Query         psy14516
Match_columns 76
No_of_seqs    103 out of 471
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 21:53:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14516.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14516hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02148 zf-UBP:  Zn-finger in   99.2   9E-12 1.9E-16   73.0   1.3   32   45-76      1-33  (63)
  2 KOG0804|consensus               99.1 2.3E-11   5E-16   94.3   0.9   36   41-76    227-262 (493)
  3 smart00290 ZnF_UBP Ubiquitin C  99.0 1.3E-10 2.9E-15   64.5   1.8   33   44-76      1-33  (50)
  4 COG5207 UBP14 Isopeptidase T [  99.0   2E-10 4.3E-15   91.2   2.4   64   13-76    143-212 (749)
  5 KOG0944|consensus               98.9 9.8E-10 2.1E-14   88.6   2.6   62   15-76    149-219 (763)
  6 cd02669 Peptidase_C19M A subfa  97.8   1E-05 2.2E-10   61.7   2.5   37   40-76     14-50  (440)
  7 KOG1873|consensus               96.9 0.00041 8.8E-09   57.4   1.4   52   25-76     45-116 (877)
  8 PRK14890 putative Zn-ribbon RN  85.2    0.29 6.2E-06   28.8   0.1   24   41-64     35-58  (59)
  9 COG2888 Predicted Zn-ribbon RN  82.5     0.4 8.8E-06   28.4   0.0   24   41-64     37-60  (61)
 10 cd00350 rubredoxin_like Rubred  80.3     0.8 1.7E-05   23.3   0.7   20   43-62      2-25  (33)
 11 cd00729 rubredoxin_SM Rubredox  78.7     1.3 2.7E-05   22.9   1.1   14   54-67      2-15  (34)
 12 PF14803 Nudix_N_2:  Nudix N-te  73.6     2.9 6.4E-05   21.7   1.7   14   51-64     19-32  (34)
 13 PF00643 zf-B_box:  B-box zinc   68.5     3.4 7.5E-05   21.3   1.3   26   42-67      3-28  (42)
 14 COG5207 UBP14 Isopeptidase T [  65.6     1.7 3.8E-05   35.6  -0.4   50   24-73      2-57  (749)
 15 PF07754 DUF1610:  Domain of un  62.6       6 0.00013   19.2   1.4   12   50-61     12-23  (24)
 16 PF01927 Mut7-C:  Mut7-C RNAse   62.3     6.3 0.00014   26.0   1.9   13   52-64    122-134 (147)
 17 PRK11788 tetratricopeptide rep  59.8       6 0.00013   28.3   1.6   26   40-65    352-379 (389)
 18 PF04810 zf-Sec23_Sec24:  Sec23  59.5     8.7 0.00019   20.2   1.8   13   51-63     21-33  (40)
 19 PF13923 zf-C3HC4_2:  Zinc fing  58.1     7.7 0.00017   19.8   1.4   22   46-67      2-24  (39)
 20 COG1773 Rubredoxin [Energy pro  57.5     5.7 0.00012   23.0   0.9   12   51-62     33-44  (55)
 21 smart00661 RPOL9 RNA polymeras  57.4      10 0.00022   20.2   1.9   12   53-64     19-30  (52)
 22 PF08274 PhnA_Zn_Ribbon:  PhnA   57.3     6.4 0.00014   20.0   1.0   20   44-63      4-28  (30)
 23 smart00154 ZnF_AN1 AN1-like Zi  56.9      10 0.00022   20.0   1.8   28   45-72      1-32  (39)
 24 COG1997 RPL43A Ribosomal prote  55.8     9.5 0.00021   24.1   1.8   27   41-67     34-66  (89)
 25 COG5574 PEX10 RING-finger-cont  54.3     9.8 0.00021   28.4   1.9   26   41-66    214-239 (271)
 26 PF01412 ArfGap:  Putative GTPa  54.2      11 0.00024   23.9   1.9   28   40-67     11-38  (116)
 27 PRK10220 hypothetical protein;  53.8     9.9 0.00021   24.9   1.7   20   45-64      6-30  (111)
 28 TIGR00686 phnA alkylphosphonat  52.3     9.3  0.0002   25.0   1.4   20   45-64      5-29  (109)
 29 PF09538 FYDLN_acid:  Protein o  50.1      15 0.00033   23.6   2.1   26   39-64      6-36  (108)
 30 PHA02942 putative transposase;  49.4      14  0.0003   28.3   2.1   24   41-64    324-352 (383)
 31 PF10571 UPF0547:  Uncharacteri  49.1     8.5 0.00018   18.8   0.7   19   45-63      3-23  (26)
 32 COG0777 AccD Acetyl-CoA carbox  47.6     6.4 0.00014   29.7   0.1   24   40-63     26-56  (294)
 33 COG0675 Transposase and inacti  45.6      18 0.00038   25.3   2.1   25   41-65    308-333 (364)
 34 KOG2026|consensus               45.6      16 0.00036   28.9   2.0   37   40-76     27-63  (442)
 35 PF08271 TF_Zn_Ribbon:  TFIIB z  45.5      22 0.00047   18.7   2.0   16   52-67     17-32  (43)
 36 cd01121 Sms Sms (bacterial rad  45.3      12 0.00027   28.4   1.3   21   44-64      2-24  (372)
 37 KOG0317|consensus               44.9     9.9 0.00021   28.7   0.7   27   40-66    237-263 (293)
 38 smart00105 ArfGap Putative GTP  43.7      13 0.00029   23.4   1.1   26   42-67      3-28  (112)
 39 PF07282 OrfB_Zn_ribbon:  Putat  43.5      20 0.00044   20.2   1.8   23   41-63     27-55  (69)
 40 PF00096 zf-C2H2:  Zinc finger,  43.4     3.3 7.2E-05   18.6  -1.3   20   55-74      1-21  (23)
 41 PRK11823 DNA repair protein Ra  43.3      13 0.00027   28.9   1.1   25   41-65      6-32  (446)
 42 PF13719 zinc_ribbon_5:  zinc-r  42.3     7.6 0.00017   20.1  -0.2   29   22-50      2-33  (37)
 43 PF15227 zf-C3HC4_4:  zinc fing  41.9      21 0.00046   18.8   1.6   23   45-67      1-23  (42)
 44 COG1592 Rubrerythrin [Energy p  40.7      13 0.00029   25.7   0.8   13   54-66    134-146 (166)
 45 TIGR02605 CxxC_CxxC_SSSS putat  40.7      13 0.00027   20.1   0.6    6   57-62     29-34  (52)
 46 TIGR00416 sms DNA repair prote  40.3      14 0.00031   28.7   1.0   25   41-65      6-32  (454)
 47 PF13920 zf-C3HC4_3:  Zinc fing  39.5      25 0.00053   18.7   1.6   25   43-67      3-28  (50)
 48 PF05715 zf-piccolo:  Piccolo Z  38.1      26 0.00056   20.7   1.6   21   42-62     30-57  (61)
 49 COG1656 Uncharacterized conser  37.8      20 0.00044   24.9   1.3   14   51-64    127-140 (165)
 50 PRK14704 anaerobic ribonucleos  37.8      20 0.00043   29.4   1.5   23   41-63    558-581 (618)
 51 PF06221 zf-C2HC5:  Putative zi  36.0      12 0.00027   21.6   0.0   14   56-69     20-33  (57)
 52 COG1066 Sms Predicted ATP-depe  35.9      19 0.00041   28.8   1.1   22   41-62      6-29  (456)
 53 PF05191 ADK_lid:  Adenylate ki  35.0      24 0.00051   18.4   1.0   10   55-64      2-11  (36)
 54 PF08792 A2L_zn_ribbon:  A2L zi  34.6      39 0.00085   17.2   1.8   22   43-64      4-31  (33)
 55 PF11781 RRN7:  RNA polymerase   34.4      33 0.00072   17.8   1.6   22   42-63      8-34  (36)
 56 smart00547 ZnF_RBZ Zinc finger  33.6      24 0.00052   16.3   0.9    6   43-48      3-8   (26)
 57 TIGR02487 NrdD anaerobic ribon  33.5      26 0.00056   28.3   1.5   26   41-66    523-550 (579)
 58 PRK14873 primosome assembly pr  33.4      28  0.0006   28.7   1.7   23   41-63    409-431 (665)
 59 PRK09263 anaerobic ribonucleos  33.0      26 0.00056   29.2   1.4   22   41-62    640-667 (711)
 60 cd00730 rubredoxin Rubredoxin;  32.6      19 0.00042   20.1   0.5   12   55-66      2-13  (50)
 61 PRK08270 anaerobic ribonucleos  32.4      27 0.00058   28.8   1.4   23   41-63    625-648 (656)
 62 PF01780 Ribosomal_L37ae:  Ribo  32.4      27  0.0006   22.0   1.2   27   41-67     34-66  (90)
 63 PF15616 TerY-C:  TerY-C metal   32.3      38 0.00082   22.6   1.9   22   43-65     78-99  (131)
 64 PRK00762 hypA hydrogenase nick  32.1      17 0.00038   23.5   0.3   22   40-62     68-100 (124)
 65 TIGR00515 accD acetyl-CoA carb  32.1      12 0.00027   27.7  -0.5   23   41-63     25-54  (285)
 66 PF12523 DUF3725:  Protein of u  31.4      25 0.00054   21.4   0.9   12   52-63     57-68  (74)
 67 CHL00174 accD acetyl-CoA carbo  31.1      13 0.00027   28.0  -0.6   22   41-62     37-65  (296)
 68 COG2051 RPS27A Ribosomal prote  30.6      49  0.0011   19.9   2.0   27   41-67     18-51  (67)
 69 PRK05654 acetyl-CoA carboxylas  30.2      14 0.00031   27.4  -0.4   23   41-63     26-55  (292)
 70 PF07649 C1_3:  C1-like domain;  30.0      26 0.00056   17.0   0.6   20   44-63      2-24  (30)
 71 PRK07218 replication factor A;  29.7      26 0.00057   27.4   1.0   23   41-63    296-318 (423)
 72 PF00641 zf-RanBP:  Zn-finger i  29.7      37 0.00081   16.4   1.2   14   53-66      3-16  (30)
 73 PRK14559 putative protein seri  29.7      46 0.00099   27.5   2.3   36   22-63      1-36  (645)
 74 PRK08271 anaerobic ribonucleos  29.4      33 0.00072   28.2   1.5   25   41-65    565-591 (623)
 75 PF04438 zf-HIT:  HIT zinc fing  29.3      26 0.00057   17.5   0.6   23   43-66      3-25  (30)
 76 PF14835 zf-RING_6:  zf-RING of  29.2      32 0.00069   20.5   1.1   26   42-67      7-33  (65)
 77 PRK12380 hydrogenase nickel in  28.9      21 0.00046   22.7   0.3   24   40-63     68-95  (113)
 78 smart00184 RING Ring finger. E  28.6      32  0.0007   15.9   0.9   21   46-66      2-22  (39)
 79 PF13894 zf-C2H2_4:  C2H2-type   28.4      35 0.00076   14.5   0.9   13   55-67      1-13  (24)
 80 PF00097 zf-C3HC4:  Zinc finger  28.2      53  0.0011   16.4   1.7   23   45-67      1-24  (41)
 81 cd01675 RNR_III Class III ribo  27.2      33 0.00071   27.5   1.1   25   41-65    517-543 (555)
 82 PF07295 DUF1451:  Protein of u  26.8      37 0.00079   22.9   1.1   28   41-68    111-144 (146)
 83 PF08882 Acetone_carb_G:  Aceto  26.6      42 0.00091   22.0   1.4   17   52-68     13-37  (112)
 84 PF01428 zf-AN1:  AN1-like Zinc  26.3      36 0.00078   17.9   0.9   19   54-72     13-33  (43)
 85 cd02341 ZZ_ZZZ3 Zinc finger, Z  26.1      46 0.00099   18.3   1.3   11   51-61     12-22  (48)
 86 TIGR00100 hypA hydrogenase nic  26.1      34 0.00074   21.8   0.9   24   40-63     68-95  (115)
 87 COG2023 RPR2 RNase P subunit R  25.4      39 0.00084   21.9   1.0   12   53-64     81-92  (105)
 88 PRK00398 rpoP DNA-directed RNA  24.8      57  0.0012   17.2   1.5   20   43-62      4-29  (46)
 89 PF00569 ZZ:  Zinc finger, ZZ t  24.8      60  0.0013   17.3   1.6   19   43-61      5-26  (46)
 90 TIGR02300 FYDLN_acid conserved  24.5      58  0.0012   21.9   1.7   25   40-64      7-36  (129)
 91 PRK00564 hypA hydrogenase nick  24.2      35 0.00077   21.8   0.7   24   40-63     69-97  (117)
 92 PF09986 DUF2225:  Uncharacteri  24.1      35 0.00077   23.9   0.7   15   53-67     47-61  (214)
 93 smart00834 CxxC_CXXC_SSSS Puta  23.6      42 0.00092   16.8   0.8    7   56-62     28-34  (41)
 94 PRK00415 rps27e 30S ribosomal   23.4      54  0.0012   19.1   1.3   27   41-67     10-43  (59)
 95 smart00064 FYVE Protein presen  23.3      53  0.0011   18.3   1.2   26   42-67     10-39  (68)
 96 PRK03681 hypA hydrogenase nick  23.1      39 0.00084   21.6   0.7   24   40-63     68-96  (114)
 97 TIGR00595 priA primosomal prot  22.9      58  0.0013   25.7   1.8   23   41-63    239-262 (505)
 98 PRK11032 hypothetical protein;  22.8      46 0.00099   22.9   1.0   28   41-68    123-156 (160)
 99 COG5347 GTPase-activating prot  22.8      51  0.0011   25.0   1.4   28   40-67     18-45  (319)
100 PHA00616 hypothetical protein   22.4     9.1  0.0002   21.1  -2.0   19   56-74      3-22  (44)
101 PRK05452 anaerobic nitric oxid  22.4      49  0.0011   25.9   1.3   10   53-62    457-466 (479)
102 PF13717 zinc_ribbon_4:  zinc-r  22.3      27 0.00058   18.0  -0.2   28   23-50      3-33  (36)
103 PHA00626 hypothetical protein   21.9      72  0.0016   18.7   1.6   25   42-66     11-35  (59)
104 smart00504 Ubox Modified RING   21.5      43 0.00093   18.1   0.6   23   45-67      4-26  (63)
105 PF09723 Zn-ribbon_8:  Zinc rib  21.5      44 0.00095   17.6   0.6    9   54-62     26-34  (42)
106 PRK08579 anaerobic ribonucleos  21.4      56  0.0012   26.9   1.4   26   40-65    566-593 (625)
107 cd02344 ZZ_HERC2 Zinc finger,   21.1      93   0.002   16.9   1.9   11   51-61     12-22  (45)
108 PLN03119 putative ADP-ribosyla  21.0      80  0.0017   26.4   2.2   28   40-67     21-48  (648)
109 PRK00432 30S ribosomal protein  20.5      81  0.0018   17.4   1.6   21   44-64     22-47  (50)
110 PF13248 zf-ribbon_3:  zinc-rib  20.3      63  0.0014   15.2   1.0    7   56-62     18-24  (26)
111 cd00065 FYVE FYVE domain; Zinc  20.2      55  0.0012   17.5   0.8   11   57-67     21-31  (57)
112 TIGR02827 RNR_anaer_Bdell anae  20.0      53  0.0012   26.9   1.1   25   41-65    531-557 (586)

