leading to further signaling. While not all Gab proteins depend on the PH domain for recruitment, it is required for Gab activity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display str
Probab=64.58  E-value=3.6  Score=29.97  Aligned_cols=23  Identities=22%  Similarity=0.615  Sum_probs=20.1

Q ss_pred             hhhHHhhcCCChHHHHHHHHHHH
Q psy14437        110 SAKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       110 tAk~lLlla~s~eeq~~WVs~L~  132 (160)
                      ..|-.+|.|.|.||+..||..+.
T Consensus        83 ~~r~y~l~A~s~ee~~~Wi~~I~  105 (108)
T cd01266          83 IVRDLYLVAKNEEEMTLWVNCIC  105 (108)
T ss_pred             CCccEEEEECCHHHHHHHHHHHH
Confidence            35778899999999999999884


No 24 
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. CNK is believed to regulate the activity and the subcellular localization of RAS activated RAF. CNK is composed of N-terminal SAM and PDZ domains along with a central or C-terminal PH domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskelet
Probab=64.05  E-value=3.2  Score=29.06  Aligned_cols=22  Identities=32%  Similarity=0.502  Sum_probs=19.2

Q ss_pred             hhHHhhcCCChHHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~  132 (160)
                      .+.++|-|.|.||+.+||..|.
T Consensus        73 ~~~~~f~a~s~~e~~~Wi~ai~   94 (96)
T cd01260          73 YKSFYFAAETLDDLSQWVNHLI   94 (96)
T ss_pred             CcEEEEEeCCHHHHHHHHHHHH
Confidence            3678899999999999999874


No 25 
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase)  pleckstrin homology (PH) domain. MRCK (myotonic dystrophy-related Cdc42-binding kinase)  pleckstrin homology (PH) domain. MRCK consists of a serine/threonine kinase domain, a cysteine rich (C1) region, a PH domain and a p21 binding motif. It has been shown to promote cytoskeletal reorganization, which affects many biological processes.  The MRCK PH domain is responsible for its targeting to cell to cell junctions. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=64.01  E-value=3.2  Score=32.84  Aligned_cols=22  Identities=32%  Similarity=0.567  Sum_probs=19.8

Q ss_pred             hhhHhhcCCChHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      -.-|||||.|-.|-++||.-|.
T Consensus        95 ~~~~~~lA~s~~eK~kWV~aL~  116 (122)
T cd01243          95 KCSTLMLADTEEEKSKWVGALS  116 (122)
T ss_pred             ccEEEEEeCCchHHHHHHHHHH
Confidence            4679999999999999999875


No 26 
>cd00821 PH Pleckstrin homology (PH) domain. Pleckstrin homology (PH) domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=63.08  E-value=3.8  Score=25.93  Aligned_cols=21  Identities=29%  Similarity=0.651  Sum_probs=19.5

Q ss_pred             hhHhhcCCChHHHHHHHHHHH
Q psy14437         45 KEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        45 keLLLla~s~eeq~~WVs~L~   65 (160)
                      +.++|.|.|.+|...|+..|.
T Consensus        74 ~~~~~~~~s~~~~~~W~~~l~   94 (96)
T cd00821          74 RSYLLQAESEEEREEWIEALQ   94 (96)
T ss_pred             cEEEEEeCCHHHHHHHHHHHh
Confidence            888999999999999999885


No 27 
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD has a RhoGEF (DH) domain, followed by a PH domain, a FYVE domain and a C-terminal PH domain. FGD is a guanine nucleotide exchange factor that activates the Rho GTPase Cdc42. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=62.16  E-value=4.8  Score=29.17  Aligned_cols=25  Identities=24%  Similarity=0.391  Sum_probs=22.5

Q ss_pred             hHHhhcCCChHHHHHHHHHHHHHhh
Q psy14437        112 KEMLLLAPSTDDQKLWVQRLSKKIQ  136 (160)
Q Consensus       112 k~lLlla~s~eeq~~WVs~L~kkIp  136 (160)
                      |-+.|-|.|+||...||..|..-|.
T Consensus        76 rsf~l~A~s~eEk~~W~~ai~~~i~  100 (101)
T cd01219          76 RCLELQARTQKEKNDWVQAIFSIID  100 (101)
T ss_pred             cEEEEEcCCHHHHHHHHHHHHHHhh
Confidence            6788999999999999999988774


No 28 
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain. Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain. Clg contains a RhoGEF (DH) domain and a PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=61.46  E-value=6.3  Score=29.30  Aligned_cols=34  Identities=21%  Similarity=0.557  Sum_probs=26.3

Q ss_pred             Ccccc---cCchhhhhHhhcCCChHHHHHHHHHHHHhH
Q psy14437         34 PCKLH---CDPNSAKEMLLLAPSTDDQKLWVQRLSKKI   68 (160)
Q Consensus        34 pCk~n---~D~~~AkeLLLla~s~eeq~~WVs~L~k~I   68 (160)
                      ||++.   +| ....-+.|-|.|.|+=+.|+.+|.+-|
T Consensus        59 ~~~F~v~~~~-~p~~~~~l~A~s~e~K~~W~~~i~~~i   95 (97)
T cd01222          59 PLCFRVIPFD-DPKGALQLTARNREEKRIWTQQLKRAM   95 (97)
T ss_pred             CcEEEEEecC-CCceEEEEEecCHHHHHHHHHHHHHHh
Confidence            78874   33 222478899999999999999998754


No 29 
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool/Pix contains an N-terminal SH3 domain followed by a RhoGEF (DH) and PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=60.69  E-value=4.8  Score=31.31  Aligned_cols=24  Identities=17%  Similarity=0.451  Sum_probs=20.8

Q ss_pred             HHhhcCCChHHHHHHHHHHHHHhh
Q psy14437        113 EMLLLAPSTDDQKLWVQRLSKKIQ  136 (160)
Q Consensus       113 ~lLlla~s~eeq~~WVs~L~kkIp  136 (160)
                      -+++..+|++|-..|+.||.+.|+
T Consensus        87 ~i~v~C~~~~e~~~Wl~hL~~~~~  110 (111)
T cd01225          87 RIVVVCNNPQDAQEWVELLNANNP  110 (111)
T ss_pred             cEEEEeCCHHHHHHHHHHHHhhcC
Confidence            367889999999999999998764


No 30 
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool/Pix contains an N-terminal SH3 domain followed by a RhoGEF (DH) and PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=60.51  E-value=4.8  Score=31.31  Aligned_cols=24  Identities=17%  Similarity=0.451  Sum_probs=20.8

Q ss_pred             hHhhcCCChHHHHHHHHHHHHhHh
Q psy14437         46 EMLLLAPSTDDQKLWVQRLSKKIQ   69 (160)
Q Consensus        46 eLLLla~s~eeq~~WVs~L~k~I~   69 (160)
                      -+++..+|++|-+.|+.+|.+.|+
T Consensus        87 ~i~v~C~~~~e~~~Wl~hL~~~~~  110 (111)
T cd01225          87 RIVVVCNNPQDAQEWVELLNANNP  110 (111)
T ss_pred             cEEEEeCCHHHHHHHHHHHHhhcC
Confidence            466788999999999999998774


