Query         psy14529
Match_columns 59
No_of_seqs    34 out of 36
Neff          2.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:12:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14529.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14529hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01175 IPT_COE IPT domain of   99.7 2.3E-18   5E-23  109.5   3.6   34   26-59      8-41  (85)
  2 KOG3836|consensus               98.5 4.6E-08   1E-12   78.3   1.7   53    1-53    248-357 (605)
  3 KOG3836|consensus               97.9 4.3E-06 9.3E-11   67.2   1.3   59    1-59      9-109 (605)
  4 cd00603 IPT_PCSR IPT domain of  97.5 0.00014 3.1E-09   42.2   3.2   31   26-56      8-41  (90)
  5 cd00102 IPT Immunoglobulin-lik  97.4  0.0002 4.2E-09   40.6   3.1   30   26-55      8-40  (89)
  6 PF01833 TIG:  IPT/TIG domain;   97.0 0.00046   1E-08   38.3   1.6   32   26-57      8-42  (85)
  7 smart00429 IPT ig-like, plexin  96.5  0.0035 7.6E-08   36.2   2.9   28   26-53      9-36  (90)
  8 cd01179 IPT_plexin_repeat2 Sec  96.4  0.0045 9.8E-08   36.5   3.2   30   26-55      8-39  (85)
  9 cd01180 IPT_plexin_repeat1 Fir  93.9   0.074 1.6E-06   32.1   3.0   30   26-55      8-42  (94)
 10 cd01178 IPT_NFAT IPT domain of  88.1    0.63 1.4E-05   30.2   2.9   28   27-54     10-37  (101)
 11 cd00602 IPT_TF IPT domain of e  86.5    0.89 1.9E-05   28.9   2.9   28   27-54      9-37  (101)
 12 cd01176 IPT_RBP-Jkappa IPT dom  83.3     1.2 2.7E-05   29.2   2.5   22   35-56     20-41  (97)
 13 cd01181 IPT_plexin_repeat3 Thi  79.3     1.7 3.7E-05   26.8   2.0   23   26-48      8-30  (99)
 14 cd01177 IPT_NFkappaB IPT domai  69.3     6.8 0.00015   25.6   3.0   29   27-55      9-38  (102)
 15 cd00604 IPT_CGTD IPT domain (d  68.8     5.6 0.00012   24.0   2.4   22   34-55     14-36  (81)
 16 cd02849 CGTase_C_term Cgtase (  64.9     7.4 0.00016   23.4   2.4   22   34-55     16-38  (81)
 17 PF03525 Meiotic_rec114:  Meiot  64.3     2.8   6E-05   32.3   0.5   11    1-11     96-106 (328)
 18 PF13734 Inhibitor_I69:  Spi pr  48.7      19 0.00042   22.7   2.4   18    6-24     54-71  (96)
 19 PRK11700 hypothetical protein;  46.4     8.5 0.00018   27.5   0.6    7   26-32    107-113 (187)
 20 KOG0813|consensus               43.4      42 0.00092   24.9   3.8   41    7-48    111-153 (265)
 21 PF04448 DUF551:  Protein of un  43.4      14 0.00031   20.1   1.1   17   19-40      3-19  (69)
 22 cd01819 Patatin_and_cPLA2 Pata  39.6      26 0.00057   22.4   2.0   20   14-39    129-153 (155)
 23 KOG0179|consensus               37.7      21 0.00047   26.6   1.5   13   32-44     28-40  (235)
 24 PTZ00422 glideosome-associated  37.4      17 0.00037   28.1   1.0   42    4-49     13-73  (394)
 25 PLN02199 shikimate kinase       37.1      19 0.00042   27.1   1.2   26    2-27     39-73  (303)
 26 PF06007 PhnJ:  Phosphonate met  31.8      32 0.00069   26.2   1.6   22   22-43     36-60  (277)
 27 KOG3374|consensus               31.6      39 0.00085   24.8   2.0   23    7-29     62-88  (210)
 28 PF10633 NPCBM_assoc:  NPCBM-as  30.4      77  0.0017   17.9   2.8   18   19-37     24-43  (78)
 29 cd07268 Glo_EDI_BRP_like_4 Thi  26.7      28 0.00061   24.1   0.6    7   26-32     69-75  (149)
 30 PF05159 Capsule_synth:  Capsul  26.0      42  0.0009   22.8   1.3   18   34-51    218-235 (269)
 31 TIGR02961 allantoicase allanto  25.0      44 0.00095   25.5   1.4   15   11-25      7-21  (322)
 32 smart00539 NIDO Extracellular   24.5 1.1E+02  0.0023   20.4   3.0   29    4-36     69-97  (152)
 33 PF03561 Allantoicase:  Allanto  24.2      46   0.001   22.5   1.3   10   16-25      2-11  (152)
 34 PF11886 DUF3406:  Domain of un  21.5      68  0.0015   24.3   1.8   21   30-50    132-152 (273)
 35 TIGR00013 taut 4-oxalocrotonat  21.3      31 0.00068   18.5  -0.0   15   23-37     44-58  (63)
 36 PRK11170 nagA N-acetylglucosam  21.0 1.5E+02  0.0033   22.0   3.5   26   16-41    266-296 (382)
 37 TIGR01554 major_cap_HK97 phage  20.7 1.1E+02  0.0023   22.2   2.6   29   11-42    298-327 (378)
 38 COG2986 HutH Histidine ammonia  20.5      26 0.00055   28.5  -0.6   28   17-52    305-335 (498)
 39 COG2764 PhnB Uncharacterized p  20.5 2.4E+02  0.0051   18.7   4.1   33    7-39     48-81  (136)
 40 cd05472 cnd41_like Chloroplast  20.4      64  0.0014   22.0   1.4   18   36-53    269-286 (299)
 41 PRK10148 hypothetical protein;  20.4 2.5E+02  0.0054   18.0   4.6   36    7-42     59-94  (147)
 42 PHA02146 hypothetical protein   20.2      38 0.00083   21.8   0.2   10   22-31     54-63  (86)
 43 PRK13257 allantoicase; Provisi  20.1      66  0.0014   24.8   1.5   15   11-25     22-36  (336)

