Diaphorina citri psyllid: psy14444

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-

MLMIHQDIDLPELQGEIDDVCTKKCERAIKVINDRVIVEDTCLCFNALGGLPGQAFTKANKTLLRVSTSMSLIFDNLKFTKATRYRKVLVIFIPTDEIKHKVDFLHSLRKKTETQNHHQFDSTTTIRYSNIGMKNLDLYTWLKLENIVPTLYTSTYTYLKFEIEDELPIQTVYLKFSIGTYEKHKRAIKAINDRVIVEDTCLCFNALGGLPGPYVKWFLKKIGPAGLHKMLAGFEDKSAIAVCTFAFGDRDGSVRLFRGETHGKIVEPRGPDTFGWDSCFQPDGFEQTYAEMLKEQKNQISHRNKAVLKLQDFFVKMNATESPYVKWFLKKVGPTGLYKMLAGFEDKSAKAICTFAFGDRDGSVRLFRGETHGKIVEPRGPDTFGWDSCFQPDGFKQTYAEMPKEQKNRISHRNKAVLKLQDFFVKMNANLRKNSNRRIGK

cEEEEcccccccccccHHHHHHHHHHHHHHHHcccEEEEEcEEEEEcccccccccccccHHHHHHHccccHHHHccccccccCEEEEEEEEEcccccccccHHHHHccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEcccccccCEEEcccccccHHHHHHHHccccccEEEEEEEEEEECccccCEEEEEEEEEEEEcccccccccccccEECcccccccccccHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHccccccccEEEEEEEEEECccccEEEEEEEEcEEEEccccccccccccEEECcccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccc

*LMIHQDIDLPELQGEIDDVCTKKCERAIKVINDRVIVEDTCLCFNALGGLPGQAFTKANKTLLRVSTSMSLIFDNLKFTKATRYRKVLVIFIPTDEIKHKVDFLHSLRKK***QNHHQFDSTTTIRYSNIGMKNLDLYTWLKLENIVPTLYTSTYTYLKFEIEDELPIQTVYLKFSIGTYEKHKRAIKAINDRVIVEDTCLCFNALGGLPGPYVKWFLKKIGPAGLHKMLAGFEDKSAIAVCTFAFGDRDGSVRLFRGETHGKIVEPRGPDTFGWDSCFQPDGFEQTYAEMLKEQKNQISHRNKAVLKLQDFFVKMNATESPYVKWFLKKVGPTGLYKMLAGFEDKSAKAICTFAFGDRDGSVRLFRGETHGKIVEPRGPDTFGWDSCFQPDGFKQTYAEMPKEQKNRISHRNKAVLKLQDFFVKM**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Inosine triphosphate pyrophosphatase	Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.	confident	F6Y089
Inosine triphosphate pyrophosphatase	Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.	confident	Q9GYG4
Inosine triphosphate pyrophosphatase	Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.	confident	A3LVK6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0036217 [MF]	dGTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0008152 [BP]	metabolic process	probable	GO:0008150
GO:0036218 [MF]	dTTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0035870 [MF]	dITP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0008828 [MF]	dATP pyrophosphohydrolase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0047840 [MF]	dCTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0036219 [MF]	GTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0004170 [MF]	dUTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036222 [MF]	XTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036221 [MF]	UTP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036220 [MF]	ITP diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CAR, chain A
Confidence level:very confident
Coverage over the Query: 123-133,144-318
View the alignment between query and template
View the model in PyMOL

Template: 2CAR, chain A
Confidence level:very confident
Coverage over the Query: 315-425
View the alignment between query and template
View the model in PyMOL