No 31 
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain. Ephexin Pleckstrin homology (PH) domain. Ephexin contains a RhoGEF (DH) followed by a PH domain and an SH3 domain. The ephexin PH domain is believed to act with the DH domain in mediating protein-protein interactions with the Eph receptor. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=60.38  E-value=3.2  Score=32.55  Aligned_cols=21  Identities=38%  Similarity=0.650  Sum_probs=18.7

Q ss_pred             hhHHhhcCCChHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRL  131 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L  131 (160)
                      -.+|+|=|.|.+|..+||+-|
T Consensus        98 ~~el~L~a~S~sdr~rWi~Al  118 (125)
T cd01221          98 QAELLLSADSQSDRERWLSAL  118 (125)
T ss_pred             EEEEEEECCCHHHHHHHHHhc
Confidence            467899999999999999876


No 32 
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. This protein consists of two C2 domains, followed by a RasGAP domain, a PH domain and a BTK domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=60.34  E-value=3.6  Score=30.43  Aligned_cols=23  Identities=22%  Similarity=0.332  Sum_probs=20.2

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~k  133 (160)
                      .+-+.|-|+|.+|+..||+-|.|
T Consensus        75 ~r~~yi~a~s~~E~~~Wi~al~k   97 (98)
T cd01244          75 DDTMQLQFEAPVEATDWLNALEK   97 (98)
T ss_pred             CCeEEEECCCHHHHHHHHHHHhc
Confidence            35789999999999999998865


No 33 
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain. PARIS-1 pleckstrin homology (PH) domain. PARIS-1 contains a  PH domain and a TBC-type GTPase catalytic domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=60.32  E-value=4.9  Score=28.82  Aligned_cols=24  Identities=29%  Similarity=0.473  Sum_probs=20.3

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSKK  134 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~kk  134 (160)
                      .|-..|-|.|.||...||.-|..+
T Consensus        70 ~r~y~l~A~s~~e~~~Wi~al~~~   93 (95)
T cd01265          70 NEVIALKASSDKQMNYWLQALQSK   93 (95)
T ss_pred             CcEEEEECCCHHHHHHHHHHHHhh
Confidence            456788999999999999998764


No 34 
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain. Tec pleckstrin homology (PH) domain. Proteins in the Tec family of cytoplasmic protein tyrosine kinases that includes Bruton's tyrosine kinase (BTK), BMX, IL2-inducible T-cell kinase (Itk) and Tec. These proteins generally have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. Tec PH domains tether these proteins to membranes following the activation of PI3K and its subsequent phosphorylation of phosphoinositides. The importance of PH domain membrane anchoring is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain, which causes X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few dis
Probab=58.54  E-value=5.2  Score=29.27  Aligned_cols=23  Identities=22%  Similarity=0.606  Sum_probs=19.7

Q ss_pred             hhhHhhcCCChHHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      .+-+.|.|.|.||++.||.-|.+
T Consensus        83 ~r~~yl~A~s~~er~~WI~ai~~  105 (106)
T cd01238          83 EGTLYVFAPTEELRKRWIKALKQ  105 (106)
T ss_pred             CCeEEEEcCCHHHHHHHHHHHHh
Confidence            46778899999999999998864


No 35 
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain. Ephexin Pleckstrin homology (PH) domain. Ephexin contains a RhoGEF (DH) followed by a PH domain and an SH3 domain. The ephexin PH domain is believed to act with the DH domain in mediating protein-protein interactions with the Eph receptor. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=58.51  E-value=3.9  Score=32.08  Aligned_cols=24  Identities=33%  Similarity=0.616  Sum_probs=20.3

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHH
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      +.-++|+|=|.|.+|..+|++-|.
T Consensus        96 gk~~el~L~a~S~sdr~rWi~Al~  119 (125)
T cd01221          96 DKQAELLLSADSQSDRERWLSALA  119 (125)
T ss_pred             CCEEEEEEECCCHHHHHHHHHhcC
Confidence            445789999999999999998763


No 36 
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain. Centaurin Pleckstrin homology (PH) domain. Centaurin beta and gamma consist of a PH domain, an ArfGAP domain and three ankyrin repeats. Centaurain gamma also has an N-terminal Ras homology domain. Centaurin alpha has a different domain architecture and its PH domain is in a different subfamily.  Centaurin can bind to phosphatidlyinositol (3,4,5)P3.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=58.50  E-value=5.4  Score=26.84  Aligned_cols=21  Identities=19%  Similarity=0.441  Sum_probs=19.2

Q ss_pred             hhHhhcCCChHHHHHHHHHHH
Q psy14437         45 KEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        45 keLLLla~s~eeq~~WVs~L~   65 (160)
                      +.++|-|.+.||.++||.-|.
T Consensus        72 ~~~~f~a~s~~~~~~Wi~al~   92 (94)
T cd01250          72 KTWHFQADSEEERDDWISAIQ   92 (94)
T ss_pred             cEEEEECCCHHHHHHHHHHHh
Confidence            778899999999999999885


No 37 
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain. Outspread Pleckstrin homology (PH) domain. Outspread contains two PH domains and a C-terminal coiled-coil region. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=57.95  E-value=5.1  Score=30.05  Aligned_cols=25  Identities=20%  Similarity=0.416  Sum_probs=21.8

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      +-.|.+.|.|.|.||++.|++-|..
T Consensus        78 tp~R~f~l~Aete~E~~~Wi~~l~~  102 (104)
T cd01236          78 TPDKEHFIKAETKEEISWWLNMLMV  102 (104)
T ss_pred             CCCceEEEEeCCHHHHHHHHHHHHh
Confidence            3358899999999999999998875


No 38 
>cd01218 PH_phafin2 Phafin2  Pleckstrin Homology (PH) domain. Phafin2  Pleckstrin Homology (PH) domain. Phafin contains a PH domain and a FYVE domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=57.80  E-value=6.3  Score=29.58  Aligned_cols=29  Identities=14%  Similarity=0.436  Sum_probs=24.8

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHHhHhh
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSKKIQK   70 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k~I~k   70 (160)
                      +..|-..+.|.|.+|...|+.+|.+-|..
T Consensus        72 ~~~kSf~v~A~s~~eK~eWl~~i~~ai~~  100 (104)
T cd01218          72 TPTKSFAVYAATETEKREWMLHINKCVTD  100 (104)
T ss_pred             cCCeEEEEEcCCHHHHHHHHHHHHHHHHH
Confidence            34667789999999999999999988854


No 39 
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain. Outspread Pleckstrin homology (PH) domain. Outspread contains two PH domains and a C-terminal coiled-coil region. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=57.20  E-value=5.3  Score=29.96  Aligned_cols=23  Identities=22%  Similarity=0.439  Sum_probs=20.6

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~k  133 (160)
                      .|.+.|.|.|.||++.||.-|.+
T Consensus        80 ~R~f~l~Aete~E~~~Wi~~l~~  102 (104)
T cd01236          80 DKEHFIKAETKEEISWWLNMLMV  102 (104)
T ss_pred             CceEEEEeCCHHHHHHHHHHHHh
Confidence            58899999999999999998864