No 1  
>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors. COE family proteins are all transcription factors and play an important role in variety of developmental processes. Mouse EBF is involved in the regulation of the early stages of B-cell differentiation, Drosophila collier is a regulator of the head patterning, and a related protein in Xenopus is involved in primary neurogenesis. All COE family members have a well conserved DNA binding domain that contains an atypical Zn finger motif. The function of the IPT domain is unknown.
Probab=99.73  E-value=2.3e-18  Score=109.54  Aligned_cols=34  Identities=94%  Similarity=1.653  Sum_probs=33.5

Q ss_pred             CCCCceecCeEEEEecCccccceeeEEeeeEeeC
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDGLQVVFGTMLVWS   59 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~GLqvvfG~~lvws   59 (59)
                      |+|||++||++|+|+|||||+||||+||++.+|+
T Consensus         8 P~eG~~tGGt~VtI~GenF~~gl~V~FG~~~~w~   41 (85)
T cd01175           8 PSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWS   41 (85)
T ss_pred             CCCCcccCCeEEEEECCCCCCCcEEEECCEeEEE
Confidence            9999999999999999999999999999999996


No 2  
>KOG3836|consensus
Probab=98.49  E-value=4.6e-08  Score=78.26  Aligned_cols=53  Identities=32%  Similarity=0.232  Sum_probs=50.8

Q ss_pred             CceEEEEEEeeeccCCceEEEecCC-------------------------------------------------------
Q psy14529          1 MRRFQVVISTQVGVDGPLLAVSDNI-------------------------------------------------------   25 (59)
Q Consensus         1 mRrfqV~vstt~~vdg~~LavSDnm-------------------------------------------------------   25 (59)
                      |||||+.+.+.+.+++..++.+|+|                                                       
T Consensus       248 ~~~~Q~~i~~~~~v~~~g~n~~~~als~~~~~~s~~~~~l~~~d~~~~v~~~i~~~~~~~~~~~~~~~~~~~~~~~~i~~  327 (605)
T KOG3836|consen  248 MRRFQVLINGGVEVTLLGANFKDIALSTQCSEESTMVNYLPPSDNPGSVSVSITDPSETSDSNNSNSSPPTSSSTKAIFT  327 (605)
T ss_pred             cccccccccccceecccccchhhhhhcccccccccceeeccccccCCCceeeeccccccccccccccCCccCCCccccee
Confidence            7999999999999999999999988                                                       


Q ss_pred             --CCCCceecCeEEEEecCccccceeeEEe
Q psy14529         26 --PSEGWTSGGATVIIVGDNFFDGLQVVFG   53 (59)
Q Consensus        26 --pseGW~tgG~tViiiG~nFf~GLqvvfG   53 (59)
                        |++||..||..+.|+|.|||.||++.||
T Consensus       328 yvp~t~~q~~~~al~ivg~n~~~~l~~a~~  357 (605)
T KOG3836|consen  328 YVPSTDRQLIEYALQIVGLNMNGKLEDARN  357 (605)
T ss_pred             eecCCCceeeeeEEEEecccccCchhhhcC
Confidence              9999999999999999999999999998


No 3  
>KOG3836|consensus
Probab=97.90  E-value=4.3e-06  Score=67.22  Aligned_cols=59  Identities=19%  Similarity=0.088  Sum_probs=54.4

