Diaphorina citri psyllid: psy14446


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MNTAVKGIDVIDRKVENGILKSHRLISSQWGLPNWARSVVGSTNIFYASERSEVNPITRQMTLETTNLTYGHVIAVDERLCYQPHPEDNSKTLLKQEAVVTVRGIPLSSYVENMLTSKISHNAGK
cccEEEEEEEEEEEEEccEEEEEEEEEECccccHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEccccEEEEEEEEEEEECccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHccc
*NTAVKGIDVIDRKVENGILKSHRLISSQWGLPNWARSVVGSTNIFYASERSEVNPITRQMTLETTNLTYGHVIAVDERLCYQPHPEDNSKTLLKQEAVVTVRGIPLSSYVENMLTSKISH****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTAVKGIDVIDRKVENGILKSHRLISSQWGLPNWARSVVGSTNIFYASERSEVNPITRQMTLETTNLTYGHVIAVDERLCYQPHPEDNSKTLLKQEAVVTVRGIPLSSYVENMLTSKISHNAGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein slowmo Required to regulate peristaltic movement and also for germline proliferation in males and females.confidentQ9V3U9
Protein slowmo homolog 2 confidentQ9Y3B1
Protein slowmo homolog 2 confidentQ9CYY7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031314 [CC]extrinsic to mitochondrial inner membraneprobableGO:0044464, GO:0019898, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0031312, GO:0031975, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KCM, chain A
Confidence level:probable
Coverage over the Query: 7-85
View the alignment between query and template
View the model in PyMOL