Diaphorina citri psyllid: psy14476


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MSEDGRSKGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEDRKAHLASQYMQRIANMRMQQMGQLFQPGSTGGYFVPTLPQPQRFYGPTQMTQIRPQPRWAAAPQMRPSGQTAQGFPNIPQFRSAPRASTGQTVIRGANMSARPITGQSTMGPRGGGPMQAPGPASVSAAGRQTGGYNKYPVRNPGTQPQAQIGGIQPAAAGVQAVHVQGQEPLTSTMLAAAQPQEQKQMLGERLFPLIQRMYPELAGKITGMLLEIDNAELLYMLEHNESLKSKVEEAVAVLQAHQAKQAAVKKE
cccccccccCEEEEcccHHHHHHHHHHHcccEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHccccHHHHHHcccccccHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
******SKGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQ************Y***I**********LFQ**STGGYFVPTL******************************************************************************************************************************************************MLGERLFPLIQRMYPELAGKITGMLLEIDNAELLYMLEHNESLKSKVEEAVAV**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEDGRSKGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEDRKAHLASQYMQRIANMRMQQMGQLFQPGSTGGYFVPTLPQPQRFYGPTQMTQIRPQPRWAAAPQMRPSGQTAQGFPNIPQFRSAPRASTGQTVIRGANMSARPITGQSTMGPRGGGPMQAPGPASVSAAGRQTGGYNKYPVRNPGTQPQAQIGGIQPAAAGVQAVHVQGQEPLTSTMLAAAQPQEQKQMLGERLFPLIQRMYPELAGKITGMLLEIDNAELLYMLEHxxxxxxxxxxxxxxxxxxxxxQAAVKKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein 4 Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.confidentQ13310

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008143 [MF]poly(A) RNA bindingprobableGO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:2000623 [BP]negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0009894, GO:0009895, GO:0009892, GO:0080090, GO:0031329, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:0019219, GO:0065007, GO:0048519, GO:0045934, GO:2000622, GO:0031330, GO:0061013, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:0060255, GO:0051253, GO:0051252, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0008266 [MF]poly(U) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0060212 [BP]negative regulation of nuclear-transcribed mRNA poly(A) tail shorteningprobableGO:0009894, GO:0009895, GO:0009892, GO:0080090, GO:0031329, GO:0050684, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:0060255, GO:0065007, GO:1900151, GO:0048519, GO:0010468, GO:0050686, GO:0045934, GO:0031330, GO:0061013, GO:0050794, GO:0060211, GO:0008150, GO:0051171, GO:0051172, GO:0031440, GO:0031441, GO:0051253, GO:0051252, GO:0019219, GO:0048523
GO:0048255 [BP]mRNA stabilizationprobableGO:0019222, GO:0043489, GO:0043488, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0005844 [CC]polysomeprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0017130 [MF]poly(C) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G9L, chain A
Confidence level:very confident
Coverage over the Query: 212-298
View the alignment between query and template
View the model in PyMOL
Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 2-46,74-91
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 134-146
View the alignment between query and template
View the model in PyMOL