No 1  
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=99.16  E-value=9e-12  Score=72.97  Aligned_cols=32  Identities=41%  Similarity=0.978  Sum_probs=28.0

Q ss_pred             cCcCCCC-CCeeeecccCceeecCCCcchhccC
Q psy14516         45 CVDCASV-AENWVCLICYQVRCGRYIEEHSNEF   76 (76)
Q Consensus        45 C~~C~~~-~~~W~CL~Cg~v~CgR~~~~Ha~~H   76 (76)
                      |++|+.. .++|+||+||+++|||+.++||++|
T Consensus         1 C~~C~~~~~~lw~CL~Cg~~~C~~~~~~Ha~~H   33 (63)
T PF02148_consen    1 CSVCGSTNSNLWLCLTCGYVGCGRYSNGHALKH   33 (63)
T ss_dssp             -SSSHTCSSSEEEETTTS-EEETTTSTSHHHHH
T ss_pred             CCCCCCcCCceEEeCCCCcccccCCcCcHHHHh
Confidence            7788877 8999999999999999999999887


No 2  
>KOG0804|consensus
Probab=99.09  E-value=2.3e-11  Score=94.31  Aligned_cols=36  Identities=39%  Similarity=1.001  Sum_probs=33.8

Q ss_pred             CccccCcCCCCCCeeeecccCceeecCCCcchhccC
Q psy14516         41 VKAPCVDCASVAENWVCLICYQVRCGRYIEEHSNEF   76 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~CL~Cg~v~CgR~~~~Ha~~H   76 (76)
                      ....|.+|+...++|+||+||+||||||..|||++|
T Consensus       227 e~~~c~~c~~~~~LwicliCg~vgcgrY~eghA~rH  262 (493)
T KOG0804|consen  227 ESSLCLACGCTEDLWICLICGNVGCGRYKEGHARRH  262 (493)
T ss_pred             hhhhhhhhcccccEEEEEEccceecccccchhHHHH
Confidence            367799999999999999999999999999999998


No 3  
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=99.01  E-value=1.3e-10  Score=64.53  Aligned_cols=33  Identities=42%  Similarity=0.983  Sum_probs=30.7

Q ss_pred             ccCcCCCCCCeeeecccCceeecCCCcchhccC
Q psy14516         44 PCVDCASVAENWVCLICYQVRCGRYIEEHSNEF   76 (76)
Q Consensus        44 ~C~~C~~~~~~W~CL~Cg~v~CgR~~~~Ha~~H   76 (76)
                      +|.+|....++|+||+|++++|+|+.++|+.+|
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c~~~~~~h~~~H   33 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGCGRYQLGHALEH   33 (50)
T ss_pred             CcccCCCcCCeEEecCCCCcccCCCCCcHHHHH
Confidence            589999999999999999999999989999876


No 4  
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=98.98  E-value=2e-10  Score=91.16  Aligned_cols=64  Identities=27%  Similarity=0.444  Sum_probs=49.9

Q ss_pred             ccceEeeeeCCCCCCccCcccCCCC-CCCCccccCcCCCCCCeeeecccCceeecCC-----CcchhccC
Q psy14516         13 NEEMFLVTPLADCPHTPLVAPVPQS-GVDVKAPCVDCASVAENWVCLICYQVRCGRY-----IEEHSNEF   76 (76)
Q Consensus        13 ~~~~fav~p~~~CpHl~~l~~~~~~-~~~~~~~C~~C~~~~~~W~CL~Cg~v~CgR~-----~~~Ha~~H   76 (76)
                      .+.-.|+..+.+|+|.-.+.+-... ..-....|+.|+...++|+||+||.+||||-     +||||+.|
T Consensus       143 d~~~~w~~E~~tC~H~~n~~~~s~~~~ni~~~~Cs~CDl~~nLW~Cl~CG~vgCGR~QyG~~GngHAlsH  212 (749)
T COG5207         143 DERVLWRDEEVTCVHGCNEGPSSIEMGNIGGLKCSLCDLKTNLWVCLSCGYVGCGRMQYGAEGNGHALSH  212 (749)
T ss_pred             hhhhhhhhhcccccccCCCCCCcccccccCCceeccccchhceEEEEecCcccccceeecCCCCcchhhh
Confidence            4456789999999998765431111 1125678999999999999999999999994     69999887


No 5  
>KOG0944|consensus
Probab=98.87  E-value=9.8e-10  Score=88.59  Aligned_cols=62  Identities=18%  Similarity=0.378  Sum_probs=46.7

Q ss_pred             ceEeeeeCCCCCCcc-CcccCCCC-CC-CCccccCcCCCCCCeeeecccCceeecCC------CcchhccC
Q psy14516         15 EMFLVTPLADCPHTP-LVAPVPQS-GV-DVKAPCVDCASVAENWVCLICYQVRCGRY------IEEHSNEF   76 (76)
Q Consensus        15 ~~fav~p~~~CpHl~-~l~~~~~~-~~-~~~~~C~~C~~~~~~W~CL~Cg~v~CgR~------~~~Ha~~H   76 (76)
                      ..-|+.++.++++.. .+.+++.. .+ ...++|+.|+...++|+||+||.|+|||.      +|+||+.|
T Consensus       149 ~~aWd~Evr~v~k~~~nl~q~dng~~~~~~gwkCs~CDL~~NLWlcLtcG~v~CGR~qfg~~GgNgHA~~H  219 (763)
T KOG0944|consen  149 VNAWDNEVRTVSKHANNLSQIDNGKRIPPSGWKCSKCDLTENLWLCLTCGSVGCGRKQFGGSGGNGHALSH  219 (763)
T ss_pred             hhhhhhheeeccCCCCChhhcccCcccCCCcceecccCcccceEEEeccCceeecceeecCCCCCcchHHh
Confidence            345667775555544 36554432 23 46799999999999999999999999995      49999987


No 6  
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.84  E-value=1e-05  Score=61.72  Aligned_cols=37  Identities=24%  Similarity=0.389  Sum_probs=34.2

Q ss_pred             CCccccCcCCCCCCeeeecccCceeecCCCcchhccC
Q psy14516         40 DVKAPCVDCASVAENWVCLICYQVRCGRYIEEHSNEF   76 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~CL~Cg~v~CgR~~~~Ha~~H   76 (76)
                      +....|+.|+...++|+||+||.+++||..++||..|
T Consensus        14 d~e~~C~~~~~~~n~~~CL~cg~~~~g~~~~~ha~~H   50 (440)
T cd02669          14 DFEKVCSVSLSNLNVYACLVCGKYFQGRGKGSHAYTH   50 (440)
T ss_pred             cccccccccCCCCcEEEEcccCCeecCCCCCcHHHHH
Confidence            5677899999999999999999999999999999877


No 7  
>KOG1873|consensus
Probab=96.90  E-value=0.00041  Score=57.41  Aligned_cols=52  Identities=25%  Similarity=0.526  Sum_probs=38.0

Q ss_pred             CCCccC-ccc--CCCCCC-CCccccCcCCC---------------CCCeeeecccCceeecC-CCcchhccC
Q psy14516         25 CPHTPL-VAP--VPQSGV-DVKAPCVDCAS---------------VAENWVCLICYQVRCGR-YIEEHSNEF   76 (76)
Q Consensus        25 CpHl~~-l~~--~~~~~~-~~~~~C~~C~~---------------~~~~W~CL~Cg~v~CgR-~~~~Ha~~H   76 (76)
                      |.|+.. +..  +.+... ..+..|.+|..               ...+|+||.||+.+||| ....||++|
T Consensus        45 C~Hi~Kav~l~~lk~~iks~~~~~C~eC~e~~~~k~g~s~~~~~~~~~iWLCLkCG~q~CG~~~~~~halkH  116 (877)
T KOG1873|consen   45 CQHIKKAVDLSHLKRAIKSLLWIKCSECNEEVKVKDGGSSDQFEFDNAIWLCLKCGYQGCGRNSESQHALKH  116 (877)
T ss_pred             cchHHhhhcHHHHHHHHHHHHHHHHHHhhhcceeccCCCccccccccceeeecccCCeeeCCCcccchhhhh
Confidence            999987 332  111111 25677998873               34699999999999999 789999887


No 8  
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.20  E-value=0.29  Score=28.84  Aligned_cols=24  Identities=17%  Similarity=0.443  Sum_probs=21.0