Q ss_pred             CceEEEEEEe-eeccCCceEEEecCC-----------------------------------------CCCCceecCeEEE
Q psy14529          1 MRRFQVVIST-QVGVDGPLLAVSDNI-----------------------------------------PSEGWTSGGATVI   38 (59)
Q Consensus         1 mRrfqV~vst-t~~vdg~~LavSDnm-----------------------------------------pseGW~tgG~tVi   38 (59)
                      |+++|..+++ .+....+.|+++|++                                         |++.|..++.+..
T Consensus         9 ~~~iq~~l~~~~~~~~~~~l~~~~~n~l~~~v~n~~~~pld~~~~~l~~v~t~~~~~~~v~~~~~~~~~~ahfek~~p~~   88 (605)
T KOG3836|consen    9 IASIQGPLHRHVVFGRKEPLRTVYANPLDNIVINPQQLPLDLEVIGLPKVSTPRKNEFIVFNSKQLFPIRAHFEKDLPTR   88 (605)
T ss_pred             hhhccCccccCccccCCCcccchhcccccccccCcccccCChhhhccccccCcccccccccccccccchhhhcccCCCcc
Confidence            6789999999 899999999999998                                         6788888999999


Q ss_pred             EecCccccceeeEEeeeEeeC
Q psy14529         39 IVGDNFFDGLQVVFGTMLVWS   59 (59)
Q Consensus        39 iiG~nFf~GLqvvfG~~lvws   59 (59)
                      |+++|||+++|.+|+.|++|+
T Consensus        89 l~~~nffH~~~~~F~~m~ly~  109 (605)
T KOG3836|consen   89 LVCYNFFHKAQNGFVVMALYK  109 (605)
T ss_pred             ccccceecccccceEEEEeec
Confidence            999999999999999999985


No 4  
>cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins . This subgroup contains IPT domains of plexins, receptors, like the plasminogen-related growth factor receptors, the hepatocyte growth factor-scatter factors, and the macrophage-stimulating receptors and of fibrocystin. Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT_PCSR domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.
Probab=97.48  E-value=0.00014  Score=42.15  Aligned_cols=31  Identities=39%  Similarity=0.621  Sum_probs=28.6

Q ss_pred             CCCCceecCeEEEEecCccccc---eeeEEeeeE
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDG---LQVVFGTML   56 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~G---LqvvfG~~l   56 (59)
                      |+.|+..||+.|.|.|.||.+.   ++|.||...
T Consensus         8 P~~g~~~Ggt~vtI~G~~f~~~~~~~~V~ig~~~   41 (90)
T cd00603           8 PSSGPLSGGTRLTITGSNLGSGSPRVRVTVGGVP   41 (90)
T ss_pred             CCCCCCCCCeEEEEEEECCCCCCceEEEEECCEE
Confidence            9999999999999999999998   899998753


No 5  
>cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT). IPTs are also known as Transcription factor ImmunoGlobin (TIG) domains. They are present in intracellular transcription factors, cell surface receptors (such as plexins and scatter factor receptors), as well as, cyclodextrin glycosyltransferase and similar enzymes. Although they are involved in DNA binding in transcription factors, their function in other proteins is unknown. In these transcription factors, IPTs form homo- or heterodimers with the exception of the nuclear factor of activated Tcells (NFAT) transcription factors which are mainly monomers.
Probab=97.40  E-value=0.0002  Score=40.57  Aligned_cols=30  Identities=53%  Similarity=0.856  Sum_probs=28.0

Q ss_pred             CCCCceecCeEEEEecCccccc--eeeEE-eee
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDG--LQVVF-GTM   55 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~G--Lqvvf-G~~   55 (59)
                      |..|...||+.|.|.|+||-++  .+|.| |..
T Consensus         8 P~~g~~~GGt~itI~G~~f~~~~~~~v~~~g~~   40 (89)
T cd00102           8 PSSGPVSGGTEVTITGSNFGSGSNLRVTFGGGV   40 (89)
T ss_pred             CCcCCCCCCeEEEEEEECCCCCCcEEEEEeCCC
Confidence            9999999999999999999999  99999 654


No 6  
>PF01833 TIG:  IPT/TIG domain;  InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold. These domains are found in cell surface receptors such as Met and Ron as well as in intracellular transcription factors where it is involved in DNA binding. The Ron tyrosine kinase receptor shares with the members of its subfamily (Met and Sea) a unique functional feature: the control of cell dissociation, motility, and invasion of extracellular matrices (scattering) [].; GO: 0005515 protein binding; PDB: 3HRP_A 1UAD_D 3MLP_E 9CGT_A 3CGT_A 6CGT_A 4CGT_A 1CGT_A 7CGT_A 1CGU_A ....
Probab=96.97  E-value=0.00046  Score=38.32  Aligned_cols=32  Identities=34%  Similarity=0.611  Sum_probs=29.3

Q ss_pred             CCCCceecCeEEEEecCcc---ccceeeEEeeeEe
Q psy14529         26 PSEGWTSGGATVIIVGDNF---FDGLQVVFGTMLV   57 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nF---f~GLqvvfG~~lv   57 (59)
                      |+.|+..||..|.|.|.||   -+-+++.||....
T Consensus         8 P~~~~~~gg~~ItI~G~~f~~~~~~~~v~i~~~~~   42 (85)
T PF01833_consen    8 PNSGSISGGTNITITGSNFGSNSSNISVKIGGSQC   42 (85)
T ss_dssp             SSEEETTCTSEEEEEEESSESSSTTEEEEETTEEE
T ss_pred             CCeEecCCCEEEEEEEEeecccCCceEEEECCEee
Confidence            9999999999999999999   8899999987653