No 40 
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. PH domains are only found in eukaryotes, and are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.  The IRS PH domain targets IRS molecules to the plasma membrane, usually in response to insulin stimulation.
Probab=53.60  E-value=7.1  Score=28.99  Aligned_cols=21  Identities=24%  Similarity=0.363  Sum_probs=19.0

Q ss_pred             hHHhhcCCChHHHHHHHHHHH
Q psy14437        112 KEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       112 k~lLlla~s~eeq~~WVs~L~  132 (160)
                      +-++|.|.|.+||..|+..|.
T Consensus        79 r~f~l~aese~E~~~Wi~~i~   99 (101)
T cd01257          79 EYFAVAAENEAEQDSWYQALL   99 (101)
T ss_pred             ceEEEEeCCHHHHHHHHHHHh
Confidence            678899999999999999885


No 41 
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha is a phophatidlyinositide binding protein consisting of an N-terminal ArfGAP domain and two PH domains. In response to growth factor activation, PI3K phosphorylates phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 1 is recruited to the plasma membrane following growth factor stimulation by specific binding of its PH domain to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 2 is constitutively bound to the plasma membrane since it binds phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate with equal affinity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specifici
Probab=53.28  E-value=7.9  Score=28.19  Aligned_cols=26  Identities=12%  Similarity=0.507  Sum_probs=22.9

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHHHhh
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSKKIQ  136 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~kkIp  136 (160)
                      -|..+|-|.|.+|...||..|.+-|.
T Consensus        76 ~Rty~l~a~s~~e~~~Wi~ai~~v~~  101 (103)
T cd01251          76 ERKFLFACETEQDRREWIAAFQNVLS  101 (103)
T ss_pred             CeEEEEECCCHHHHHHHHHHHHHHhc
Confidence            67788999999999999999988774


No 42 
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain. Centaurin Pleckstrin homology (PH) domain. Centaurin beta and gamma consist of a PH domain, an ArfGAP domain and three ankyrin repeats. Centaurain gamma also has an N-terminal Ras homology domain. Centaurin alpha has a different domain architecture and its PH domain is in a different subfamily.  Centaurin can bind to phosphatidlyinositol (3,4,5)P3.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=52.31  E-value=7.1  Score=26.26  Aligned_cols=21  Identities=19%  Similarity=0.441  Sum_probs=18.9

Q ss_pred             hHHhhcCCChHHHHHHHHHHH
Q psy14437        112 KEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       112 k~lLlla~s~eeq~~WVs~L~  132 (160)
                      +.++|-|.|.||.+.||.-|.
T Consensus        72 ~~~~f~a~s~~~~~~Wi~al~   92 (94)
T cd01250          72 KTWHFQADSEEERDDWISAIQ   92 (94)
T ss_pred             cEEEEECCCHHHHHHHHHHHh
Confidence            778899999999999999874


No 43 
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain. Tec pleckstrin homology (PH) domain. Proteins in the Tec family of cytoplasmic protein tyrosine kinases that includes Bruton's tyrosine kinase (BTK), BMX, IL2-inducible T-cell kinase (Itk) and Tec. These proteins generally have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. Tec PH domains tether these proteins to membranes following the activation of PI3K and its subsequent phosphorylation of phosphoinositides. The importance of PH domain membrane anchoring is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain, which causes X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few dis
Probab=51.62  E-value=12  Score=27.41  Aligned_cols=22  Identities=23%  Similarity=0.634  Sum_probs=18.7

Q ss_pred             hHHhhcCCChHHHHHHHHHHHH
Q psy14437        112 KEMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus       112 k~lLlla~s~eeq~~WVs~L~k  133 (160)
                      +-+-|.|.|.+|++.||.-|.+
T Consensus        84 r~~yl~A~s~~er~~WI~ai~~  105 (106)
T cd01238          84 GTLYVFAPTEELRKRWIKALKQ  105 (106)
T ss_pred             CeEEEEcCCHHHHHHHHHHHHh
Confidence            5677889999999999998754


No 44 
>PF10880 DUF2673:  Protein of unknown function (DUF2673);  InterPro: IPR024247 This family of proteins with unknown function appears to be restricted to Rickettsiae spp.
Probab=50.54  E-value=10  Score=26.94  Aligned_cols=19  Identities=47%  Similarity=0.681  Sum_probs=15.6

Q ss_pred             HhhcCCChHHHHHHHHHHH
Q psy14437        114 MLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       114 lLlla~s~eeq~~WVs~L~  132 (160)
                      --+.|-|.++|+.||.-|-
T Consensus        33 tqi~amst~~qq~wvaslt   51 (65)
T PF10880_consen   33 TQIQAMSTDDQQAWVASLT   51 (65)
T ss_pred             HHHHHhcchhHHHHHHHhh
Confidence            3467889999999999874


No 45 
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. PH domains are only found in eukaryotes, and are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.  The IRS PH domain targets IRS molecules to the plasma membrane, usually in response to insulin stimulation.
Probab=47.93  E-value=9.1  Score=28.44  Aligned_cols=22  Identities=23%  Similarity=0.342  Sum_probs=19.4

Q ss_pred             hhhHhhcCCChHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      .+-.+|.|.|.+||..|+..|.
T Consensus        78 dr~f~l~aese~E~~~Wi~~i~   99 (101)
T cd01257          78 DEYFAVAAENEAEQDSWYQALL   99 (101)
T ss_pred             CceEEEEeCCHHHHHHHHHHHh
Confidence            3678899999999999999875


No 46 
>cd01218 PH_phafin2 Phafin2  Pleckstrin Homology (PH) domain. Phafin2  Pleckstrin Homology (PH) domain. Phafin contains a PH domain and a FYVE domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=47.27  E-value=10  Score=28.48  Aligned_cols=26  Identities=15%  Similarity=0.468  Sum_probs=22.5

Q ss_pred             hhHHhhcCCChHHHHHHHHHHHHHhh
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLSKKIQ  136 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~kkIp  136 (160)
                      .|-..+.|.|++|...|+.+|.+-|.
T Consensus        74 ~kSf~v~A~s~~eK~eWl~~i~~ai~   99 (104)
T cd01218          74 TKSFAVYAATETEKREWMLHINKCVT   99 (104)
T ss_pred             CeEEEEEcCCHHHHHHHHHHHHHHHH
Confidence            46677999999999999999988764


No 47 
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain. Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain. Oxysterol binding proteins are a multigene family that is conserved in yeast, flies, worms, mammals and plants. They all contain a C-terminal oxysterol binding domain, and most contain an N-terminal PH domain. OSBP PH domains bind to membrane phosphoinositides and thus likely play an important role in intracellular targeting. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=46.55  E-value=11  Score=25.15  Aligned_cols=23  Identities=30%  Similarity=0.549  Sum_probs=20.0

Q ss_pred             hhhhHhhcCCChHHHHHHHHHHH
Q psy14437         43 SAKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        43 ~AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      ..+.++|-|.+.||-..||.-|.
T Consensus        67 ~~~~~~~~a~s~~e~~~Wi~al~   89 (91)
T cd01246          67 GDKTLHLRANSEEERQRWVDALE   89 (91)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHH
Confidence            34788999999999999999875