Q ss_pred             CccccCcCCCCCCeeeecccCcee
Q psy14516         41 VKAPCVDCASVAENWVCLICYQVR   64 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~CL~Cg~v~   64 (76)
                      ..++|..|....+...|..||..|
T Consensus        35 ~I~RC~~CRk~~~~Y~CP~CGF~G   58 (59)
T PRK14890         35 IIYRCEKCRKQSNPYTCPKCGFEG   58 (59)
T ss_pred             eEeechhHHhcCCceECCCCCCcC
Confidence            367899999999999999999875


No 9  
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=82.51  E-value=0.4  Score=28.37  Aligned_cols=24  Identities=17%  Similarity=0.411  Sum_probs=21.3

Q ss_pred             CccccCcCCCCCCeeeecccCcee
Q psy14516         41 VKAPCVDCASVAENWVCLICYQVR   64 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~CL~Cg~v~   64 (76)
                      ...+|+.|...++...|..||..|
T Consensus        37 ~I~Rc~~CRk~g~~Y~Cp~CGF~G   60 (61)
T COG2888          37 EIYRCAKCRKLGNPYRCPKCGFEG   60 (61)
T ss_pred             eeehhhhHHHcCCceECCCcCccC
Confidence            578899999999999999999875


No 10 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=80.33  E-value=0.8  Score=23.32  Aligned_cols=20  Identities=30%  Similarity=0.871  Sum_probs=12.8

Q ss_pred             cccCcCCCC----CCeeeecccCc
Q psy14516         43 APCVDCASV----AENWVCLICYQ   62 (76)
Q Consensus        43 ~~C~~C~~~----~~~W~CL~Cg~   62 (76)
                      +.|..|+-.    ...|.|..||.
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCCCC
Confidence            356666633    35778888775


No 11 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=78.67  E-value=1.3  Score=22.92  Aligned_cols=14  Identities=36%  Similarity=0.980  Sum_probs=10.8

Q ss_pred             eeeecccCceeecC
Q psy14516         54 NWVCLICYQVRCGR   67 (76)
Q Consensus        54 ~W~CL~Cg~v~CgR   67 (76)
                      .|+|..||++.=|+
T Consensus         2 ~~~C~~CG~i~~g~   15 (34)
T cd00729           2 VWVCPVCGYIHEGE   15 (34)
T ss_pred             eEECCCCCCEeECC
Confidence            58899999886554


No 12 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=73.58  E-value=2.9  Score=21.74  Aligned_cols=14  Identities=29%  Similarity=0.479  Sum_probs=10.0

Q ss_pred             CCCeeeecccCcee
Q psy14516         51 VAENWVCLICYQVR   64 (76)
Q Consensus        51 ~~~~W~CL~Cg~v~   64 (76)
                      .++-++|..||.|+
T Consensus        19 ~r~R~vC~~Cg~Ih   32 (34)
T PF14803_consen   19 DRERLVCPACGFIH   32 (34)
T ss_dssp             SS-EEEETTTTEEE
T ss_pred             CccceECCCCCCEE
Confidence            45678888888875


No 13 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=68.46  E-value=3.4  Score=21.29  Aligned_cols=26  Identities=15%  Similarity=0.429  Sum_probs=20.3

Q ss_pred             ccccCcCCCCCCeeeecccCceeecC
Q psy14516         42 KAPCVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        42 ~~~C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      ...|..+....-.+.|.+|+...|..
T Consensus         3 ~~~C~~H~~~~~~~~C~~C~~~~C~~   28 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLFCEDCNEPLCSE   28 (42)
T ss_dssp             SSB-SSTTTSBEEEEETTTTEEEEHH
T ss_pred             CccCccCCccceEEEecCCCCccCcc
Confidence            45688888777788899999999886


No 14 
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=65.62  E-value=1.7  Score=35.65  Aligned_cols=50  Identities=24%  Similarity=0.480  Sum_probs=33.3

Q ss_pred             CCCCccCccc-CCCC-CCCCccccCcCCCCC----CeeeecccCceeecCCCcchh
Q psy14516         24 DCPHTPLVAP-VPQS-GVDVKAPCVDCASVA----ENWVCLICYQVRCGRYIEEHS   73 (76)
Q Consensus        24 ~CpHl~~l~~-~~~~-~~~~~~~C~~C~~~~----~~W~CL~Cg~v~CgR~~~~Ha   73 (76)
                      .|||...... +|.. .+-....|.-|..+.    .+-+||.|+..+|+|.+--|.
T Consensus         2 S~~H~e~ae~vlpn~~av~~reeC~yCf~S~~~e~si~vClnCfqs~C~~h~~~H~   57 (749)
T COG5207           2 SFSHSEMAEMVLPNLPAVRFREECCYCFRSIGDEHSISVCLNCFQSFCEKHRGIHL   57 (749)
T ss_pred             CCchhhhhhhcCCCCchhhhhhhhheeeccCCCCcceehHHHHhHhhhhhccceee
Confidence            6888876432 2211 111345588888653    367899999999999877765


No 15 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=62.60  E-value=6  Score=19.22  Aligned_cols=12  Identities=25%  Similarity=0.390  Sum_probs=6.8

Q ss_pred             CCCCeeeecccC
Q psy14516         50 SVAENWVCLICY   61 (76)
Q Consensus        50 ~~~~~W~CL~Cg   61 (76)
                      .......|..||
T Consensus        12 ~~~v~f~CPnCG   23 (24)
T PF07754_consen   12 EQAVPFPCPNCG   23 (24)
T ss_pred             ccCceEeCCCCC
Confidence            334455666666


No 16 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=62.28  E-value=6.3  Score=25.99  Aligned_cols=13  Identities=31%  Similarity=0.703  Sum_probs=10.7

Q ss_pred             CCeeeecccCcee
Q psy14516         52 AENWVCLICYQVR   64 (76)
Q Consensus        52 ~~~W~CL~Cg~v~   64 (76)
                      .+-|.|..||.+.
T Consensus       122 ~~f~~C~~C~kiy  134 (147)
T PF01927_consen  122 DEFWRCPGCGKIY  134 (147)
T ss_pred             CeEEECCCCCCEe
Confidence            4589999999874


No 17 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=59.79  E-value=6  Score=28.34  Aligned_cols=26  Identities=19%  Similarity=0.445  Sum_probs=21.3

Q ss_pred             CCccccCcCCCCCCeee--ecccCceee
Q psy14516         40 DVKAPCVDCASVAENWV--CLICYQVRC   65 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~--CL~Cg~v~C   65 (76)
                      +..+.|+.|+.....|.  |..||..+-
T Consensus       352 ~p~~~c~~cg~~~~~~~~~c~~c~~~~~  379 (389)
T PRK11788        352 KPRYRCRNCGFTARTLYWHCPSCKAWET  379 (389)
T ss_pred             CCCEECCCCCCCCccceeECcCCCCccC
Confidence            46678999999988775  999998764


No 18 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=59.48  E-value=8.7  Score=20.21  Aligned_cols=13  Identities=23%  Similarity=0.807  Sum_probs=8.3

Q ss_pred             CCCeeeecccCce
Q psy14516         51 VAENWVCLICYQV   63 (76)
Q Consensus        51 ~~~~W~CL~Cg~v   63 (76)
                      ....|+|..|+..
T Consensus        21 ~~~~w~C~~C~~~   33 (40)
T PF04810_consen   21 GGKTWICNFCGTK   33 (40)
T ss_dssp             TTTEEEETTT--E
T ss_pred             CCCEEECcCCCCc
Confidence            4568999988864


No 19 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=58.09  E-value=7.7  Score=19.78  Aligned_cols=22  Identities=18%  Similarity=0.255  Sum_probs=15.8

Q ss_pred             CcCCCC-CCeeeecccCceeecC
Q psy14516         46 VDCASV-AENWVCLICYQVRCGR   67 (76)
Q Consensus        46 ~~C~~~-~~~W~CL~Cg~v~CgR   67 (76)
                      ..|... .+.++-+.||++.|.+
T Consensus         2 ~iC~~~~~~~~~~~~CGH~fC~~   24 (39)
T PF13923_consen    2 PICLDELRDPVVVTPCGHSFCKE   24 (39)
T ss_dssp             TTTTSB-SSEEEECTTSEEEEHH
T ss_pred             CCCCCcccCcCEECCCCCchhHH
Confidence            344433 5567899999999975


No 20 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=57.50  E-value=5.7  Score=22.97  Aligned_cols=12  Identities=33%  Similarity=1.030  Sum_probs=8.3

Q ss_pred             CCCeeeecccCc
Q psy14516         51 VAENWVCLICYQ   62 (76)
Q Consensus        51 ~~~~W~CL~Cg~   62 (76)
                      ..+.|+|..||.
T Consensus        33 lPd~w~CP~Cg~   44 (55)
T COG1773          33 LPDDWVCPECGV   44 (55)
T ss_pred             CCCccCCCCCCC
Confidence            456777777774


No 21 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=57.43  E-value=10  Score=20.24  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=9.0

Q ss_pred             CeeeecccCcee
Q psy14516         53 ENWVCLICYQVR   64 (76)
Q Consensus        53 ~~W~CL~Cg~v~   64 (76)
                      +.|+|..||+..
T Consensus        19 ~~~vC~~Cg~~~   30 (52)
T smart00661       19 RRFVCRKCGYEE   30 (52)
T ss_pred             CEEECCcCCCeE
Confidence            478888888754


No 22 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=57.34  E-value=6.4  Score=19.99  Aligned_cols=20  Identities=35%  Similarity=0.559  Sum_probs=11.3

Q ss_pred             ccCcCCC-----CCCeeeecccCce
Q psy14516         44 PCVDCAS-----VAENWVCLICYQV   63 (76)
Q Consensus        44 ~C~~C~~-----~~~~W~CL~Cg~v   63 (76)
                      .|..|..     .+.+++|.+|++.
T Consensus         4 ~Cp~C~se~~y~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTYEDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----EE-SSSEEETTTTEE
T ss_pred             CCCCCCCcceeccCCEEeCCccccc
Confidence            3555553     4678899999864


No 23 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=56.90  E-value=10  Score=20.04  Aligned_cols=28  Identities=29%  Similarity=0.650  Sum_probs=18.4

Q ss_pred             cCcCCCCCCe--eeecccCceeecC--CCcch
Q psy14516         45 CVDCASVAEN--WVCLICYQVRCGR--YIEEH   72 (76)
Q Consensus        45 C~~C~~~~~~--W~CL~Cg~v~CgR--~~~~H   72 (76)
                      |..|.....+  -.|-.|+.+.|++  +...|
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~HR~~e~H   32 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGEHRLPEDH   32 (39)
T ss_pred             CcccCCcccccCeECCccCCccccccCCcccc
Confidence            4455554443  5589999999995  45555


No 24 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=55.76  E-value=9.5  Score=24.11  Aligned_cols=27  Identities=26%  Similarity=0.532  Sum_probs=21.4

Q ss_pred             CccccCcCCC------CCCeeeecccCceeecC
Q psy14516         41 VKAPCVDCAS------VAENWVCLICYQVRCGR   67 (76)
Q Consensus        41 ~~~~C~~C~~------~~~~W~CL~Cg~v~CgR   67 (76)
                      ....|.+|..      ....|.|-.||..+-|-
T Consensus        34 ~~~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRTTVKRIATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCcceeeeccCeEEcCCCCCeeccc
Confidence            4556888884      46799999999998875


No 25 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=54.29  E-value=9.8  Score=28.42  Aligned_cols=26  Identities=23%  Similarity=0.407  Sum_probs=23.9

Q ss_pred             CccccCcCCCCCCeeeecccCceeec
Q psy14516         41 VKAPCVDCASVAENWVCLICYQVRCG   66 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~CL~Cg~v~Cg   66 (76)
                      ...+|.-|...-+.-.|..||+++|-
T Consensus       214 ~d~kC~lC~e~~~~ps~t~CgHlFC~  239 (271)
T COG5574         214 ADYKCFLCLEEPEVPSCTPCGHLFCL  239 (271)
T ss_pred             cccceeeeecccCCcccccccchhhH
Confidence            57789999999999999999999984


No 26 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=54.23  E-value=11  Score=23.92  Aligned_cols=28  Identities=21%  Similarity=0.436  Sum_probs=18.2

