Diaphorina citri psyllid: psy14448


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
VIHKKIDLPELQGEIDDICKKKCEKAIKTINDRVIVEDTCLCFNALRGLPGDSQKNRFTRVTRKSCPFGLYKMLAGFIDKSAKAICTFAFGDRDGSKLQEFVQILGPNVPFRMIHKNIDLPELQGEIDDLCKKKCERAMKSINDRVIVEDTCLCFNALGGLPGPYVKWFLQKIGPFGLYKMLAGFIDKSAKAICTFAFGDRDGSVRLFRGEAQGKIVKPRGRNMLSWDSCFQPDGFKQTYGEMPDEQKNQVSYRYKAALKLKDFFMKMNANLRTNSKKGR
ccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEcEEEEccccccccHHHHHHHHHHccccccHHHHHHHcccccccccHHHHEEEcccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEccEEEEEcccccccccHHccccccccHHHHHHHcccccccEEEEEEEEEECccccCEEEEEEEEEEEEcccccccccccccEECcccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHccccccccc
*IHKKIDLPELQGEIDDICKKKCEKAIKTINDRVIVEDTCLCFNALRGLPGDSQKNRFTRVTRKSCPFGLYKMLAGFIDKSAKAICTFAFGDRDGSKLQEFVQILGPNVPFRMIHKNIDLPELQGEIDDLCKKKCERAMKSINDRVIVEDTCLCFNALGGLPGPYVKWFLQKIGPFGLYKMLAGFIDKSAKAICTFAFGDRDGSVRLFRGEAQGKIVKPRGRNMLSWDSCFQPDGFKQTYGEMPDEQKNQVSYRYKAALKLKDFFMK*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VIHKKIDLPELQGEIDDICKKKCEKAIKTINDRVIVEDTCLCFNALRGLPGDSQKNRFTRVTRKSCPFGLYKMLAGFIDKSAKAICTFAFGDRDGSKLQEFVQILGPNVPFRMIHKNIDLPELQGEIDDLCKKKCERAMKSINDRVIVEDTCLCFNALGGLPGPYVKWFLQKIGPFGLYKMLAGFIDKSAKAICTFAFGDRDGSVRLFRGEAQGKIVKPRGRNMLSWDSCFQPDGFKQTYGEMPDEQKNQVSYRYKAALKLKDFFMKMNANLRTNSKKGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inosine triphosphate pyrophosphatase Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.confidentF6Y089
Inosine triphosphate pyrophosphatase Pyrophosphatase that hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) as well as 2'-deoxy-N-6-hydroxylaminopurine triposphate (dHAPTP) and xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.confidentQ9D892
Inosine triphosphate pyrophosphatase Pyrophosphatase that hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) as well as 2'-deoxy-N-6-hydroxylaminopurine triposphate (dHAPTP) and xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.confidentQ9BY32

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006193 [BP]ITP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0034641, GO:0006807, GO:0046041, GO:0072521, GO:0072523, GO:0009259, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0009199, GO:0046483, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0008152, GO:0034655, GO:0046700, GO:0009056, GO:0055086, GO:1901565, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0019693, GO:0006163, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0044237, GO:0006753, GO:0044281
GO:0047840 [MF]dCTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036217 [MF]dGTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036218 [MF]dTTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0035870 [MF]dITP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0051276 [BP]chromosome organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0008828 [MF]dATP pyrophosphohydrolase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036219 [MF]GTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0004170 [MF]dUTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036222 [MF]XTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036221 [MF]UTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429
GO:0036220 [MF]ITP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CAR, chain A
Confidence level:very confident
Coverage over the Query: 86-268
View the alignment between query and template
View the model in PyMOL
Template: 2CAR, chain A
Confidence level:very confident
Coverage over the Query: 4-107
View the alignment between query and template
View the model in PyMOL