No 7  
>smart00429 IPT ig-like, plexins, transcription factors.
Probab=96.45  E-value=0.0035  Score=36.16  Aligned_cols=28  Identities=29%  Similarity=0.426  Sum_probs=24.9

Q ss_pred             CCCCceecCeEEEEecCccccceeeEEe
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDGLQVVFG   53 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~GLqvvfG   53 (59)
                      |+.|+..||+.|+|.|.||-++-++.+.
T Consensus         9 P~~g~~~GGt~iti~G~nf~~~~~~~~~   36 (90)
T smart00429        9 PTSGPVSGGTEITLCGKNLDSISVVFVE   36 (90)
T ss_pred             cCcCcCCCCeEEEEeeecCCcceEEEEE
Confidence            9999999999999999999887776553


No 8  
>cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.
Probab=96.40  E-value=0.0045  Score=36.55  Aligned_cols=30  Identities=37%  Similarity=0.606  Sum_probs=27.3

Q ss_pred             CCCCceecCeEEEEecCccccc--eeeEEeee
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDG--LQVVFGTM   55 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~G--LqvvfG~~   55 (59)
                      |++|=..||++|.|.|.||-++  .+|.||..
T Consensus         8 P~~Gp~~GGT~vtI~G~~~~~~~~~~V~ig~~   39 (85)
T cd01179           8 PSYGPQSGGTRLTITGKHLNAGSSVRVTVGGQ   39 (85)
T ss_pred             CCCCCCCCCEEEEEEEECCCCCCeEEEEECCe
Confidence            9999999999999999999888  77888865


No 9  
>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.
Probab=93.94  E-value=0.074  Score=32.11  Aligned_cols=30  Identities=30%  Similarity=0.372  Sum_probs=26.2

Q ss_pred             CCCCceecCeEEEEecCccccc-----eeeEEeee
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDG-----LQVVFGTM   55 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~G-----LqvvfG~~   55 (59)
                      |..|=..||+.|+|-|.||-.+     .+|.+|..
T Consensus         8 P~~Gp~~GGT~vTI~G~nl~~~~~~~~~~V~ig~~   42 (94)
T cd01180           8 PLSGPLEGGTRLTICGSNLGLRKNDVRHGVRVGGV   42 (94)
T ss_pred             CCCCCCCCCEEEEEEEEcCCCCcccceeEEEECCE
Confidence            9999999999999999999988     46777754


No 10 
>cd01178 IPT_NFAT IPT domain of the NFAT family of transcription factors. NFAT transcription complexes are a target of calcineurin, a calcium dependent phosphatase, and activate genes mainly involved in cell-cell-interaction.
Probab=88.12  E-value=0.63  Score=30.21  Aligned_cols=28  Identities=29%  Similarity=0.572  Sum_probs=25.0

Q ss_pred             CCCceecCeEEEEecCccccceeeEEee
Q psy14529         27 SEGWTSGGATVIIVGDNFFDGLQVVFGT   54 (59)
Q Consensus        27 seGW~tgG~tViiiG~nFf~GLqvvfG~   54 (59)
                      +.|-..||..++++||||-...+|+|--
T Consensus        10 ~s~sv~GG~Ev~Ll~~k~~kDikV~F~E   37 (101)
T cd01178          10 NSCSVNGGEELFLTGKNFLKDSKVVFQE   37 (101)
T ss_pred             CceeecCCCEEEEEehhcCCCCEEEEEE
Confidence            4566899999999999999999999974


No 11 
>cd00602 IPT_TF IPT domain of eukaryotic transcription factors NF-kappaB/Rel, nuclear factor of activated Tcells (NFAT), and  recombination signal J-kappa binding protein (RBP-Jkappa). The IPT domains in these proteins are involved in DNA binding. Most NF-kappaB/Rel proteins form homo- and heterodimers, while NFAT proteins are largely monomeric (with TonEBP being an exception). While the majority of sequence-specific DNA binding elements are found in the N-terminal domain, several are found in the IPT domain in loops adjacent to, and including, the linker region.
Probab=86.48  E-value=0.89  Score=28.94  Aligned_cols=28  Identities=29%  Similarity=0.522  Sum_probs=24.3

Q ss_pred             CCCceecCeEEEEecCcccc-ceeeEEee
Q psy14529         27 SEGWTSGGATVIIVGDNFFD-GLQVVFGT   54 (59)
Q Consensus        27 seGW~tgG~tViiiG~nFf~-GLqvvfG~   54 (59)
                      .+|-..||..++++++||-- .++|.|+.
T Consensus         9 ~s~~~~GG~ev~Ll~~k~~k~dikV~F~e   37 (101)
T cd00602           9 LSGSVNGGDEVFLLCDKVNKPDIKVWFGE   37 (101)
T ss_pred             CeeEcCCCcEEEEEecCCCCCCCEEEEEe
Confidence            35666799999999999866 99999997