Q ss_pred             CCccccCcCCCCCCeeeecccCceeecC
Q psy14516         40 DVKAPCVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      +....|.+|+...-.|+++.=|...|.+
T Consensus        11 ~~N~~CaDCg~~~p~w~s~~~GiflC~~   38 (116)
T PF01412_consen   11 PGNKVCADCGAPNPTWASLNYGIFLCLE   38 (116)
T ss_dssp             TTCTB-TTT-SBS--EEETTTTEEE-HH
T ss_pred             cCcCcCCCCCCCCCCEEEeecChhhhHH
Confidence            3667899999999999988877777654


No 27 
>PRK10220 hypothetical protein; Provisional
Probab=53.76  E-value=9.9  Score=24.93  Aligned_cols=20  Identities=20%  Similarity=0.602  Sum_probs=14.1

Q ss_pred             cCcCC-----CCCCeeeecccCcee
Q psy14516         45 CVDCA-----SVAENWVCLICYQVR   64 (76)
Q Consensus        45 C~~C~-----~~~~~W~CL~Cg~v~   64 (76)
                      |..|.     ..+++|+|..|++.-
T Consensus         6 CP~C~seytY~d~~~~vCpeC~hEW   30 (111)
T PRK10220          6 CPKCNSEYTYEDNGMYICPECAHEW   30 (111)
T ss_pred             CCCCCCcceEcCCCeEECCcccCcC
Confidence            55555     246789999998754


No 28 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=52.29  E-value=9.3  Score=24.98  Aligned_cols=20  Identities=25%  Similarity=0.632  Sum_probs=14.3

Q ss_pred             cCcCCC-----CCCeeeecccCcee
Q psy14516         45 CVDCAS-----VAENWVCLICYQVR   64 (76)
Q Consensus        45 C~~C~~-----~~~~W~CL~Cg~v~   64 (76)
                      |..|..     .+++|+|..|++.-
T Consensus         5 CP~C~seytY~dg~~~iCpeC~~EW   29 (109)
T TIGR00686         5 CPKCNSEYTYHDGTQLICPSCLYEW   29 (109)
T ss_pred             CCcCCCcceEecCCeeECccccccc
Confidence            555552     46789999998754


No 29 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=50.13  E-value=15  Score=23.61  Aligned_cols=26  Identities=23%  Similarity=0.450  Sum_probs=18.2

Q ss_pred             CCCccccCcCC-----CCCCeeeecccCcee
Q psy14516         39 VDVKAPCVDCA-----SVAENWVCLICYQVR   64 (76)
Q Consensus        39 ~~~~~~C~~C~-----~~~~~W~CL~Cg~v~   64 (76)
                      +..+..|.+|+     ..++.=+|..||.+.
T Consensus         6 lGtKR~Cp~CG~kFYDLnk~PivCP~CG~~~   36 (108)
T PF09538_consen    6 LGTKRTCPSCGAKFYDLNKDPIVCPKCGTEF   36 (108)
T ss_pred             cCCcccCCCCcchhccCCCCCccCCCCCCcc
Confidence            34556688887     346777799998764


No 30 
>PHA02942 putative transposase; Provisional
Probab=49.44  E-value=14  Score=28.29  Aligned_cols=24  Identities=17%  Similarity=0.436  Sum_probs=18.8

Q ss_pred             CccccCcCCCC-----CCeeeecccCcee
Q psy14516         41 VKAPCVDCASV-----AENWVCLICYQVR   64 (76)
Q Consensus        41 ~~~~C~~C~~~-----~~~W~CL~Cg~v~   64 (76)
                      .+..|..|+..     ...|.|..||...
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCEe
Confidence            45669999953     4589999999875


No 31 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=49.12  E-value=8.5  Score=18.79  Aligned_cols=19  Identities=21%  Similarity=0.527  Sum_probs=10.0

Q ss_pred             cCcCCCC--CCeeeecccCce
Q psy14516         45 CVDCASV--AENWVCLICYQV   63 (76)
Q Consensus        45 C~~C~~~--~~~W~CL~Cg~v   63 (76)
                      |.+|+..  ...-.|..||++
T Consensus         3 CP~C~~~V~~~~~~Cp~CG~~   23 (26)
T PF10571_consen    3 CPECGAEVPESAKFCPHCGYD   23 (26)
T ss_pred             CCCCcCCchhhcCcCCCCCCC
Confidence            4555532  334457777765


No 32 
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=47.56  E-value=6.4  Score=29.68  Aligned_cols=24  Identities=21%  Similarity=0.440  Sum_probs=19.2

Q ss_pred             CCccccCcCCC-------CCCeeeecccCce
Q psy14516         40 DVKAPCVDCAS-------VAENWVCLICYQV   63 (76)
Q Consensus        40 ~~~~~C~~C~~-------~~~~W~CL~Cg~v   63 (76)
                      +.+..|.+|..       ..++|+|+.|++-
T Consensus        26 ~lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h   56 (294)
T COG0777          26 GLWTKCPSCGEMLYRKELESNLKVCPKCGHH   56 (294)
T ss_pred             CceeECCCccceeeHHHHHhhhhcccccCcc
Confidence            46788999983       5789999999863


No 33 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=45.64  E-value=18  Score=25.25  Aligned_cols=25  Identities=20%  Similarity=0.430  Sum_probs=19.3

Q ss_pred             CccccCcCCCC-CCeeeecccCceee
Q psy14516         41 VKAPCVDCASV-AENWVCLICYQVRC   65 (76)
Q Consensus        41 ~~~~C~~C~~~-~~~W~CL~Cg~v~C   65 (76)
                      .+..|..|+.. ...|.|..||.+.=
T Consensus       308 tS~~C~~cg~~~~r~~~C~~cg~~~~  333 (364)
T COG0675         308 TSKTCPCCGHLSGRLFKCPRCGFVHD  333 (364)
T ss_pred             CcccccccCCccceeEECCCCCCeeh
Confidence            45678888864 57899999998753


No 34 
>KOG2026|consensus
Probab=45.57  E-value=16  Score=28.89  Aligned_cols=37  Identities=27%  Similarity=0.486  Sum_probs=32.5

Q ss_pred             CCccccCcCCCCCCeeeecccCceeecCCCcchhccC
Q psy14516         40 DVKAPCVDCASVAENWVCLICYQVRCGRYIEEHSNEF   76 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~CL~Cg~v~CgR~~~~Ha~~H   76 (76)
                      +....|..-...-+...||.||.-.=||..+.||..|
T Consensus        27 d~ek~c~vslsnLnvyAclvcg~y~qgr~~kS~A~~h   63 (442)
T KOG2026|consen   27 DFEKPCSVSLSNLNVYACLVCGKYFQGRGEKSHAYTH   63 (442)
T ss_pred             cCCCCCcccccccceeeeeeeCchhhCcCccccchhc
Confidence            4667798888889999999999999999999999876


No 35 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=45.51  E-value=22  Score=18.70  Aligned_cols=16  Identities=25%  Similarity=0.256  Sum_probs=9.0

Q ss_pred             CCeeeecccCceeecC
Q psy14516         52 AENWVCLICYQVRCGR   67 (76)
Q Consensus        52 ~~~W~CL~Cg~v~CgR   67 (76)
                      +...+|..||.|.=.+
T Consensus        17 ~g~~vC~~CG~Vl~e~   32 (43)
T PF08271_consen   17 RGELVCPNCGLVLEEN   32 (43)
T ss_dssp             TTEEEETTT-BBEE-T
T ss_pred             CCeEECCCCCCEeecc
Confidence            3456788888775433


No 36 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=45.34  E-value=12  Score=28.42  Aligned_cols=21  Identities=29%  Similarity=0.884  Sum_probs=16.4

Q ss_pred             ccCcCCCCCCeee--ecccCcee
Q psy14516         44 PCVDCASVAENWV--CLICYQVR   64 (76)
Q Consensus        44 ~C~~C~~~~~~W~--CL~Cg~v~   64 (76)
                      .|++|+.....|.  |..|+.=+
T Consensus         2 ~c~~cg~~~~~~~g~cp~c~~w~   24 (372)
T cd01121           2 VCSECGYVSPKWLGKCPECGEWN   24 (372)
T ss_pred             CCCCCCCCCCCccEECcCCCCce
Confidence            6999998777665  99998644


No 37 
>KOG0317|consensus
Probab=44.89  E-value=9.9  Score=28.69  Aligned_cols=27  Identities=19%  Similarity=0.330  Sum_probs=24.2

Q ss_pred             CCccccCcCCCCCCeeeecccCceeec
Q psy14516         40 DVKAPCVDCASVAENWVCLICYQVRCG   66 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~CL~Cg~v~Cg   66 (76)
                      ..+..|+-|...+.+--|.-||+++|=
T Consensus       237 ~a~~kC~LCLe~~~~pSaTpCGHiFCW  263 (293)
T KOG0317|consen  237 EATRKCSLCLENRSNPSATPCGHIFCW  263 (293)
T ss_pred             CCCCceEEEecCCCCCCcCcCcchHHH
Confidence            356789999999999999999999984


No 38 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=43.67  E-value=13  Score=23.43  Aligned_cols=26  Identities=19%  Similarity=0.498  Sum_probs=22.5

Q ss_pred             ccccCcCCCCCCeeeecccCceeecC
Q psy14516         42 KAPCVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        42 ~~~C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      ...|.+|+...-.|+++.=|...|.+
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~   28 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIE   28 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHH
Confidence            46799999999999999988888874


No 39 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=43.47  E-value=20  Score=20.23  Aligned_cols=23  Identities=17%  Similarity=0.463  Sum_probs=16.3

Q ss_pred             CccccCcCCC------CCCeeeecccCce
Q psy14516         41 VKAPCVDCAS------VAENWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~------~~~~W~CL~Cg~v   63 (76)
                      .+..|..|+.      ....|.|..||..
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            4555777773      4557889999987


No 40 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=43.41  E-value=3.3  Score=18.57  Aligned_cols=20  Identities=20%  Similarity=0.517  Sum_probs=11.2

Q ss_pred             eeecccCceeecCC-Ccchhc
Q psy14516         55 WVCLICYQVRCGRY-IEEHSN   74 (76)
Q Consensus        55 W~CL~Cg~v~CgR~-~~~Ha~   74 (76)
                      +.|..|+...=.++ -..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            46777777665542 344443


No 41 
>PRK11823 DNA repair protein RadA; Provisional
Probab=43.26  E-value=13  Score=28.91  Aligned_cols=25  Identities=20%  Similarity=0.639  Sum_probs=19.2

Q ss_pred             CccccCcCCCCCCeee--ecccCceee
Q psy14516         41 VKAPCVDCASVAENWV--CLICYQVRC   65 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~--CL~Cg~v~C   65 (76)
                      ....|++|+.....|.  |..|+.=+.
T Consensus         6 ~~y~C~~Cg~~~~~~~g~Cp~C~~w~t   32 (446)
T PRK11823          6 TAYVCQECGAESPKWLGRCPECGAWNT   32 (446)
T ss_pred             CeEECCcCCCCCcccCeeCcCCCCccc
Confidence            4578999998877665  999986543


No 42 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=42.27  E-value=7.6  Score=20.13  Aligned_cols=29  Identities=24%  Similarity=0.583  Sum_probs=18.2

Q ss_pred             CCCCCCccCcccCCCCCC---CCccccCcCCC
Q psy14516         22 LADCPHTPLVAPVPQSGV---DVKAPCVDCAS   50 (76)
Q Consensus        22 ~~~CpHl~~l~~~~~~~~---~~~~~C~~C~~   50 (76)
                      +..||+....-.++.+.+   ....+|..|..
T Consensus         2 ~i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~   33 (37)
T PF13719_consen    2 IITCPNCQTRFRVPDDKLPAGGRKVRCPKCGH   33 (37)
T ss_pred             EEECCCCCceEEcCHHHcccCCcEEECCCCCc
Confidence            357999887544554322   35677888764


No 43 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=41.87  E-value=21  Score=18.81  Aligned_cols=23  Identities=26%  Similarity=0.498  Sum_probs=14.8