No 48 
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain. Phospholipase D (PLD) pleckstrin homology (PH) domain.  PLD hydrolyzes phosphatidylcholine to phosphatidic acid (PtdOH), which can bind target proteins. PLD contains a PH domain, a PX domain and four conserved PLD signature domains. The PLD PH domain is specific for bisphosphorylated inositides. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=43.57  E-value=11  Score=28.25  Aligned_cols=25  Identities=24%  Similarity=0.448  Sum_probs=22.5

Q ss_pred             chhhhhHhhcCCChHHHHHHHHHHH
Q psy14437         41 PNSAKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        41 ~~~AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      .+..|.|.|.|.|.++++.||.-|.
T Consensus        95 ~t~~R~~~l~a~s~~~~~~Wi~~i~  119 (121)
T cd01254          95 TNSNRSLKLKCKSSRKLKQWMASIE  119 (121)
T ss_pred             EcCCcEEEEEeCCHHHHHHHHHHHH
Confidence            4778999999999999999998875


No 49 
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain. Cytohesin Pleckstrin homology (PH) domain. Cytohesin is an ARF-Guanine nucleotide Exchange Factor (GEF), which has a Sec7-type Arf-GEFdomain and a pleckstrin homology domain. It specifically binds phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4, 5)P3) via its PH domain and it acts as a PI 3-kinase effector mediating biological responses such as cell adhesion and membrane trafficking.  PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=42.39  E-value=22  Score=26.28  Aligned_cols=23  Identities=13%  Similarity=0.421  Sum_probs=19.6

Q ss_pred             hhcCCChHHHHHHHHHHHHHhhh
Q psy14437        115 LLLAPSTDDQKLWVQRLSKKIQK  137 (160)
Q Consensus       115 Llla~s~eeq~~WVs~L~kkIpk  137 (160)
                      .|-|.|.||...||..|..-|..
T Consensus        93 ~~~A~s~~e~~~Wi~al~~~~~~  115 (125)
T cd01252          93 RISAANDEEMDEWIKSIKASISP  115 (125)
T ss_pred             EEECCCHHHHHHHHHHHHHHHhc
Confidence            36799999999999999887743


No 50 
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain. Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain. The GPBP protein is a kinase that phosphorylates an N-terminal region of the alpha 3 chain of type IV collagen , which is commonly known as the goodpasture antigen.  It has has an N-terminal PH domain and a C-terminal START domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cyt
Probab=41.74  E-value=11  Score=26.99  Aligned_cols=25  Identities=20%  Similarity=0.401  Sum_probs=21.5

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      +..+.+.|-|.|.+|-+.||.-|.+
T Consensus        66 ~~~r~~~L~A~s~~e~~~Wi~al~~   90 (91)
T cd01247          66 NENVVWYLRAENSQSRLLWMDSVVR   90 (91)
T ss_pred             CCCeEEEEEeCCHHHHHHHHHHHhh
Confidence            3448899999999999999998864


No 51 
>TIGR03504 FimV_Cterm FimV C-terminal domain. This protein is found at the extreme C-terminus of FimV from Pseudomonas aeruginosa, and of TspA of Neisseria meningitidis. Disruption of the former blocks twitching motility from type IV pili; Semmler, et al. suggest a role in peptidoglycan layer remodelling required by type IV fimbrial systems.
Probab=40.97  E-value=34  Score=22.12  Aligned_cols=29  Identities=21%  Similarity=0.374  Sum_probs=23.7

Q ss_pred             ChhhhhHHh--hcCCChHHHHHHHHHHHHHh
Q psy14437        107 DPNSAKEML--LLAPSTDDQKLWVQRLSKKI  135 (160)
Q Consensus       107 D~~tAk~lL--lla~s~eeq~~WVs~L~kkI  135 (160)
                      |...||++|  |+....++|+.=...|+.+|
T Consensus        14 d~e~Ar~lL~evl~~~~~~q~~eA~~LL~~l   44 (44)
T TIGR03504        14 DLEGARELLEEVIEEGDEAQRQEARALLAQL   44 (44)
T ss_pred             ChHHHHHHHHHHHHcCCHHHHHHHHHHHhcC
Confidence            678899998  67888888998888887764


No 52 
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain. BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain.  The BCR-related protein has a RhoGEF(DH) domain followed by a PH domain, a C2 domain and a RhoGAP domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinases, tyrosine kinases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=40.01  E-value=13  Score=28.31  Aligned_cols=28  Identities=18%  Similarity=0.329  Sum_probs=23.5

Q ss_pred             ChhhhhHHhhcCCChHHHHHHHHHHHHH
Q psy14437        107 DPNSAKEMLLLAPSTDDQKLWVQRLSKK  134 (160)
Q Consensus       107 D~~tAk~lLlla~s~eeq~~WVs~L~kk  134 (160)
                      .-+..|-+.++|.|++|-..|+.|+.+-
T Consensus        66 ~~~~~KSf~~~asS~~Er~eW~~hI~~~   93 (96)
T cd01228          66 HNKNGKSYTFLLSSDYERSEWRESIQKL   93 (96)
T ss_pred             cccCCceEEEEecCHHHHHHHHHHHHHH
Confidence            3445788899999999999999998753


No 53 
>PF15405 PH_5:  Pleckstrin homology domain; PDB: 2Z0Q_A.
Probab=38.72  E-value=18  Score=28.13  Aligned_cols=36  Identities=14%  Similarity=0.349  Sum_probs=26.0

Q ss_pred             cccCcccccCchhhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         31 AIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        31 ~i~pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      ..-|.++.|=...-..+-|-|+|.-+++.|++++-+
T Consensus        98 ~~yp~~~~hlG~~~~~~TLyA~s~~~R~~W~e~I~~  133 (135)
T PF15405_consen   98 SLYPFTFRHLGRKGYSYTLYASSAQARQKWLEKIEE  133 (135)
T ss_dssp             SEEEEEE---GGG-EEEEEE-SSHHHHHHHHHHHHH
T ss_pred             CccCEEEEEcCCCceEEEEEeCCHHHHHHHHHHHHh
Confidence            456888877666667799999999999999998864


No 54 
>COG3965 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]
Probab=37.34  E-value=35  Score=30.81  Aligned_cols=35  Identities=20%  Similarity=0.412  Sum_probs=28.2

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHHhHhhcCCCCCC
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANT   77 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k~I~k~~~~~~s   77 (160)
                      +.-||+|||||+ |.|++=.++..+-.+|-++.+..
T Consensus       218 ~al~eiLlmtP~-el~q~ies~~~~~v~k~~f~~~~  252 (314)
T COG3965         218 SALREILLMTPN-ELQQSIESHAHEIVEKYGFPSYH  252 (314)
T ss_pred             HHHHHHHhcCcH-HHHHHHHHHHHHHHHHhcCchHH
Confidence            456999999999 88999888888888887765433