No 12 
>cd01176 IPT_RBP-Jkappa IPT domain of the recombination signal Jkappa binding protein (RBP-Jkappa). RBP-J kappa, was initially considered to be involved in V(D)J recombination because of its DNA binding specificity and structural similarity to site-specific recombinases known as the integrase family. Further studies indicated that RBP-J kappa functions as a repressor of transcription, via destabilization of the general transcription factor IID and recruitment of histone deacetylase complexes.
Probab=83.30  E-value=1.2  Score=29.25  Aligned_cols=22  Identities=36%  Similarity=0.576  Sum_probs=19.6

Q ss_pred             eEEEEecCccccceeeEEeeeE
Q psy14529         35 ATVIIVGDNFFDGLQVVFGTML   56 (59)
Q Consensus        35 ~tViiiG~nFf~GLqvvfG~~l   56 (59)
                      +.+-+.||||-..|+|-||...
T Consensus        20 amlEl~GenF~pnLkVWFG~ve   41 (97)
T cd01176          20 AMLELHGENFTPNLKVWFGDVE   41 (97)
T ss_pred             EEEEEecCcCCCCceEEECCcc
Confidence            6778899999999999999764


No 13 
>cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.
Probab=79.28  E-value=1.7  Score=26.76  Aligned_cols=23  Identities=26%  Similarity=0.469  Sum_probs=20.6

Q ss_pred             CCCCceecCeEEEEecCccccce
Q psy14529         26 PSEGWTSGGATVIIVGDNFFDGL   48 (59)
Q Consensus        26 pseGW~tgG~tViiiG~nFf~GL   48 (59)
                      |+.|-..||+++.|.|-||-.|-
T Consensus         8 P~~g~~SGGt~itV~G~~Lds~q   30 (99)
T cd01181           8 PEWSFLSGGTPITVTGTNLNTVQ   30 (99)
T ss_pred             cCCCccCCCEEEEEEeeccCccc
Confidence            89999999999999999996554


No 14 
>cd01177 IPT_NFkappaB IPT domain of the transcription factor NFkappaB and related transcription factors. NFkappaB is considered a central regulator of stress responses, activated by different stressful conditions, including physical stress, oxidative stress, and exposure to certain chemicals. NFkappaB blocking cell apoptosis in several cell types, gives it an important role in cell proliferation and differentiation.
Probab=69.35  E-value=6.8  Score=25.59  Aligned_cols=29  Identities=28%  Similarity=0.410  Sum_probs=25.0

Q ss_pred             CCCceecCeEEEEecCccc-cceeeEEeee
Q psy14529         27 SEGWTSGGATVIIVGDNFF-DGLQVVFGTM   55 (59)
Q Consensus        27 seGW~tgG~tViiiG~nFf-~GLqvvfG~~   55 (59)
                      ..|-..||..|++++|++= ++.||.|-..
T Consensus         9 ~sgsv~GG~Ev~LLcdKV~K~dI~VrF~e~   38 (102)
T cd01177           9 TSGSVKGGDEVYLLCDKVQKEDIQVRFFEE   38 (102)
T ss_pred             cccccCCCcEEEEEecccCCCCCEEEEEEc
Confidence            4577899999999999998 5899999754


No 15 
>cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes. These enzymes are involved in the enzymatic hydrolysis of alpha-1,4 linkages of starch polymers and belong to the glycosyl hydrolase family 13. Most consist of three domains (A,B,C) but CGTase is more complex and has two additional domains (D,E). The function of the IPT/D domain is unknown.
Probab=68.77  E-value=5.6  Score=23.97  Aligned_cols=22  Identities=45%  Similarity=0.652  Sum_probs=18.8

Q ss_pred             CeEEEEecCcccc-ceeeEEeee
Q psy14529         34 GATVIIVGDNFFD-GLQVVFGTM   55 (59)
Q Consensus        34 G~tViiiG~nFf~-GLqvvfG~~   55 (59)
                      |.+|.|.|.+|=+ --+|.||..
T Consensus        14 G~~VtI~G~gFg~~~~~V~~g~~   36 (81)
T cd00604          14 GNTVTISGEGFGSTGGTVYFGGT   36 (81)
T ss_pred             CCEEEEEEECCCCCccEEEECCE
Confidence            8999999999976 468999875


No 16 
>cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain.  Enzymes such as amylases, cyclomaltodextrinase (CDase), and CGTase degrade starch to smaller oligosaccharides by hydrolyzing the alpha-D-(1,4) linkages between glucose residues present in starch. In the case of CGTases, an additional cyclization reaction is catalyzed yielding mixtures of cyclic oligosaccharides which are referred to as alpha-, beta-, or gamma-cyclodextrins (CDs) (consisting of six, seven, or eight glucoses, respectively). CGTases are characterized as depending on the major product of the cyclization reaction. Besides having similar catalytic site residues, amylases and CGTases contain carbohydrate binding domains that are distant from the active site and which are implicated in attaching the enzyme to raw starch granules and in guiding the amylose chain into the active site. The C-terminus of CGTase may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These d
Probab=64.87  E-value=7.4  Score=23.43  Aligned_cols=22  Identities=45%  Similarity=0.570  Sum_probs=18.7