Q ss_pred             cCcCCCCCCeeeecccCceeecC
Q psy14516         45 CVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        45 C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      |..|...-..-+=|.||++.|-+
T Consensus         1 CpiC~~~~~~Pv~l~CGH~FC~~   23 (42)
T PF15227_consen    1 CPICLDLFKDPVSLPCGHSFCRS   23 (42)
T ss_dssp             ETTTTSB-SSEEE-SSSSEEEHH
T ss_pred             CCccchhhCCccccCCcCHHHHH
Confidence            44566655666678899999964


No 44 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=40.74  E-value=13  Score=25.71  Aligned_cols=13  Identities=38%  Similarity=0.966  Sum_probs=11.3

Q ss_pred             eeeecccCceeec
Q psy14516         54 NWVCLICYQVRCG   66 (76)
Q Consensus        54 ~W~CL~Cg~v~Cg   66 (76)
                      .|+|..||++.=|
T Consensus       134 ~~vC~vCGy~~~g  146 (166)
T COG1592         134 VWVCPVCGYTHEG  146 (166)
T ss_pred             EEEcCCCCCcccC
Confidence            8999999998755


No 45 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=40.72  E-value=13  Score=20.07  Aligned_cols=6  Identities=33%  Similarity=0.722  Sum_probs=3.1

Q ss_pred             ecccCc
Q psy14516         57 CLICYQ   62 (76)
Q Consensus        57 CL~Cg~   62 (76)
                      |..||.
T Consensus        29 CP~Cg~   34 (52)
T TIGR02605        29 CPECGG   34 (52)
T ss_pred             CCCCCC
Confidence            555554


No 46 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=40.27  E-value=14  Score=28.72  Aligned_cols=25  Identities=24%  Similarity=0.634  Sum_probs=18.7

Q ss_pred             CccccCcCCCCCCeee--ecccCceee
Q psy14516         41 VKAPCVDCASVAENWV--CLICYQVRC   65 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~--CL~Cg~v~C   65 (76)
                      ....|+.|+.....|.  |..|+.=+.
T Consensus         6 ~~y~C~~Cg~~~~~~~g~Cp~C~~w~t   32 (454)
T TIGR00416         6 SKFVCQHCGADSPKWQGKCPACHAWNT   32 (454)
T ss_pred             CeEECCcCCCCCccccEECcCCCCccc
Confidence            4577999998777655  999986443


No 47 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=39.45  E-value=25  Score=18.72  Aligned_cols=25  Identities=24%  Similarity=0.462  Sum_probs=20.1

Q ss_pred             cccCcCCCCCCeeeecccCce-eecC
Q psy14516         43 APCVDCASVAENWVCLICYQV-RCGR   67 (76)
Q Consensus        43 ~~C~~C~~~~~~W~CL~Cg~v-~CgR   67 (76)
                      ..|..|.......+-+-||+. .|..
T Consensus         3 ~~C~iC~~~~~~~~~~pCgH~~~C~~   28 (50)
T PF13920_consen    3 EECPICFENPRDVVLLPCGHLCFCEE   28 (50)
T ss_dssp             SB-TTTSSSBSSEEEETTCEEEEEHH
T ss_pred             CCCccCCccCCceEEeCCCChHHHHH
Confidence            468899998888999999999 7763


No 48 
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=38.05  E-value=26  Score=20.70  Aligned_cols=21  Identities=29%  Similarity=0.868  Sum_probs=14.3

Q ss_pred             ccccCcCC-------CCCCeeeecccCc
Q psy14516         42 KAPCVDCA-------SVAENWVCLICYQ   62 (76)
Q Consensus        42 ~~~C~~C~-------~~~~~W~CL~Cg~   62 (76)
                      ...|.-|+       ....-|+||.|..
T Consensus        30 ~~VCnlCGFNP~Phl~E~~eWLCLnCQ~   57 (61)
T PF05715_consen   30 SQVCNLCGFNPTPHLTEVKEWLCLNCQM   57 (61)
T ss_pred             hhhhcccCCCCCccccccceeeeecchh
Confidence            44566666       3357899999964


No 49 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=37.82  E-value=20  Score=24.93  Aligned_cols=14  Identities=21%  Similarity=0.451  Sum_probs=10.5

Q ss_pred             CCCeeeecccCcee
Q psy14516         51 VAENWVCLICYQVR   64 (76)
Q Consensus        51 ~~~~W~CL~Cg~v~   64 (76)
                      ..+-|.|..||.+.
T Consensus       127 ~~~f~~C~~CgkiY  140 (165)
T COG1656         127 YEEFYRCPKCGKIY  140 (165)
T ss_pred             ccceeECCCCcccc
Confidence            45678899888764


No 50 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=37.78  E-value=20  Score=29.36  Aligned_cols=23  Identities=17%  Similarity=0.213  Sum_probs=19.3

Q ss_pred             CccccCcCCCCCCe-eeecccCce
Q psy14516         41 VKAPCVDCASVAEN-WVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~~~~~-W~CL~Cg~v   63 (76)
                      ..+.|.+|+-.++. |.|..||+-
T Consensus       558 ~~~~C~~CGy~g~~~~~CP~CG~~  581 (618)
T PRK14704        558 PVDRCKCCSYHGVIGNECPSCGNE  581 (618)
T ss_pred             CCeecCCCCCCCCcCccCcCCCCC
Confidence            67789999987676 999999964


No 51 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=36.05  E-value=12  Score=21.61  Aligned_cols=14  Identities=29%  Similarity=0.600  Sum_probs=11.2

Q ss_pred             eecccCceeecCCC
Q psy14516         56 VCLICYQVRCGRYI   69 (76)
Q Consensus        56 ~CL~Cg~v~CgR~~   69 (76)
                      -||.||.|-|..-.
T Consensus        20 NCl~CGkIiC~~Eg   33 (57)
T PF06221_consen   20 NCLNCGKIICEQEG   33 (57)
T ss_pred             cccccChhhccccc
Confidence            49999999997643


No 52 
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=35.93  E-value=19  Score=28.77  Aligned_cols=22  Identities=27%  Similarity=0.830  Sum_probs=18.8

Q ss_pred             CccccCcCCCCCCeee--ecccCc
Q psy14516         41 VKAPCVDCASVAENWV--CLICYQ   62 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~--CL~Cg~   62 (76)
                      ....|++|+....-|.  |..||.
T Consensus         6 t~f~C~~CG~~s~KW~GkCp~Cg~   29 (456)
T COG1066           6 TAFVCQECGYVSPKWLGKCPACGA   29 (456)
T ss_pred             cEEEcccCCCCCccccccCCCCCC
Confidence            3467999999999998  999984


No 53 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=35.03  E-value=24  Score=18.37  Aligned_cols=10  Identities=20%  Similarity=0.630  Sum_probs=7.9

Q ss_pred             eeecccCcee
Q psy14516         55 WVCLICYQVR   64 (76)
Q Consensus        55 W~CL~Cg~v~   64 (76)
                      |+|..||.+.
T Consensus         2 r~C~~Cg~~Y   11 (36)
T PF05191_consen    2 RICPKCGRIY   11 (36)
T ss_dssp             EEETTTTEEE
T ss_pred             cCcCCCCCcc
Confidence            7888888764


No 54 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=34.59  E-value=39  Score=17.23  Aligned_cols=22  Identities=23%  Similarity=0.593  Sum_probs=13.5

Q ss_pred             cccCcCCCC------CCeeeecccCcee
Q psy14516         43 APCVDCASV------AENWVCLICYQVR   64 (76)
Q Consensus        43 ~~C~~C~~~------~~~W~CL~Cg~v~   64 (76)
                      ..|..|+..      .+..+|..||.+.
T Consensus         4 ~~C~~C~~~~i~~~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    4 KKCSKCGGNGIVNKEDDYEVCIFCGSSF   31 (33)
T ss_pred             eEcCCCCCCeEEEecCCeEEcccCCcEe
Confidence            456777643      3445688887653


No 55 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=34.41  E-value=33  Score=17.78  Aligned_cols=22  Identities=27%  Similarity=0.584  Sum_probs=13.8

Q ss_pred             ccccCcCCCC-----CCeeeecccCce
Q psy14516         42 KAPCVDCASV-----AENWVCLICYQV   63 (76)
Q Consensus        42 ~~~C~~C~~~-----~~~W~CL~Cg~v   63 (76)
                      ..+|..|...     ...+.|-.||++
T Consensus         8 ~~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    8 NEPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CCcCCCCCCeEeEccCCEEEhhhCceE
Confidence            3458888753     345567777765


No 56 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=33.60  E-value=24  Score=16.32  Aligned_cols=6  Identities=33%  Similarity=0.933  Sum_probs=2.7

Q ss_pred             cccCcC
Q psy14516         43 APCVDC   48 (76)
Q Consensus        43 ~~C~~C   48 (76)
                      +.|..|
T Consensus         3 W~C~~C    8 (26)
T smart00547        3 WECPAC    8 (26)
T ss_pred             ccCCCC
Confidence            344444


No 57 
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=33.51  E-value=26  Score=28.27  Aligned_cols=26  Identities=23%  Similarity=0.348  Sum_probs=20.3

Q ss_pred             CccccCcCCCCCCe--eeecccCceeec
Q psy14516         41 VKAPCVDCASVAEN--WVCLICYQVRCG   66 (76)
Q Consensus        41 ~~~~C~~C~~~~~~--W~CL~Cg~v~Cg   66 (76)
                      ..+.|.+|+-..+.  |.|..||+-.+.
T Consensus       523 ~~~~C~~CG~~g~~~~~~CP~Cgs~~~~  550 (579)
T TIGR02487       523 PVDVCEDCGYTGEGLNDKCPKCGSHDIE  550 (579)
T ss_pred             CCccCCCCCCCCCCCCCcCcCCCCccce
Confidence            56789999987665  899999975444


No 58 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=33.37  E-value=28  Score=28.69  Aligned_cols=23  Identities=26%  Similarity=0.585  Sum_probs=19.4

Q ss_pred             CccccCcCCCCCCeeeecccCce
Q psy14516         41 VKAPCVDCASVAENWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~CL~Cg~v   63 (76)
                      ....|.-|+.....|.|..||..
T Consensus       409 ~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        409 GTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             CeeECCCCcCCCcCccCCCCcCC
Confidence            45779999988789999999875


No 59 
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=32.99  E-value=26  Score=29.15  Aligned_cols=22  Identities=23%  Similarity=0.569  Sum_probs=18.3

Q ss_pred             CccccCcCCCCCCe------eeecccCc
Q psy14516         41 VKAPCVDCASVAEN------WVCLICYQ   62 (76)
Q Consensus        41 ~~~~C~~C~~~~~~------W~CL~Cg~   62 (76)
                      ..+.|.+|+-.++.      |.|..||+
T Consensus       640 ~~~~C~~CG~~Ge~~~~~~~~~CP~CG~  667 (711)
T PRK09263        640 PIDECYECGFTGEFECTEKGFTCPKCGN  667 (711)
T ss_pred             CCcccCCCCCCccccCCCCCCcCcCCCC
Confidence            56889999986555      99999996


No 60 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=32.60  E-value=19  Score=20.10  Aligned_cols=12  Identities=25%  Similarity=0.495  Sum_probs=9.1

Q ss_pred             eeecccCceeec
Q psy14516         55 WVCLICYQVRCG   66 (76)
Q Consensus        55 W~CL~Cg~v~Cg   66 (76)
                      |+|..||.|.=.
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            788888887643


No 61 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=32.39  E-value=27  Score=28.77  Aligned_cols=23  Identities=17%  Similarity=0.251  Sum_probs=19.4

Q ss_pred             CccccCcCCC-CCCeeeecccCce
Q psy14516         41 VKAPCVDCAS-VAENWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~-~~~~W~CL~Cg~v   63 (76)
                      ..+.|.+|+- .+..|.|+.||.-
T Consensus       625 ~~~~C~~CG~~~g~~~~CP~CG~~  648 (656)
T PRK08270        625 TFSICPKHGYLSGEHEFCPKCGEE  648 (656)
T ss_pred             CCcccCCCCCcCCCCCCCcCCcCc
Confidence            5678999996 6789999999954