No 55 
>cd00900 PH-like Pleckstrin homology-like domain. Pleckstrin homology-like domain.  This family includes the PH domain, both the Shc-like and IRS-like PTB domains, the ran-binding domain, the EVH1 domain, a domain in neurobeachin and the third domain of FERM. All of these domains have a PH fold, but lack significant sequence similarity. They are generally involved in targeting to protein to the appropriate cellular location or interacting with a binding partner.  The PH domain is commonly found in eukaryotic signaling proteins. This domain family possesses multiple functions including the ability to bind inositol phosphates and to other proteins.
Probab=37.20  E-value=17  Score=23.07  Aligned_cols=23  Identities=22%  Similarity=0.524  Sum_probs=20.3

Q ss_pred             hhhHhhcCCChHHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      -+.+.|-|.+.+|-+.|+..|..
T Consensus        76 ~~~~~~~~~~~~~~~~W~~al~~   98 (99)
T cd00900          76 RRVFVFQADSEEEAQEWVEALQQ   98 (99)
T ss_pred             cEEEEEEcCCHHHHHHHHHHHhc
Confidence            57889999999999999998864


No 56 
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain. Phospholipase D (PLD) pleckstrin homology (PH) domain.  PLD hydrolyzes phosphatidylcholine to phosphatidic acid (PtdOH), which can bind target proteins. PLD contains a PH domain, a PX domain and four conserved PLD signature domains. The PLD PH domain is specific for bisphosphorylated inositides. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=36.78  E-value=15  Score=27.52  Aligned_cols=25  Identities=24%  Similarity=0.448  Sum_probs=21.7

Q ss_pred             hhhhhHHhhcCCChHHHHHHHHHHH
Q psy14437        108 PNSAKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       108 ~~tAk~lLlla~s~eeq~~WVs~L~  132 (160)
                      .+..|.+.|.|.|..+++.||.-+.
T Consensus        95 ~t~~R~~~l~a~s~~~~~~Wi~~i~  119 (121)
T cd01254          95 TNSNRSLKLKCKSSRKLKQWMASIE  119 (121)
T ss_pred             EcCCcEEEEEeCCHHHHHHHHHHHH
Confidence            3567899999999999999998764


No 57 
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain. Unc-104 pleckstrin homology (PH) domain. Unc-104 is a kinesin-like protein containing an N-terminal kinesin catalytic domain, followed by a forkhead associated domain with a C-terminal PH domain. These proteins are responsible for the transport of membrane vesicles along microtubules. The mechanism involves the binding of the  PH domain to phosphatidiylinositol (4,5) P2-containing liposomes.
Probab=36.71  E-value=18  Score=25.98  Aligned_cols=24  Identities=21%  Similarity=0.304  Sum_probs=20.4

Q ss_pred             hhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         43 SAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        43 ~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      ..|-+.|-|.|.||.+.||..|..
T Consensus        73 ~~rt~~~~A~s~~e~~~Wi~ai~~   96 (100)
T cd01233          73 KHRGYLFQALSDKEMIDWLYALNP   96 (100)
T ss_pred             CCCEEEEEcCCHHHHHHHHHHhhh
Confidence            357788889999999999998864


No 58 
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain. Akt pleckstrin homology (PH) domain.  Akt (Protein Kinase B (PKB)) is a phosphatidylinositol 3'-kinase (PI3K)-dependent Ser/Thr kinase. The PH domain recruits Akt to the plasma membrane by binding to phosphoinositides (PtdIns-3,4-P2) and is required for activation. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=36.37  E-value=29  Score=25.05  Aligned_cols=20  Identities=10%  Similarity=0.423  Sum_probs=16.7

Q ss_pred             hhcCCChHHHHHHHHHHHHh
Q psy14437         48 LLLAPSTDDQKLWVQRLSKK   67 (160)
Q Consensus        48 LLla~s~eeq~~WVs~L~k~   67 (160)
                      .+-|.|.||++.||.-|...
T Consensus        82 ~f~a~s~ee~~eWi~ai~~v  101 (102)
T cd01241          82 TFHVESPEEREEWIHAIQTV  101 (102)
T ss_pred             EEEeCCHHHHHHHHHHHHhh
Confidence            45689999999999998754


No 59 
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain. Unc-104 pleckstrin homology (PH) domain. Unc-104 is a kinesin-like protein containing an N-terminal kinesin catalytic domain, followed by a forkhead associated domain with a C-terminal PH domain. These proteins are responsible for the transport of membrane vesicles along microtubules. The mechanism involves the binding of the  PH domain to phosphatidiylinositol (4,5) P2-containing liposomes.
Probab=36.35  E-value=16  Score=26.16  Aligned_cols=22  Identities=23%  Similarity=0.339  Sum_probs=19.0

Q ss_pred             hhHHhhcCCChHHHHHHHHHHH
Q psy14437        111 AKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       111 Ak~lLlla~s~eeq~~WVs~L~  132 (160)
                      .|-+.|-|.|+||.+.||..|.
T Consensus        74 ~rt~~~~A~s~~e~~~Wi~ai~   95 (100)
T cd01233          74 HRGYLFQALSDKEMIDWLYALN   95 (100)
T ss_pred             CCEEEEEcCCHHHHHHHHHHhh
Confidence            4667888999999999999875


No 60 
>COG3965 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]
Probab=36.11  E-value=39  Score=30.53  Aligned_cols=41  Identities=22%  Similarity=0.399  Sum_probs=32.1

Q ss_pred             CccccCChhhhhHHhhcCCChHHHHHHHHHHHHHhhhcCCCC
Q psy14437        101 PCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKA  142 (160)
Q Consensus       101 PCk~~~D~~tAk~lLlla~s~eeq~~WVs~L~kkIpk~~~~~  142 (160)
                      |.|+--=.+.-||+|++|++ |.|++=.++-..-++|.++.+
T Consensus       210 plPlg~vk~al~eiLlmtP~-el~q~ies~~~~~v~k~~f~~  250 (314)
T COG3965         210 PLPLGTVKSALREILLMTPN-ELQQSIESHAHEIVEKYGFPS  250 (314)
T ss_pred             eccHHHHHHHHHHHHhcCcH-HHHHHHHHHHHHHHHHhcCch
Confidence            55554445667999999999 889898888888888877654


No 61 
>PF13831 PHD_2:  PHD-finger; PDB: 2L43_A 2KU3_A.
Probab=36.08  E-value=10  Score=23.53  Aligned_cols=20  Identities=20%  Similarity=0.197  Sum_probs=13.7

Q ss_pred             cccccCcccccccccccccc
Q psy14437          8 NFNVTPIRCRIKVHKDHLNG   27 (160)
Q Consensus         8 ~~a~ecrrC~~K~Hkdh~d~   27 (160)
                      ||-+.|.+|.+-+|+.=.+.
T Consensus         2 n~ll~C~~C~v~VH~~CYGv   21 (36)
T PF13831_consen    2 NPLLFCDNCNVAVHQSCYGV   21 (36)
T ss_dssp             CEEEE-SSS--EEEHHHHT-
T ss_pred             CceEEeCCCCCcCChhhCCc
Confidence            78899999999999876654


No 62 
>PF15410 PH_9:  Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A.
Probab=35.16  E-value=17  Score=27.15  Aligned_cols=32  Identities=13%  Similarity=0.338  Sum_probs=22.4