Q ss_pred             CeEEEEecCccc-cceeeEEeee
Q psy14529         34 GATVIIVGDNFF-DGLQVVFGTM   55 (59)
Q Consensus        34 G~tViiiG~nFf-~GLqvvfG~~   55 (59)
                      |.+|.|.|.+|= +-.+|.||..
T Consensus        16 G~~VtI~G~gFg~~~~~V~~g~~   38 (81)
T cd02849          16 GNTVTISGEGFGSAPGTVYFGTT   38 (81)
T ss_pred             CCEEEEEEECCCCCCcEEEECCE
Confidence            889999999997 4468999975


No 17 
>PF03525 Meiotic_rec114:  Meiotic recombination protein rec114;  InterPro: IPR004354 REC114 is one of 10 genes required for initiation of meiotic recombination in Saccharomyces cerevisiae []. Located on chromosome XIII, it is transcribed only in meiosis and has no detectable function in mitosis [].   REC114 has been shown to possess an intron and is one of only three genes in yeast with 3' introns []. The 3' splice site utilised in REC114 is a very rare AAG sequence - only three other genes in yeast use this non- consensus sequence []. It appears that the intron is not essential for expression of REC114 and is not absolutely required for meiotic function. Nevertheless, it is conserved in evolution - two other species of yeast contain an intron at the same location in their REC114 genes []. ; GO: 0007131 reciprocal meiotic recombination
Probab=64.29  E-value=2.8  Score=32.29  Aligned_cols=11  Identities=55%  Similarity=0.812  Sum_probs=9.3

Q ss_pred             CceEEEEEEee
Q psy14529          1 MRRFQVVISTQ   11 (59)
Q Consensus         1 mRrfqV~vstt   11 (59)
                      ||||||...+-
T Consensus        96 mrRFQV~F~n~  106 (328)
T PF03525_consen   96 MRRFQVGFNND  106 (328)
T ss_pred             EEEEEEecCCh
Confidence            89999998764


No 18 
>PF13734 Inhibitor_I69:  Spi protease inhibitor; PDB: 1PVJ_A 1DKI_D 2UZJ_A 2JTC_A 4D8E_A 4D8I_A 4D8B_A.
Probab=48.69  E-value=19  Score=22.75  Aligned_cols=18  Identities=44%  Similarity=0.645  Sum_probs=11.9

Q ss_pred             EEEEeeeccCCceEEEecC
Q psy14529          6 VVISTQVGVDGPLLAVSDN   24 (59)
Q Consensus         6 V~vstt~~vdg~~LavSDn   24 (59)
                      |+||.-.+ -++|||.||+
T Consensus        54 VIVSgDdr-~~~ILaYS~~   71 (96)
T PF13734_consen   54 VIVSGDDR-MGPILAYSDE   71 (96)
T ss_dssp             EEEESBTT-S-SEEEEESS
T ss_pred             EEEECCCC-ccceeEEcCC
Confidence            45555444 4599999997


No 19 
>PRK11700 hypothetical protein; Provisional
Probab=46.43  E-value=8.5  Score=27.48  Aligned_cols=7  Identities=57%  Similarity=1.498  Sum_probs=5.5

Q ss_pred             CCCCcee
Q psy14529         26 PSEGWTS   32 (59)
Q Consensus        26 pseGW~t   32 (59)
                      |-|||+.
T Consensus       107 p~eGWEH  113 (187)
T PRK11700        107 PHEGWEH  113 (187)
T ss_pred             CCCCceE
Confidence            8899953


No 20 
>KOG0813|consensus
Probab=43.39  E-value=42  Score=24.89  Aligned_cols=41  Identities=24%  Similarity=0.313  Sum_probs=31.8

Q ss_pred             EEEeeeccCCceE-EEecCCCCCCceecCeEEEEecCc-cccce
Q psy14529          7 VISTQVGVDGPLL-AVSDNIPSEGWTSGGATVIIVGDN-FFDGL   48 (59)
Q Consensus         7 ~vstt~~vdg~~L-avSDnmpseGW~tgG~tViiiG~n-Ff~GL   48 (59)
                      ++.|.--.+||+. .+.+ -++|+-.--|-++...|++ ||+|+
T Consensus       111 ~l~TPgHT~~hi~~~~~~-~~~e~~iFtGDtlf~~GcG~~FEgt  153 (265)
T KOG0813|consen  111 CLHTPGHTAGHICYYVTE-STGERAIFTGDTLFGAGCGRFFEGT  153 (265)
T ss_pred             EEeCCCccCCcEEEEeec-CCCCCeEEeCCceeecCccchhcCC
Confidence            4566666777764 3333 6889999999999999996 99986