No 62 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=32.35  E-value=27  Score=21.97  Aligned_cols=27  Identities=26%  Similarity=0.564  Sum_probs=20.1

Q ss_pred             CccccCcCCC------CCCeeeecccCceeecC
Q psy14516         41 VKAPCVDCAS------VAENWVCLICYQVRCGR   67 (76)
Q Consensus        41 ~~~~C~~C~~------~~~~W~CL~Cg~v~CgR   67 (76)
                      ....|..|+.      ....|-|-.|+....|-
T Consensus        34 ~ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~AGG   66 (90)
T PF01780_consen   34 AKYTCPFCGKTSVKRVATGIWKCKKCGKKFAGG   66 (90)
T ss_dssp             S-BEESSSSSSEEEEEETTEEEETTTTEEEE-B
T ss_pred             CCCcCCCCCCceeEEeeeEEeecCCCCCEEeCC
Confidence            4566888884      45689999999999885


No 63 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=32.29  E-value=38  Score=22.63  Aligned_cols=22  Identities=27%  Similarity=0.619  Sum_probs=19.2

Q ss_pred             cccCcCCCCCCeeeecccCceee
Q psy14516         43 APCVDCASVAENWVCLICYQVRC   65 (76)
Q Consensus        43 ~~C~~C~~~~~~W~CL~Cg~v~C   65 (76)
                      .-|.-|+.....=+| .||++.|
T Consensus        78 PgCP~CGn~~~fa~C-~CGkl~C   99 (131)
T PF15616_consen   78 PGCPHCGNQYAFAVC-GCGKLFC   99 (131)
T ss_pred             CCCCCCcChhcEEEe-cCCCEEE
Confidence            559999998888888 8999999


No 64 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.13  E-value=17  Score=23.52  Aligned_cols=22  Identities=27%  Similarity=0.650  Sum_probs=15.9

Q ss_pred             CCccccCcCCCC-----CC------eeeecccCc
Q psy14516         40 DVKAPCVDCASV-----AE------NWVCLICYQ   62 (76)
Q Consensus        40 ~~~~~C~~C~~~-----~~------~W~CL~Cg~   62 (76)
                      +...+| +|+..     ..      .+.|+.||.
T Consensus        68 p~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs  100 (124)
T PRK00762         68 PVEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGN  100 (124)
T ss_pred             CeeEEe-eCcCcccccccchhccccCCcCcCCCC
Confidence            467889 99966     22      167999994


No 65 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=32.11  E-value=12  Score=27.70  Aligned_cols=23  Identities=26%  Similarity=0.462  Sum_probs=18.2

Q ss_pred             CccccCcCCC-------CCCeeeecccCce
Q psy14516         41 VKAPCVDCAS-------VAENWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~-------~~~~W~CL~Cg~v   63 (76)
                      .+.+|..|..       .++.++|..||+-
T Consensus        25 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h   54 (285)
T TIGR00515        25 VWTKCPKCGQVLYTKELERNLEVCPKCDHH   54 (285)
T ss_pred             CeeECCCCcchhhHHHHHhhCCCCCCCCCc
Confidence            5888999984       3567899999873


No 66 
>PF12523 DUF3725:  Protein of unknown function (DUF3725);  InterPro: IPR022199  This domain family is found in viruses, and is approximately 70 amino acids in length. The family is found in association with PF01577 from PFAM. There is a conserved FLE sequence motif. 
Probab=31.38  E-value=25  Score=21.40  Aligned_cols=12  Identities=33%  Similarity=0.866  Sum_probs=8.6

Q ss_pred             CCeeeecccCce
Q psy14516         52 AENWVCLICYQV   63 (76)
Q Consensus        52 ~~~W~CL~Cg~v   63 (76)
                      .++|.|..|++.
T Consensus        57 ~Elw~Ch~C~~t   68 (74)
T PF12523_consen   57 SELWECHSCDNT   68 (74)
T ss_pred             cceEEeecCCCc
Confidence            567888777764


No 67 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.10  E-value=13  Score=27.99  Aligned_cols=22  Identities=18%  Similarity=0.459  Sum_probs=18.1

Q ss_pred             CccccCcCCC-------CCCeeeecccCc
Q psy14516         41 VKAPCVDCAS-------VAENWVCLICYQ   62 (76)
Q Consensus        41 ~~~~C~~C~~-------~~~~W~CL~Cg~   62 (76)
                      .+.+|..|..       .++.++|..||+
T Consensus        37 lw~kc~~C~~~~~~~~l~~~~~vcp~c~~   65 (296)
T CHL00174         37 LWVQCENCYGLNYKKFLKSKMNICEQCGY   65 (296)
T ss_pred             CeeECCCccchhhHHHHHHcCCCCCCCCC
Confidence            5888999984       366789999987


No 68 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=30.56  E-value=49  Score=19.88  Aligned_cols=27  Identities=26%  Similarity=0.632  Sum_probs=18.5

Q ss_pred             CccccCcCCC-------CCCeeeecccCceeecC
Q psy14516         41 VKAPCVDCAS-------VAENWVCLICYQVRCGR   67 (76)
Q Consensus        41 ~~~~C~~C~~-------~~~~W~CL~Cg~v~CgR   67 (76)
                      ..-+|.+|+.       ....-.|+.||.+.+--
T Consensus        18 l~VkCpdC~N~q~vFshast~V~C~~CG~~l~~P   51 (67)
T COG2051          18 LRVKCPDCGNEQVVFSHASTVVTCLICGTTLAEP   51 (67)
T ss_pred             EEEECCCCCCEEEEeccCceEEEecccccEEEec
Confidence            3456888884       23344599999988754


No 69 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=30.21  E-value=14  Score=27.44  Aligned_cols=23  Identities=26%  Similarity=0.475  Sum_probs=18.2

Q ss_pred             CccccCcCCC-------CCCeeeecccCce
Q psy14516         41 VKAPCVDCAS-------VAENWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~-------~~~~W~CL~Cg~v   63 (76)
                      .+.+|..|..       .++.++|..||+-
T Consensus        26 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h   55 (292)
T PRK05654         26 LWTKCPSCGQVLYRKELEANLNVCPKCGHH   55 (292)
T ss_pred             CeeECCCccchhhHHHHHhcCCCCCCCCCC
Confidence            5888999984       3567899999874


No 70 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=29.98  E-value=26  Score=17.01  Aligned_cols=20  Identities=20%  Similarity=0.534  Sum_probs=6.8

Q ss_pred             ccCcCCCCCCe---eeecccCce
Q psy14516         44 PCVDCASVAEN---WVCLICYQV   63 (76)
Q Consensus        44 ~C~~C~~~~~~---W~CL~Cg~v   63 (76)
                      .|..|+.....   ..|.+|..+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf~   24 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDFD   24 (30)
T ss_dssp             --TTTS----S--EEE-TTT---
T ss_pred             cCCcCCCcCCCCceEECccCCCc
Confidence            47777766553   348888654


No 71 
>PRK07218 replication factor A; Provisional
Probab=29.74  E-value=26  Score=27.44  Aligned_cols=23  Identities=22%  Similarity=0.407  Sum_probs=20.5

Q ss_pred             CccccCcCCCCCCeeeecccCce
Q psy14516         41 VKAPCVDCASVAENWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~~~~~W~CL~Cg~v   63 (76)
                      ...+|..|...-..|.|..||.+
T Consensus       296 li~rCP~C~r~v~~~~C~~hG~v  318 (423)
T PRK07218        296 LIERCPECGRVIQKGQCRSHGAV  318 (423)
T ss_pred             ceecCcCccccccCCcCCCCCCc
Confidence            45789999999999999999987


No 72 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=29.66  E-value=37  Score=16.35  Aligned_cols=14  Identities=21%  Similarity=0.657  Sum_probs=7.7

Q ss_pred             CeeeecccCceeec
Q psy14516         53 ENWVCLICYQVRCG   66 (76)
Q Consensus        53 ~~W~CL~Cg~v~Cg   66 (76)
                      ..|.|..|+.+.-.
T Consensus         3 g~W~C~~C~~~N~~   16 (30)
T PF00641_consen    3 GDWKCPSCTFMNPA   16 (30)
T ss_dssp             SSEEETTTTEEEES
T ss_pred             cCccCCCCcCCchH
Confidence            35666666655433


No 73 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=29.66  E-value=46  Score=27.50  Aligned_cols=36  Identities=19%  Similarity=0.466  Sum_probs=18.9

Q ss_pred             CCCCCCccCcccCCCCCCCCccccCcCCCCCCeeeecccCce
Q psy14516         22 LADCPHTPLVAPVPQSGVDVKAPCVDCASVAENWVCLICYQV   63 (76)
Q Consensus        22 ~~~CpHl~~l~~~~~~~~~~~~~C~~C~~~~~~W~CL~Cg~v   63 (76)
                      |+.||+.....+  .    ....|..|+..-..-.|..||..
T Consensus         1 M~~Cp~Cg~~n~--~----~akFC~~CG~~l~~~~Cp~CG~~   36 (645)
T PRK14559          1 MLICPQCQFENP--N----NNRFCQKCGTSLTHKPCPQCGTE   36 (645)
T ss_pred             CCcCCCCCCcCC--C----CCccccccCCCCCCCcCCCCCCC
Confidence            467888876442  1    22235555554433345555554


No 74 
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=29.35  E-value=33  Score=28.20  Aligned_cols=25  Identities=24%  Similarity=0.393  Sum_probs=20.4

Q ss_pred             CccccCcCCC--CCCeeeecccCceee
Q psy14516         41 VKAPCVDCAS--VAENWVCLICYQVRC   65 (76)
Q Consensus        41 ~~~~C~~C~~--~~~~W~CL~Cg~v~C   65 (76)
                      ..+.|.+|+-  .++.|.|+.||+..+
T Consensus       565 ~~~iC~~CG~~~~g~~~~CP~CGs~~~  591 (623)
T PRK08271        565 KITICNDCHHIDKRTGKRCPICGSENI  591 (623)
T ss_pred             CCccCCCCCCcCCCCCcCCcCCCCcch
Confidence            6788999997  567999999997543


No 75 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.31  E-value=26  Score=17.50  Aligned_cols=23  Identities=22%  Similarity=0.626  Sum_probs=15.3

Q ss_pred             cccCcCCCCCCeeeecccCceeec
Q psy14516         43 APCVDCASVAENWVCLICYQVRCG   66 (76)
Q Consensus        43 ~~C~~C~~~~~~W~CL~Cg~v~Cg   66 (76)
                      ..|..|+. .....|..|+.-.|+
T Consensus         3 ~~C~vC~~-~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    3 KLCSVCGN-PAKYRCPRCGARYCS   25 (30)
T ss_dssp             EEETSSSS-EESEE-TTT--EESS
T ss_pred             CCCccCcC-CCEEECCCcCCceeC
Confidence            35788888 777789999888776


No 76 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=29.16  E-value=32  Score=20.52  Aligned_cols=26  Identities=27%  Similarity=0.606  Sum_probs=10.6

Q ss_pred             ccccCcCCCCCCeeeecc-cCceeecC
Q psy14516         42 KAPCVDCASVAENWVCLI-CYQVRCGR   67 (76)
Q Consensus        42 ~~~C~~C~~~~~~W~CL~-Cg~v~CgR   67 (76)
                      ..+|+.|...-+.-+||. |.+++|+-
T Consensus         7 lLrCs~C~~~l~~pv~l~~CeH~fCs~   33 (65)
T PF14835_consen    7 LLRCSICFDILKEPVCLGGCEHIFCSS   33 (65)
T ss_dssp             TTS-SSS-S--SS-B---SSS--B-TT
T ss_pred             hcCCcHHHHHhcCCceeccCccHHHHH
Confidence            456788887777777754 88888764


No 77 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=28.85  E-value=21  Score=22.75  Aligned_cols=24  Identities=29%  Similarity=0.544  Sum_probs=17.0