Q ss_pred             CcccccCchhhhhHhhcCCChHHHHHHHHHHH
Q psy14437         34 PCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        34 pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      +.++-.-+.+-.|.|+-|.+.||-+.||..+-
T Consensus        84 ~~VFrL~~~dg~e~Lfqa~~~~~m~~Wi~~IN  115 (119)
T PF15410_consen   84 KNVFRLRTADGSEYLFQASDEEEMNEWIDAIN  115 (119)
T ss_dssp             SSEEEEE-TTS-EEEEE-SSHHHHHHHHHHHH
T ss_pred             CeEEEEEeCCCCEEEEECCCHHHHHHHHHHHh
Confidence            44444334556899999999999999999874


No 63 
>PF15413 PH_11:  Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C.
Probab=34.50  E-value=20  Score=26.61  Aligned_cols=26  Identities=19%  Similarity=0.388  Sum_probs=21.3

Q ss_pred             chhhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         41 PNSAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        41 ~~~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      .+-.|.|.|.+-+.||+..||.-|.+
T Consensus        86 ~T~~kt~~l~~~t~~d~~~Wi~aL~~  111 (112)
T PF15413_consen   86 FTPTKTFHLRCETREDRYDWIEALQE  111 (112)
T ss_dssp             E-SS-EEEEEESSHHHHHHHHHHHHH
T ss_pred             ECCCcEEEEEECCHHHHHHHHHHHHh
Confidence            34579999999999999999998864


No 64 
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain. Phospholipase C (PLC) pleckstrin homology (PH) domain. There are several isozymes of PLC (beta, gamma, delta, epsilon. zeta). While, PLC beta, gamma and delta all have N-terminal PH domains, lipid binding specificity is not conserved between them.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=33.13  E-value=30  Score=25.36  Aligned_cols=21  Identities=43%  Similarity=0.759  Sum_probs=18.3

Q ss_pred             hhHhhcCCChHHHHHHHHHHH
Q psy14437         45 KEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        45 keLLLla~s~eeq~~WVs~L~   65 (160)
                      +-|=|+|+|.|+-+.||.-|.
T Consensus        93 k~L~lVA~s~~~a~~W~~gL~  113 (115)
T cd01248          93 KSLDLVAPSEEEAKTWVSGLR  113 (115)
T ss_pred             eEEEEEECCHHHHHHHHHHHh
Confidence            447899999999999999875


No 65 
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain. Beta-spectrin pleckstrin homology (PH) domain. Beta spectrin binds actin and functions as a major component of the cytoskeleton underlying cellular membranes. Beta spectrin consists of multiple spectrin repeats followed by a PH domain,  which binds to Inositol-1,4,5-Trisphosphate. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions.  PH domains are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=31.70  E-value=25  Score=24.84  Aligned_cols=24  Identities=29%  Similarity=0.621  Sum_probs=20.9

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHH
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLS   65 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~   65 (160)
                      ...+.++|-|.|.||-..||.-|.
T Consensus        79 ~~~~~~~f~a~s~e~~~~Wi~aL~  102 (104)
T cd01253          79 PDGAEFLFQAPDEEEMSSWVRALK  102 (104)
T ss_pred             cCCCEEEEECCCHHHHHHHHHHHh
Confidence            356789999999999999999874


No 66 
>COG1860 Uncharacterized protein conserved in archaea [Function unknown]
Probab=31.42  E-value=18  Score=29.52  Aligned_cols=35  Identities=20%  Similarity=0.400  Sum_probs=26.0

Q ss_pred             cccccccccCccccccc--------cccccccccccccCcccc
Q psy14437          4 LSVLNFNVTPIRCRIKV--------HKDHLNGKEEAIAPCKLH   38 (160)
Q Consensus         4 ~~~~~~a~ecrrC~~K~--------Hkdh~d~ke~~i~pCk~n   38 (160)
                      +-++-|+-||+.|++|-        ||-++-.=.+.+.||.+|
T Consensus        19 Fif~Gp~eeCk~Cr~k~~C~nLe~GrrYkVv~VR~~~~~C~ih   61 (147)
T COG1860          19 FIFLGPAEECKDCRLKNVCLNLEEGRRYKVVEVRSQVQPCPIH   61 (147)
T ss_pred             EEEecCcccccCCcchheeeccCCCcEEEEEEehhccccccee
Confidence            34678999999999983        555555444678899996


No 67 
>PF11939 DUF3457:  Protein of unknown function (DUF3457);  InterPro: IPR023994  Members of this family are chaperones for the assembly of [NiFe] hydrogenases, in the family of HybE, which is specific for hydrogenase-2 of Escherichia coli. Members often have an additional N-terminal rubredoxin domain. ; PDB: 2KC5_A.
Probab=31.22  E-value=16  Score=29.45  Aligned_cols=36  Identities=14%  Similarity=0.190  Sum_probs=21.9

Q ss_pred             CcccccccccccCccccccccccccccccccccCcccc
Q psy14437          1 MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLH   38 (160)
Q Consensus         1 ~~~~~~~~~a~ecrrC~~K~Hkdh~d~ke~~i~pCk~n   38 (160)
                      |+.|.++||++.+.-+-+.-|-++.--  -+|.|+-+|
T Consensus        20 M~~lP~~NpaL~VeAvGF~~~eg~~~G--vlvTPW~mn   55 (155)
T PF11939_consen   20 MRDLPFYNPALPVEAVGFRRFEGQWLG--VLVTPWFMN   55 (155)
T ss_dssp             -GGG-----SS--EEEEEEEETTEEEE--EEE-SS-EE
T ss_pred             hcCCCccCCCCCeEEeeeEEECCeEEE--EEechhhHh
Confidence            788999999999999999999887753  377999998


No 68 
>cd01264 PH_melted Melted pleckstrin homology (PH) domain. Melted pleckstrin homology (PH) domain. The melted protein has a C-terminal PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=31.03  E-value=24  Score=26.51  Aligned_cols=24  Identities=25%  Similarity=0.429  Sum_probs=20.9

Q ss_pred             hhhHHhhcCCChHHHHHHHHHHHH
Q psy14437        110 SAKEMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus       110 tAk~lLlla~s~eeq~~WVs~L~k  133 (160)
                      ..|-++|-|.|.+|...||+.|..
T Consensus        76 p~rt~~l~A~se~e~e~WI~~i~~   99 (101)
T cd01264          76 ADKTYILKAKDEKNAEEWLQCLNI   99 (101)
T ss_pred             CCceEEEEeCCHHHHHHHHHHHHh
Confidence            347789999999999999999864


No 69 
>PF15413 PH_11:  Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C.
Probab=30.81  E-value=23  Score=26.19  Aligned_cols=26  Identities=19%  Similarity=0.388  Sum_probs=21.2

Q ss_pred             hhhhhHHhhcCCChHHHHHHHHHHHH
Q psy14437        108 PNSAKEMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus       108 ~~tAk~lLlla~s~eeq~~WVs~L~k  133 (160)
                      .+-.|.+.|-+-+.||+..||.-|.+
T Consensus        86 ~T~~kt~~l~~~t~~d~~~Wi~aL~~  111 (112)
T PF15413_consen   86 FTPTKTFHLRCETREDRYDWIEALQE  111 (112)
T ss_dssp             E-SS-EEEEEESSHHHHHHHHHHHHH
T ss_pred             ECCCcEEEEEECCHHHHHHHHHHHHh
Confidence            45579999999999999999998864