No 21 
>PF04448 DUF551:  Protein of unknown function (DUF551)   ;  InterPro: IPR007539 This entry represents the C terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.
Probab=43.39  E-value=14  Score=20.11  Aligned_cols=17  Identities=35%  Similarity=0.776  Sum_probs=13.1

Q ss_pred             EEEecCCCCCCceecCeEEEEe
Q psy14529         19 LAVSDNIPSEGWTSGGATVIIV   40 (59)
Q Consensus        19 LavSDnmpseGW~tgG~tViii   40 (59)
                      ++|||-||.++     ..|++.
T Consensus         3 IsvserlPe~~-----~~Vlv~   19 (69)
T PF04448_consen    3 ISVSERLPEEG-----EYVLVY   19 (69)
T ss_pred             eEccccCCCCC-----CeEEEE
Confidence            68999999875     466666


No 22 
>cd01819 Patatin_and_cPLA2 Patatins and Phospholipases. Patatin-like phospholipase. This family consists of various patatin glycoproteins from plants. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates. This family also includes the catalytic domain of cytosolic phospholipase A2 (PLA2; EC 3.1.1.4) hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms.
Probab=39.57  E-value=26  Score=22.37  Aligned_cols=20  Identities=55%  Similarity=0.953  Sum_probs=14.5

Q ss_pred             cCCceEEEecCCCCC-----CceecCeEEEE
Q psy14529         14 VDGPLLAVSDNIPSE-----GWTSGGATVII   39 (59)
Q Consensus        14 vdg~~LavSDnmpse-----GW~tgG~tVii   39 (59)
                      +||   +++||+|.+     +.   |.++||
T Consensus       129 VDG---G~~~~iP~~~~~~~~r---~~~vii  153 (155)
T cd01819         129 VDG---GVSNNLPAPVLLRPGR---GVTLTI  153 (155)
T ss_pred             ecc---ceecCcCCcccccCCC---CCeEEe
Confidence            455   789999876     65   677765


No 23 
>KOG0179|consensus
Probab=37.65  E-value=21  Score=26.57  Aligned_cols=13  Identities=54%  Similarity=1.086  Sum_probs=12.1

Q ss_pred             ecCeEEEEecCcc
Q psy14529         32 SGGATVIIVGDNF   44 (59)
Q Consensus        32 tgG~tViiiG~nF   44 (59)
                      -||++|.|.||+|
T Consensus        28 NGGT~vaIaG~dF   40 (235)
T KOG0179|consen   28 NGGTTVAIAGEDF   40 (235)
T ss_pred             CCceEEEEcCCce
Confidence            4899999999999


No 24 
>PTZ00422 glideosome-associated protein 50; Provisional
Probab=37.36  E-value=17  Score=28.13  Aligned_cols=42  Identities=17%  Similarity=0.349  Sum_probs=26.7

Q ss_pred             EEEEEEeeeccCCc--eEEEecC-------------C----CCCCceecCeEEEEecCcccccee
Q psy14529          4 FQVVISTQVGVDGP--LLAVSDN-------------I----PSEGWTSGGATVIIVGDNFFDGLQ   49 (59)
Q Consensus         4 fqV~vstt~~vdg~--~LavSDn-------------m----pseGW~tgG~tViiiG~nFf~GLq   49 (59)
                      |-+...++..++|.  ++++-|=             |    -.++-    .=|+-.||||++|+.
T Consensus        13 ~~~~~~~~~~~~~~l~F~~vGDwG~g~~~Q~~VA~~M~~~~~~~~~----~FVls~GDNF~~Gv~   73 (394)
T PTZ00422         13 FVLIFISSYSVKAQLRFASLGNWGTGSKQQKLVASYLKQYAKNERV----TFLVSPGSNFPGGVD   73 (394)
T ss_pred             hheeEEeecccCCeEEEEEEecCCCCchhHHHHHHHHHHHHHhCCC----CEEEECCccccCCCC
Confidence            34555666777776  6777771             1    11111    457889999999976


No 25 
>PLN02199 shikimate kinase
Probab=37.08  E-value=19  Score=27.08  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=16.3

Q ss_pred             ceEEEEEEee---------eccCCceEEEecCCCC
Q psy14529          2 RRFQVVISTQ---------VGVDGPLLAVSDNIPS   27 (59)
Q Consensus         2 RrfqV~vstt---------~~vdg~~LavSDnmps   27 (59)
                      +||||++|+.         .+.-..-.++|||.|+
T Consensus        39 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   73 (303)
T PLN02199         39 RRFRGLSLARLQPERRNDQRRAVSPAVSCSDNNSS   73 (303)
T ss_pred             cceeEEEeccccccccchhhhccccccccCCCCch
Confidence            5899999992         1122223567888854


No 26 
>PF06007 PhnJ:  Phosphonate metabolism protein PhnJ;  InterPro: IPR010306 This family consists of several bacterial phosphonate metabolism (PhnJ) sequences. The exact role that PhnJ plays in phosphonate utilisation is unknown.; GO: 0042916 alkylphosphonate transport
Probab=31.77  E-value=32  Score=26.24  Aligned_cols=22  Identities=36%  Similarity=0.965  Sum_probs=15.8