Q ss_pred             CCccccCcCCCCC----CeeeecccCce
Q psy14516         40 DVKAPCVDCASVA----ENWVCLICYQV   63 (76)
Q Consensus        40 ~~~~~C~~C~~~~----~~W~CL~Cg~v   63 (76)
                      +...+|.+|+..-    ..+.|+.||..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         68 PAQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             CcEEEcccCCCEEecCCcCccCcCCCCC
Confidence            4678899998532    34669999853


No 78 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=28.57  E-value=32  Score=15.86  Aligned_cols=21  Identities=24%  Similarity=0.335  Sum_probs=11.5

Q ss_pred             CcCCCCCCeeeecccCceeec
Q psy14516         46 VDCASVAENWVCLICYQVRCG   66 (76)
Q Consensus        46 ~~C~~~~~~W~CL~Cg~v~Cg   66 (76)
                      ..|......-+-+.||++.|.
T Consensus         2 ~iC~~~~~~~~~~~C~H~~c~   22 (39)
T smart00184        2 PICLEELKDPVVLPCGHTFCR   22 (39)
T ss_pred             CcCccCCCCcEEecCCChHHH
Confidence            344444444455667776664


No 79 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=28.43  E-value=35  Score=14.49  Aligned_cols=13  Identities=23%  Similarity=0.539  Sum_probs=7.2

Q ss_pred             eeecccCceeecC
Q psy14516         55 WVCLICYQVRCGR   67 (76)
Q Consensus        55 W~CL~Cg~v~CgR   67 (76)
                      |.|..|+...-.+
T Consensus         1 ~~C~~C~~~~~~~   13 (24)
T PF13894_consen    1 FQCPICGKSFRSK   13 (24)
T ss_dssp             EE-SSTS-EESSH
T ss_pred             CCCcCCCCcCCcH
Confidence            6778887766544


No 80 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=28.20  E-value=53  Score=16.36  Aligned_cols=23  Identities=30%  Similarity=0.452  Sum_probs=15.0

Q ss_pred             cCcCCCCCCeee-ecccCceeecC
Q psy14516         45 CVDCASVAENWV-CLICYQVRCGR   67 (76)
Q Consensus        45 C~~C~~~~~~W~-CL~Cg~v~CgR   67 (76)
                      |..|...-.... =+.||+..|..
T Consensus         1 C~iC~~~~~~~~~~~~C~H~fC~~   24 (41)
T PF00097_consen    1 CPICLEPFEDPVILLPCGHSFCRD   24 (41)
T ss_dssp             ETTTSSBCSSEEEETTTSEEEEHH
T ss_pred             CCcCCccccCCCEEecCCCcchHH
Confidence            445555555555 78899988863


No 81 
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=27.17  E-value=33  Score=27.52  Aligned_cols=25  Identities=24%  Similarity=0.526  Sum_probs=19.5

Q ss_pred             CccccCcCCCC--CCeeeecccCceee
Q psy14516         41 VKAPCVDCASV--AENWVCLICYQVRC   65 (76)
Q Consensus        41 ~~~~C~~C~~~--~~~W~CL~Cg~v~C   65 (76)
                      ....|.+|+..  +..|.|+.||+-..
T Consensus       517 p~~~C~~CG~~~~~~~~~CP~CGs~~~  543 (555)
T cd01675         517 PIDICNDCGYIGEGEGFKCPKCGSEDV  543 (555)
T ss_pred             CCccCCCCCCCCcCCCCCCcCCCCcCc
Confidence            33489999985  58999999997543


No 82 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=26.84  E-value=37  Score=22.91  Aligned_cols=28  Identities=18%  Similarity=0.281  Sum_probs=21.1

Q ss_pred             CccccCcCCC------CCCeeeecccCceeecCC
Q psy14516         41 VKAPCVDCAS------VAENWVCLICYQVRCGRY   68 (76)
Q Consensus        41 ~~~~C~~C~~------~~~~W~CL~Cg~v~CgR~   68 (76)
                      ....|..|+.      ...+-.|..||.....|.
T Consensus       111 G~l~C~~Cg~~~~~~~~~~l~~Cp~C~~~~F~R~  144 (146)
T PF07295_consen  111 GTLVCENCGHEVELTHPERLPPCPKCGHTEFTRQ  144 (146)
T ss_pred             ceEecccCCCEEEecCCCcCCCCCCCCCCeeeeC
Confidence            5677888883      456777999998887764


No 83 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=26.62  E-value=42  Score=22.02  Aligned_cols=17  Identities=18%  Similarity=0.473  Sum_probs=13.4

Q ss_pred             CCeeeecc--------cCceeecCC
Q psy14516         52 AENWVCLI--------CYQVRCGRY   68 (76)
Q Consensus        52 ~~~W~CL~--------Cg~v~CgR~   68 (76)
                      ..+|+|-.        ||+.+|+-.
T Consensus        13 ~~l~i~~~~~k~vkc~CGh~f~d~r   37 (112)
T PF08882_consen   13 PHLWIVQKKDKVVKCDCGHEFCDAR   37 (112)
T ss_pred             CcEEEEEecCceeeccCCCeecChh
Confidence            46788877        999999843


No 84 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=26.31  E-value=36  Score=17.93  Aligned_cols=19  Identities=26%  Similarity=0.571  Sum_probs=10.9

Q ss_pred             eeeecccCceeecC--CCcch
Q psy14516         54 NWVCLICYQVRCGR--YIEEH   72 (76)
Q Consensus        54 ~W~CL~Cg~v~CgR--~~~~H   72 (76)
                      .-.|-.|+...|.+  +...|
T Consensus        13 ~~~C~~C~~~FC~~Hr~~e~H   33 (43)
T PF01428_consen   13 PFKCKHCGKSFCLKHRLPEDH   33 (43)
T ss_dssp             HEE-TTTS-EE-TTTHSTTTC
T ss_pred             CeECCCCCcccCccccCcccc
Confidence            34599999999986  44444


No 85 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=26.10  E-value=46  Score=18.32  Aligned_cols=11  Identities=18%  Similarity=0.498  Sum_probs=6.1

Q ss_pred             CCCeeeecccC
Q psy14516         51 VAENWVCLICY   61 (76)
Q Consensus        51 ~~~~W~CL~Cg   61 (76)
                      .+.-|-|+.|.
T Consensus        12 ~G~R~~C~~C~   22 (48)
T cd02341          12 PGTRYHCSECD   22 (48)
T ss_pred             ccceEECCCCC
Confidence            34455566665


No 86 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=26.08  E-value=34  Score=21.81  Aligned_cols=24  Identities=25%  Similarity=0.675  Sum_probs=17.2

Q ss_pred             CCccccCcCCCC----CCeeeecccCce
Q psy14516         40 DVKAPCVDCASV----AENWVCLICYQV   63 (76)
Q Consensus        40 ~~~~~C~~C~~~----~~~W~CL~Cg~v   63 (76)
                      +....|..|+..    ...+.|+.||..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (115)
T TIGR00100        68 PVECECEDCSEEVSPEIDLYRCPKCHGI   95 (115)
T ss_pred             CcEEEcccCCCEEecCCcCccCcCCcCC
Confidence            467789999853    235679999864


No 87 
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=25.42  E-value=39  Score=21.91  Aligned_cols=12  Identities=33%  Similarity=0.595  Sum_probs=10.0

Q ss_pred             CeeeecccCcee
Q psy14516         53 ENWVCLICYQVR   64 (76)
Q Consensus        53 ~~W~CL~Cg~v~   64 (76)
                      -.|.||.||.+-
T Consensus        81 v~vtC~~CG~~~   92 (105)
T COG2023          81 VVVTCLECGTIR   92 (105)
T ss_pred             EEEEecCCCcEE
Confidence            578899999873


No 88 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=24.80  E-value=57  Score=17.21  Aligned_cols=20  Identities=20%  Similarity=0.482  Sum_probs=11.6

Q ss_pred             cccCcCCCC------CCeeeecccCc
Q psy14516         43 APCVDCASV------AENWVCLICYQ   62 (76)
Q Consensus        43 ~~C~~C~~~------~~~W~CL~Cg~   62 (76)
                      ..|..|+..      ...+.|..||.
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~   29 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGY   29 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCC
Confidence            356666632      12566777775


No 89 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=24.76  E-value=60  Score=17.29  Aligned_cols=19  Identities=26%  Similarity=0.898  Sum_probs=11.8

Q ss_pred             cccCcCCC---CCCeeeecccC
Q psy14516         43 APCVDCAS---VAENWVCLICY   61 (76)
Q Consensus        43 ~~C~~C~~---~~~~W~CL~Cg   61 (76)
                      ..|..|..   .+.-|-|+.|.
T Consensus         5 ~~C~~C~~~~i~g~Ry~C~~C~   26 (46)
T PF00569_consen    5 YTCDGCGTDPIIGVRYHCLVCP   26 (46)
T ss_dssp             CE-SSS-SSSEESSEEEESSSS
T ss_pred             eECcCCCCCcCcCCeEECCCCC
Confidence            45667765   46778888886


No 90 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=24.51  E-value=58  Score=21.88  Aligned_cols=25  Identities=16%  Similarity=0.006  Sum_probs=17.3

Q ss_pred             CCccccCcCCC-----CCCeeeecccCcee
Q psy14516         40 DVKAPCVDCAS-----VAENWVCLICYQVR   64 (76)
Q Consensus        40 ~~~~~C~~C~~-----~~~~W~CL~Cg~v~   64 (76)
                      ..+..|.+|+.     .++.-+|..||.+.
T Consensus         7 GtKr~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300         7 GTKRICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             CccccCCCcCccccccCCCCccCCCcCCcc
Confidence            34556777773     46777888888774


No 91 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=24.18  E-value=35  Score=21.84  Aligned_cols=24  Identities=29%  Similarity=0.639  Sum_probs=16.6

Q ss_pred             CCccccCcCCCCC----Ceee-ecccCce
Q psy14516         40 DVKAPCVDCASVA----ENWV-CLICYQV   63 (76)
Q Consensus        40 ~~~~~C~~C~~~~----~~W~-CL~Cg~v   63 (76)
                      +....|.+|+...    ..+. |+.||..
T Consensus        69 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   97 (117)
T PRK00564         69 KVELECKDCSHVFKPNALDYGVCEKCHSK   97 (117)
T ss_pred             CCEEEhhhCCCccccCCccCCcCcCCCCC
Confidence            4677899998542    2344 9999864


No 92 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=24.15  E-value=35  Score=23.94  Aligned_cols=15  Identities=33%  Similarity=0.669  Sum_probs=12.4

Q ss_pred             CeeeecccCceeecC
Q psy14516         53 ENWVCLICYQVRCGR   67 (76)
Q Consensus        53 ~~W~CL~Cg~v~CgR   67 (76)
                      +.|+|..||...-.+
T Consensus        47 ~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen   47 EVWVCPHCGYAAFEE   61 (214)
T ss_pred             eEEECCCCCCccccc
Confidence            689999999887665


No 93 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=23.62  E-value=42  Score=16.78  Aligned_cols=7  Identities=29%  Similarity=0.619  Sum_probs=3.4

Q ss_pred             eecccCc
Q psy14516         56 VCLICYQ   62 (76)
Q Consensus        56 ~CL~Cg~   62 (76)
                      .|..||.
T Consensus        28 ~CP~Cg~   34 (41)
T smart00834       28 TCPECGG   34 (41)
T ss_pred             CCCCCCC
Confidence            3555554


No 94 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=23.35  E-value=54  Score=19.15  Aligned_cols=27  Identities=30%  Similarity=0.650  Sum_probs=17.8