No 70 
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 Pleckstrin Homology (PH) domain. EFA6  is an guanine nucleotide exchange factor for ARF6, which is involved in membrane recycling. It consists of a SEC7 domain followed by a PH domain.  The EFA6 PH domain regulates its association with the plasma membrane. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=30.55  E-value=24  Score=26.94  Aligned_cols=27  Identities=19%  Similarity=0.433  Sum_probs=23.0

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHHhH
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSKKI   68 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k~I   68 (160)
                      ...++.||-|++.||=..||..|.--.
T Consensus        85 ~~g~~~lfqA~~~ee~~~Wi~~I~~~~  111 (117)
T cd01230          85 ADWREFLFQTSSLKELQSWIERINVVA  111 (117)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHHH
Confidence            446899999999999999999987543


No 71 
>TIGR02753 sodN superoxide dismutase, Ni. This superoxide dismutase uses nickel, rather than iron, manganese, copper, or zinc. Its gene is always accompanied by a gene for a required protease.
Probab=30.35  E-value=23  Score=28.79  Aligned_cols=18  Identities=28%  Similarity=0.457  Sum_probs=15.7

Q ss_pred             cCccccCChhhhhHHhhc
Q psy14437        100 APCKLHCDPNSAKEMLLL  117 (160)
Q Consensus       100 aPCk~~~D~~tAk~lLll  117 (160)
                      ..|++|.|+..|.+||=+
T Consensus       114 ~~~Kq~~D~a~a~~Ll~~  131 (145)
T TIGR02753       114 SAAKVNIDKAAAQELLQY  131 (145)
T ss_pred             HHHhcCCCHHHHHHHHHH
Confidence            489999999999999854


No 72 
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain. BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain.  The BCR-related protein has a RhoGEF(DH) domain followed by a PH domain, a C2 domain and a RhoGAP domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinases, tyrosine kinases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=30.13  E-value=26  Score=26.74  Aligned_cols=27  Identities=19%  Similarity=0.336  Sum_probs=23.1

Q ss_pred             chhhhhHhhcCCChHHHHHHHHHHHHh
Q psy14437         41 PNSAKEMLLLAPSTDDQKLWVQRLSKK   67 (160)
Q Consensus        41 ~~~AkeLLLla~s~eeq~~WVs~L~k~   67 (160)
                      -...|-..++|.|++|-..|+.|+.+-
T Consensus        67 ~~~~KSf~~~asS~~Er~eW~~hI~~~   93 (96)
T cd01228          67 NKNGKSYTFLLSSDYERSEWRESIQKL   93 (96)
T ss_pred             ccCCceEEEEecCHHHHHHHHHHHHHH
Confidence            345788899999999999999999753


No 73 
>PF15409 PH_8:  Pleckstrin homology domain
Probab=30.11  E-value=43  Score=24.79  Aligned_cols=32  Identities=28%  Similarity=0.401  Sum_probs=24.3

Q ss_pred             CcccccCchhhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         34 PCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        34 pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      .|.+..|.+ +.=.-|-|.|++|=+.||+.|.+
T Consensus        56 ~~~I~idsg-~~i~hLKa~s~~~f~~Wv~aL~~   87 (89)
T PF15409_consen   56 SRRIDIDSG-DEIWHLKAKSQEDFQRWVSALQK   87 (89)
T ss_pred             CCEEEEEcC-CeEEEEEcCCHHHHHHHHHHHHh
Confidence            455655654 33567889999999999999974


No 74 
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain. Son of Sevenless (SOS) Pleckstrin homology (PH) domain. SOS is a Ras guanine nucleotide exchange factor. It has a RhoGEF (DbH) domain, a PH domain, and a RasGEF domain.  The SOS PH domain can bind to inositol 1,4,5-triphosphate. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=28.77  E-value=36  Score=25.99  Aligned_cols=27  Identities=15%  Similarity=0.380  Sum_probs=23.1

Q ss_pred             hhhHhhcCCChHHHHHHHHHHHHhHhh
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLSKKIQK   70 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~k~I~k   70 (160)
                      .+-++|.|.++||=+.|+.+|..-|-+
T Consensus        85 ~~s~~l~Akt~eeK~~Wm~~l~~~~~~  111 (112)
T cd01261          85 GNSVIFSAKNAEEKNNWMAALISVQTK  111 (112)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHHhcC
Confidence            355899999999999999999887754


No 75 
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain. Son of Sevenless (SOS) Pleckstrin homology (PH) domain. SOS is a Ras guanine nucleotide exchange factor. It has a RhoGEF (DbH) domain, a PH domain, and a RasGEF domain.  The SOS PH domain can bind to inositol 1,4,5-triphosphate. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=28.30  E-value=37  Score=25.91  Aligned_cols=26  Identities=15%  Similarity=0.388  Sum_probs=22.4

Q ss_pred             hHHhhcCCChHHHHHHHHHHHHHhhh
Q psy14437        112 KEMLLLAPSTDDQKLWVQRLSKKIQK  137 (160)
Q Consensus       112 k~lLlla~s~eeq~~WVs~L~kkIpk  137 (160)
                      +-+.|.|.++||-+.|+.+|..-|-|
T Consensus        86 ~s~~l~Akt~eeK~~Wm~~l~~~~~~  111 (112)
T cd01261          86 NSVIFSAKNAEEKNNWMAALISVQTK  111 (112)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHhcC
Confidence            45889999999999999999987744


No 76 
>PF15410 PH_9:  Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A.
Probab=27.32  E-value=28  Score=25.89  Aligned_cols=24  Identities=17%  Similarity=0.494  Sum_probs=19.0

Q ss_pred             hhhhHHhhcCCChHHHHHHHHHHH
Q psy14437        109 NSAKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       109 ~tAk~lLlla~s~eeq~~WVs~L~  132 (160)
                      .+-.+.|+-|.|.||-..||..+-
T Consensus        92 ~dg~e~Lfqa~~~~~m~~Wi~~IN  115 (119)
T PF15410_consen   92 ADGSEYLFQASDEEEMNEWIDAIN  115 (119)
T ss_dssp             TTS-EEEEE-SSHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHh
Confidence            345799999999999999999863


No 77 
>cd01264 PH_melted Melted pleckstrin homology (PH) domain. Melted pleckstrin homology (PH) domain. The melted protein has a C-terminal PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=27.13  E-value=30  Score=25.97  Aligned_cols=25  Identities=24%  Similarity=0.418  Sum_probs=21.4

Q ss_pred             hhhhhHhhcCCChHHHHHHHHHHHH
Q psy14437         42 NSAKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        42 ~~AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      +..|-++|-|.|.+|...||+.|..
T Consensus        75 tp~rt~~l~A~se~e~e~WI~~i~~   99 (101)
T cd01264          75 TADKTYILKAKDEKNAEEWLQCLNI   99 (101)
T ss_pred             cCCceEEEEeCCHHHHHHHHHHHHh
Confidence            3457789999999999999999864


