Diaphorina citri psyllid: psy14489

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----

MQNTLLLVDGSSCIYRAFYALPDIRNIDNFPVGALYGTIKMLRKLYKNYRATYIACIFDAKGKNFRNILYPSYKATRKKMPYNLILQINLIHQMVKAIGWPILIIKGVEADDVIGTLAKQAVTKHNLKVIISTNDKDMAQLVSNKIALINNNKIHDRTTIISRFGVSPEKIVDYFSLIGDMSDNLPGVKKIGPKTAVKLLNQYNSLENIINNANNIKGVIGKNLRFALNWLPKLKKILTIKTDCDLTKNIVSIPESLILQPKDEKLLMQLFNKYKLNKLNFLMH

ccccEEEEEccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccHHHHHcHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHcccEEEEEcccccccccccccEEEEEccccccHHHHHHHccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccHHHHcc

*QNTLLLVDGSSCIYRAFYALPDIRNIDNFPVGALYGTIKMLRKLYKNYRATYIACIFDAKGKNFRNILYPSYKATRKKMPYNLILQINLIHQMVKAIGWPILIIKGVEADDVIGTLAKQAVTKHNLKVIISTNDKDMAQLVSNKIALINNNKIHDRTTIISRFGVSPEKIVDYFSLIGDMSDNLPGVKKIGPKTAVKLLNQYNSLENIINNANNIKGVIGKNLRFALNWLPKLKKILTIKTDCDLTKNIVSIPESLILQPKDEKLLMQLFNKYKLNKLNFLM*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQNTLLLVDGSSCIYRAFYALPDIRNIDNFPVGALYGTIKMLRKLYKNYRATYIACIFDAKGKNFRNILYPSYKATRKKMPYNLILQINLIHQMVKAIGWPILIIKGVEADDVIGTLAKQAVTKHNLKVIISTNDKDMAQLVSNKIALINNNKIHDRTTIISRFGVSPEKIVDYFSLIGDMSDNLPGVKKIGPKTxxxxxxxxxxxxxxxxxxxxxKGVIGKNLRFALNWLPKLKKILTIKTDCDLTKNIVSIPESLILQPKDEKLLMQLFNKYKLNKLNFLMH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
5'-3' exonuclease	5'-3' exonuclease acting preferentially on double-stranded DNA.	confident	Q9PQ75
5'-3' exonuclease	5'-3' exonuclease acting preferentially on double-stranded DNA.	confident	Q89AD1
5'-3' exonuclease	5'-3' exonuclease acting preferentially on double-stranded DNA.	confident	Q49406

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044464 [CC]	cell part	probable	GO:0005575, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BGX, chain T
Confidence level:very confident
Coverage over the Query: 2-283
View the alignment between query and template
View the model in PyMOL