Q ss_pred             CccccCcCCCC------CCee-eecccCceeecC
Q psy14516         41 VKAPCVDCASV------AENW-VCLICYQVRCGR   67 (76)
Q Consensus        41 ~~~~C~~C~~~------~~~W-~CL~Cg~v~CgR   67 (76)
                      ..-+|.+|...      ...+ .|..||.+.+--
T Consensus        10 ~~VkCp~C~n~q~vFsha~t~V~C~~Cg~~L~~P   43 (59)
T PRK00415         10 LKVKCPDCGNEQVVFSHASTVVRCLVCGKTLAEP   43 (59)
T ss_pred             EEEECCCCCCeEEEEecCCcEEECcccCCCcccC
Confidence            34568888843      2333 499999888754


No 95 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=23.11  E-value=39  Score=21.55  Aligned_cols=24  Identities=17%  Similarity=0.393  Sum_probs=17.1

Q ss_pred             CCccccCcCCCCC----C-eeeecccCce
Q psy14516         40 DVKAPCVDCASVA----E-NWVCLICYQV   63 (76)
Q Consensus        40 ~~~~~C~~C~~~~----~-~W~CL~Cg~v   63 (76)
                      +....|.+|+..-    . .+.|+.||..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         68 EAECWCETCQQYVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             CcEEEcccCCCeeecCCccCCcCcCcCCC
Confidence            4678899998542    2 2669999964


No 97 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.95  E-value=58  Score=25.69  Aligned_cols=23  Identities=22%  Similarity=0.310  Sum_probs=18.5

Q ss_pred             CccccCcCCCCCC-eeeecccCce
Q psy14516         41 VKAPCVDCASVAE-NWVCLICYQV   63 (76)
Q Consensus        41 ~~~~C~~C~~~~~-~W~CL~Cg~v   63 (76)
                      ....|.-|+.... .|.|..||..
T Consensus       239 ~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       239 GKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             CeEEcCCCcCcCCCCCCCCCCCCC
Confidence            4677999997765 8999999874


No 98 
>PRK11032 hypothetical protein; Provisional
Probab=22.81  E-value=46  Score=22.90  Aligned_cols=28  Identities=18%  Similarity=0.268  Sum_probs=21.6

Q ss_pred             CccccCcCC------CCCCeeeecccCceeecCC
Q psy14516         41 VKAPCVDCA------SVAENWVCLICYQVRCGRY   68 (76)
Q Consensus        41 ~~~~C~~C~------~~~~~W~CL~Cg~v~CgR~   68 (76)
                      ....|..|+      ....+-.|..||+....|-
T Consensus       123 G~LvC~~Cg~~~~~~~p~~i~pCp~C~~~~F~R~  156 (160)
T PRK11032        123 GNLVCEKCHHHLAFYTPEVLPLCPKCGHDQFQRR  156 (160)
T ss_pred             ceEEecCCCCEEEecCCCcCCCCCCCCCCeeeeC
Confidence            567788888      3566777999999888774


No 99 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=22.78  E-value=51  Score=24.97  Aligned_cols=28  Identities=18%  Similarity=0.449  Sum_probs=19.8

Q ss_pred             CCccccCcCCCCCCeeeecccCceeecC
Q psy14516         40 DVKAPCVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      .....|.+|+...-.|.--.=|.+.|.|
T Consensus        18 ~~Nk~CaDCga~~P~W~S~nlGvfiCi~   45 (319)
T COG5347          18 SSNKKCADCGAPNPTWASVNLGVFLCID   45 (319)
T ss_pred             cccCccccCCCCCCceEecccCeEEEee
Confidence            4677899999999999844444444443


No 100
>PHA00616 hypothetical protein
Probab=22.40  E-value=9.1  Score=21.12  Aligned_cols=19  Identities=26%  Similarity=0.356  Sum_probs=11.4

Q ss_pred             eecccCceeecCC-Ccchhc
Q psy14516         56 VCLICYQVRCGRY-IEEHSN   74 (76)
Q Consensus        56 ~CL~Cg~v~CgR~-~~~Ha~   74 (76)
                      -|+.||.+..-.+ -..|.+
T Consensus         3 qC~~CG~~F~~~s~l~~H~r   22 (44)
T PHA00616          3 QCLRCGGIFRKKKEVIEHLL   22 (44)
T ss_pred             ccchhhHHHhhHHHHHHHHH
Confidence            4888888776543 244443


No 101
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=22.35  E-value=49  Score=25.90  Aligned_cols=10  Identities=30%  Similarity=0.879  Sum_probs=7.7

Q ss_pred             CeeeecccCc
Q psy14516         53 ENWVCLICYQ   62 (76)
Q Consensus        53 ~~W~CL~Cg~   62 (76)
                      +.|.|..||.
T Consensus       457 ~~~~cp~c~~  466 (479)
T PRK05452        457 DNFLCPECSL  466 (479)
T ss_pred             CCCcCcCCCC
Confidence            4688888875


No 102
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=22.26  E-value=27  Score=18.00  Aligned_cols=28  Identities=18%  Similarity=0.501  Sum_probs=16.8

Q ss_pred             CCCCCccCcccCCCCCC---CCccccCcCCC
Q psy14516         23 ADCPHTPLVAPVPQSGV---DVKAPCVDCAS   50 (76)
Q Consensus        23 ~~CpHl~~l~~~~~~~~---~~~~~C~~C~~   50 (76)
                      ..||+....-.++...+   ....+|..|+.
T Consensus         3 i~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~   33 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIPPKGRKVRCSKCGH   33 (36)
T ss_pred             EECCCCCCEEeCCHHHCCCCCcEEECCCCCC
Confidence            46888887544444322   24667887764


No 103
>PHA00626 hypothetical protein
Probab=21.93  E-value=72  Score=18.69  Aligned_cols=25  Identities=16%  Similarity=0.179  Sum_probs=20.2

Q ss_pred             ccccCcCCCCCCeeeecccCceeec
Q psy14516         42 KAPCVDCASVAENWVCLICYQVRCG   66 (76)
Q Consensus        42 ~~~C~~C~~~~~~W~CL~Cg~v~Cg   66 (76)
                      ..+|..|...++...|..||+..--
T Consensus        11 Ivrcg~cr~~snrYkCkdCGY~ft~   35 (59)
T PHA00626         11 IAKEKTMRGWSDDYVCCDCGYNDSK   35 (59)
T ss_pred             eeeeceecccCcceEcCCCCCeech
Confidence            3468888888999999999987654


No 104
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=21.47  E-value=43  Score=18.09  Aligned_cols=23  Identities=26%  Similarity=0.111  Sum_probs=12.1

Q ss_pred             cCcCCCCCCeeeecccCceeecC
Q psy14516         45 CVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        45 C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      |.-|+..-+.-+.+.||++.|.+
T Consensus         4 Cpi~~~~~~~Pv~~~~G~v~~~~   26 (63)
T smart00504        4 CPISLEVMKDPVILPSGQTYERR   26 (63)
T ss_pred             CcCCCCcCCCCEECCCCCEEeHH
Confidence            44444443444556666666654


No 105
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=21.46  E-value=44  Score=17.56  Aligned_cols=9  Identities=22%  Similarity=0.331  Sum_probs=4.6

Q ss_pred             eeeecccCc
Q psy14516         54 NWVCLICYQ   62 (76)
Q Consensus        54 ~W~CL~Cg~   62 (76)
                      ...|..||.
T Consensus        26 ~~~CP~Cg~   34 (42)
T PF09723_consen   26 PVPCPECGS   34 (42)
T ss_pred             CCcCCCCCC
Confidence            344555554


No 106
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=21.43  E-value=56  Score=26.87  Aligned_cols=26  Identities=15%  Similarity=0.268  Sum_probs=20.9

Q ss_pred             CCccccCcCCC--CCCeeeecccCceee
Q psy14516         40 DVKAPCVDCAS--VAENWVCLICYQVRC   65 (76)
Q Consensus        40 ~~~~~C~~C~~--~~~~W~CL~Cg~v~C   65 (76)
                      .....|.+|+.  ....+.|..||.-.+
T Consensus       566 p~~~~C~~CG~~~~g~~~~CP~CGs~~~  593 (625)
T PRK08579        566 PAITVCNKCGRSTTGLYTRCPRCGSEDV  593 (625)
T ss_pred             CCCccCCCCCCccCCCCCcCcCCCCchh
Confidence            36788999996  588999999997543


No 107
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=21.05  E-value=93  Score=16.94  Aligned_cols=11  Identities=18%  Similarity=0.461  Sum_probs=6.4

Q ss_pred             CCCeeeecccC
Q psy14516         51 VAENWVCLICY   61 (76)
Q Consensus        51 ~~~~W~CL~Cg   61 (76)
                      .+.-|-|+.|.
T Consensus        12 ~G~RykC~~C~   22 (45)
T cd02344          12 NGPRFKCRNCD   22 (45)
T ss_pred             ccCeEECCCCC
Confidence            34556666665


No 108
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=21.04  E-value=80  Score=26.35  Aligned_cols=28  Identities=21%  Similarity=0.660  Sum_probs=24.2

Q ss_pred             CCccccCcCCCCCCeeeecccCceeecC
Q psy14516         40 DVKAPCVDCASVAENWVCLICYQVRCGR   67 (76)
Q Consensus        40 ~~~~~C~~C~~~~~~W~CL~Cg~v~CgR   67 (76)
                      +....|.+|+...-.|+|+.-|..-|-+
T Consensus        21 PgNk~CADCgs~~P~WASiNlGIFICi~   48 (648)
T PLN03119         21 PPNRRCINCNSLGPQYVCTTFWTFVCMA   48 (648)
T ss_pred             cCCCccccCCCCCCCceeeccceEEecc
Confidence            4677899999999999999888888875


No 109
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=20.54  E-value=81  Score=17.41  Aligned_cols=21  Identities=29%  Similarity=0.683  Sum_probs=13.8

Q ss_pred             ccCcCCC-----CCCeeeecccCcee
Q psy14516         44 PCVDCAS-----VAENWVCLICYQVR   64 (76)
Q Consensus        44 ~C~~C~~-----~~~~W~CL~Cg~v~   64 (76)
                      .|..|+.     ..+.|.|-.||...
T Consensus        22 fCP~Cg~~~m~~~~~r~~C~~Cgyt~   47 (50)
T PRK00432         22 FCPRCGSGFMAEHLDRWHCGKCGYTE   47 (50)
T ss_pred             cCcCCCcchheccCCcEECCCcCCEE
Confidence            4666654     45677788887654


No 110
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=20.32  E-value=63  Score=15.24  Aligned_cols=7  Identities=29%  Similarity=0.657  Sum_probs=3.4

Q ss_pred             eecccCc
Q psy14516         56 VCLICYQ   62 (76)
Q Consensus        56 ~CL~Cg~   62 (76)
                      .|..||.
T Consensus        18 fC~~CG~   24 (26)
T PF13248_consen   18 FCPNCGA   24 (26)
T ss_pred             cChhhCC
Confidence            3555553


No 111
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=20.15  E-value=55  Score=17.51  Aligned_cols=11  Identities=27%  Similarity=0.908  Sum_probs=7.4

Q ss_pred             ecccCceeecC
Q psy14516         57 CLICYQVRCGR   67 (76)
Q Consensus        57 CL~Cg~v~CgR   67 (76)
                      |-.||.+.|+.
T Consensus        21 Cr~Cg~~~C~~   31 (57)
T cd00065          21 CRNCGRIFCSK   31 (57)
T ss_pred             cCcCcCCcChH
Confidence            66777776664


No 112
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=20.04  E-value=53  Score=26.85  Aligned_cols=25  Identities=20%  Similarity=0.518  Sum_probs=19.2

Q ss_pred             CccccCcCCCC-CCe-eeecccCceee
Q psy14516         41 VKAPCVDCASV-AEN-WVCLICYQVRC   65 (76)
Q Consensus        41 ~~~~C~~C~~~-~~~-W~CL~Cg~v~C   65 (76)
                      ..+.|.+|+-. ++. |.|+.||+..+
T Consensus       531 ~~siC~~CGy~~g~~~~~CP~CGs~~~  557 (586)
T TIGR02827       531 KITICNDCHHIDKRTLHRCPVCGSANI  557 (586)
T ss_pred             CCeecCCCCCcCCCcCCcCcCCCCccc
Confidence            67889999984 544 99999996443


Done!