No 78 
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 Pleckstrin Homology (PH) domain. EFA6  is an guanine nucleotide exchange factor for ARF6, which is involved in membrane recycling. It consists of a SEC7 domain followed by a PH domain.  The EFA6 PH domain regulates its association with the plasma membrane. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=26.90  E-value=27  Score=26.64  Aligned_cols=25  Identities=20%  Similarity=0.482  Sum_probs=21.6

Q ss_pred             hhhHHhhcCCChHHHHHHHHHHHHH
Q psy14437        110 SAKEMLLLAPSTDDQKLWVQRLSKK  134 (160)
Q Consensus       110 tAk~lLlla~s~eeq~~WVs~L~kk  134 (160)
                      ..++.|+-|.+.||=..||..|.--
T Consensus        86 ~g~~~lfqA~~~ee~~~Wi~~I~~~  110 (117)
T cd01230          86 DWREFLFQTSSLKELQSWIERINVV  110 (117)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHH
Confidence            3579999999999999999988643


No 79 
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain. Trio pleckstrin homology (PH) domain. Trio is a multidomain signaling protein that contains two RhoGEF(DH)-PH domains in tandem.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=26.89  E-value=65  Score=24.56  Aligned_cols=36  Identities=31%  Similarity=0.725  Sum_probs=27.1

Q ss_pred             Ccccc---cCch-hhhhHhhcCCChHHHHHHHHHHHHhHh
Q psy14437         34 PCKLH---CDPN-SAKEMLLLAPSTDDQKLWVQRLSKKIQ   69 (160)
Q Consensus        34 pCk~n---~D~~-~AkeLLLla~s~eeq~~WVs~L~k~I~   69 (160)
                      ||++-   .++. +..-..|=|+|.|+-+.||.+|.+-++
T Consensus        74 ~~kF~i~~~~~~~~~~~~ilqA~s~e~K~~W~~~I~~il~  113 (114)
T cd01232          74 PCRFALWSGDPPISDNRIILKANSQETKQEWVKKIREILQ  113 (114)
T ss_pred             CceEEEEeCCCCCCceEEEEECCCHHHHHHHHHHHHHHhh
Confidence            78862   2333 335678999999999999999987653


No 80 
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain. Collybistin pleckstrin homology (PH) domain. Collybistin is GEF which induces submembrane clustering of the receptor-associated peripheral membrane protein gephyrin.  It consists of an SH3 domain, followed by a RhoGEF(dbH) and PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=26.47  E-value=28  Score=26.83  Aligned_cols=23  Identities=13%  Similarity=0.278  Sum_probs=19.9

Q ss_pred             hhhHhhcCCChHHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      .+-.++.|.++|+-++|+..|..
T Consensus        83 ~~~~~f~~Kt~e~K~~Wm~a~~~  105 (109)
T cd01224          83 DEWYLFSFKSAERKHRWLSAFAL  105 (109)
T ss_pred             CeEEEEEECCHHHHHHHHHHHHH
Confidence            44589999999999999999873


No 81 
>PLN03207 stomagen; Provisional
Probab=23.47  E-value=33  Score=26.82  Aligned_cols=16  Identities=19%  Similarity=0.312  Sum_probs=13.4

Q ss_pred             ccCccccccccccccc
Q psy14437         11 VTPIRCRIKVHKDHLN   26 (160)
Q Consensus        11 ~ecrrC~~K~Hkdh~d   26 (160)
                      -|||-|+.||--+-|-
T Consensus        79 necrgcr~kc~~eqvp   94 (113)
T PLN03207         79 NECRGCRYKCRAEQVP   94 (113)
T ss_pred             ccccCccccccceecc
Confidence            4999999999877654


No 82 
>KOG3523|consensus
Probab=22.20  E-value=39  Score=33.49  Aligned_cols=31  Identities=26%  Similarity=0.402  Sum_probs=23.1

Q ss_pred             CccccCChhhhhHHhhcCCChHHHHHHHHHHH
Q psy14437        101 PCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLS  132 (160)
Q Consensus       101 PCk~~~D~~tAk~lLlla~s~eeq~~WVs~L~  132 (160)
                      +.--|.|-.. -+|||=|.|+-|++||++-|.
T Consensus       561 tLl~N~~~~~-~e~lL~a~s~Sd~~RWi~Al~  591 (695)
T KOG3523|consen  561 TLLSNHQGRQ-TELLLSAESQSDRQRWISALR  591 (695)
T ss_pred             ehhhccCCCc-eeeeecCCchHHHHHHHHhcC
Confidence            3344444333 379999999999999999886


No 83 
>PF15405 PH_5:  Pleckstrin homology domain; PDB: 2Z0Q_A.
Probab=21.43  E-value=79  Score=24.54  Aligned_cols=35  Identities=14%  Similarity=0.348  Sum_probs=24.4

Q ss_pred             ccCccccCChhhhhHHhhcCCChHHHHHHHHHHHH
Q psy14437         99 IAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus        99 saPCk~~~D~~tAk~lLlla~s~eeq~~WVs~L~k  133 (160)
                      .=|..+.|=...-..+-|-|+|.-+++.|+.++-+
T Consensus        99 ~yp~~~~hlG~~~~~~TLyA~s~~~R~~W~e~I~~  133 (135)
T PF15405_consen   99 LYPFTFRHLGRKGYSYTLYASSAQARQKWLEKIEE  133 (135)
T ss_dssp             EEEEEE---GGG-EEEEEE-SSHHHHHHHHHHHHH
T ss_pred             ccCEEEEEcCCCceEEEEEeCCHHHHHHHHHHHHh
Confidence            34777766666666789999999999999998865


No 84 
>PF15408 PH_7:  Pleckstrin homology domain
Probab=21.33  E-value=49  Score=25.45  Aligned_cols=23  Identities=17%  Similarity=0.356  Sum_probs=19.8

Q ss_pred             hhhHhhcCCChHHHHHHHHHHHH
Q psy14437         44 AKEMLLLAPSTDDQKLWVQRLSK   66 (160)
Q Consensus        44 AkeLLLla~s~eeq~~WVs~L~k   66 (160)
                      -+.+-+.|.|.|.+|+|+.-|-+
T Consensus        73 ~~~~~~FA~S~~~~~~Wi~~mN~   95 (104)
T PF15408_consen   73 RRHVQCFASSKKVCQSWIQVMNS   95 (104)
T ss_pred             cchhhhhhhHHHHHHHHHHHhcC
Confidence            46788999999999999987754


No 85 
>PF15409 PH_8:  Pleckstrin homology domain
Probab=21.08  E-value=80  Score=23.35  Aligned_cols=21  Identities=38%  Similarity=0.461  Sum_probs=17.8

Q ss_pred             HHhhcCCChHHHHHHHHHHHH
Q psy14437        113 EMLLLAPSTDDQKLWVQRLSK  133 (160)
Q Consensus       113 ~lLlla~s~eeq~~WVs~L~k  133 (160)
                      =.=|-|.|++|=+.||+.|.+
T Consensus        67 i~hLKa~s~~~f~~Wv~aL~~   87 (89)
T PF15409_consen   67 IWHLKAKSQEDFQRWVSALQK   87 (89)
T ss_pred             EEEEEcCCHHHHHHHHHHHHh
Confidence            455789999999999999864


Done!