Diaphorina citri psyllid: psy14473


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MPPLLLFLIYSYHQSFYTEGRTLPINRKQKVFPNGTLIIENVERQSDQATYTCVAKTAQGYSSRGTLEVQVMGINEKPFSGLLPKINKETSPSA
cccccEEEccccEEEEECccCEccccccEEEcccccEEEEccccccccCEEEEEEEcccccCEEEEEEEEEEcccccccccccccccccccccc
MPPLLLFLIYSYHQSFYTEGRTLPINRKQKVFPNGTLIIENVERQSDQATYTCVAKTAQGYSSRGTLEVQVMGINEKPF***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPLLLFLIYSYHQSFYTEGRTLPINRKQKVFPNGTLIIENVERQSDQATYTCVAKTAQGYSSRGTLEVQVMGINEKPFSGLLPKINKETSPSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0051635 [MF]bacterial cell surface bindingprobable
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0006909 [BP]phagocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0016319 [BP]mushroom body developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0021551 [BP]central nervous system morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0007413 [BP]axonal fasciculationprobableGO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0044707, GO:0048856, GO:0007399, GO:0032502, GO:0048812, GO:0008150
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0048846 [BP]axon extension involved in axon guidanceprobableGO:0048675, GO:0048666, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0032502, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0040011, GO:0048699, GO:0048858, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 4-75
View the alignment between query and template
View the model in PyMOL