Q ss_pred             ecCCC-CCCceecCeEEE--EecCc
Q psy14529         22 SDNIP-SEGWTSGGATVI--IVGDN   43 (59)
Q Consensus        22 SDnmp-seGW~tgG~tVi--iiG~n   43 (59)
                      |-.|| +.||-|||-+|+  +||.+
T Consensus        36 SREMP~~~GWGTGGlQvT~sliG~~   60 (277)
T PF06007_consen   36 SREMPMPRGWGTGGLQVTLSLIGPD   60 (277)
T ss_pred             cccCccccccccCceeEEEEeecCC
Confidence            45565 789999998876  45543


No 27 
>KOG3374|consensus
Probab=31.60  E-value=39  Score=24.83  Aligned_cols=23  Identities=35%  Similarity=0.627  Sum_probs=17.9

Q ss_pred             EEEeeeccCC----ceEEEecCCCCCC
Q psy14529          7 VISTQVGVDG----PLLAVSDNIPSEG   29 (59)
Q Consensus         7 ~vstt~~vdg----~~LavSDnmpseG   29 (59)
                      .+||..+|.|    .++++||..|+.|
T Consensus        62 TlSt~e~vkG~Pf~nViS~sDg~p~~g   88 (210)
T KOG3374|consen   62 TLSTNERVKGYPFVNVISISDGDPNNG   88 (210)
T ss_pred             eeeecccccCCccceEEEccCCCCcCC
Confidence            3566676665    6899999999888


No 28 
>PF10633 NPCBM_assoc:  NPCBM-associated, NEW3 domain of alpha-galactosidase;  InterPro: IPR018905 This domain has been named NEW3, but its function is not known. It is found on proteins which are bacterial galactosidases [].; PDB: 1EUT_A 2BZD_A 1WCQ_C 2BER_A 1W8O_A 1EUU_A 1W8N_A.
Probab=30.42  E-value=77  Score=17.90  Aligned_cols=18  Identities=39%  Similarity=0.761  Sum_probs=8.5

Q ss_pred             EEEecCCCCCCce--ecCeEE
Q psy14529         19 LAVSDNIPSEGWT--SGGATV   37 (59)
Q Consensus        19 LavSDnmpseGW~--tgG~tV   37 (59)
                      +.++-+. ++||+  .++.++
T Consensus        24 v~~~l~~-P~GW~~~~~~~~~   43 (78)
T PF10633_consen   24 VSLSLSL-PEGWTVSASPASV   43 (78)
T ss_dssp             -EEEEE---TTSE---EEEEE
T ss_pred             EEEEEeC-CCCccccCCcccc
Confidence            4455454 59998  444443


No 29 
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=26.69  E-value=28  Score=24.13  Aligned_cols=7  Identities=57%  Similarity=1.517  Sum_probs=5.6

Q ss_pred             CCCCcee
Q psy14529         26 PSEGWTS   32 (59)
Q Consensus        26 pseGW~t   32 (59)
                      |-|||+.
T Consensus        69 p~eGWEH   75 (149)
T cd07268          69 PQEGWEH   75 (149)
T ss_pred             CCCCceE
Confidence            8899953


No 30 
>PF05159 Capsule_synth:  Capsule polysaccharide biosynthesis protein;  InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT. Capsule polysaccharide modification protein lipB/A is involved in the phospholipid modification of the capsular polysaccharide and is a strong requirement for its translocation to the cell surface. The capsule of Neisseria meningitidis serogroup B and of other meningococcal serogroups and other Gram-negative bacterial pathogens, are anchored in the outer membrane through a 1,2-diacylglycerol moiety. The lipA and lipB genes are located on the 3' end of the ctr operon. lipA and lipB do not encode proteins responsible for diacylglycerophosphatidic acid substitution of the meningococcal capsule polymer, but they are required for proper translocation and surface expression of the lipidated polymer []. KpsS is an unusual sulphate-modified form of the capsular polysaccharide in Rhizobium loti (Mesorhizobium loti). Many plants, including R. loti, enter into symbiotic relationships with bacteria that allow survival in nutrient-limiting environments. KpsS functions as a fucosyl sulphotransferase in vitro. The kpsS gene product shares no significant amino acid similarity with previously identified sulphotransferases []. Sulphated cell surface polysaccharides are required for optimum nodule formation but limit growth rate and nodule colonisation in M. loti [].; GO: 0000271 polysaccharide biosynthetic process, 0015774 polysaccharide transport
Probab=25.98  E-value=42  Score=22.82  Aligned_cols=18  Identities=33%  Similarity=0.767  Sum_probs=15.3

Q ss_pred             CeEEEEecCccccceeeE
Q psy14529         34 GATVIIVGDNFFDGLQVV   51 (59)
Q Consensus        34 G~tViiiG~nFf~GLqvv   51 (59)
                      |..|++.|+.||+|.-+.
T Consensus       218 gkpVi~~G~~~Y~~~glt  235 (269)
T PF05159_consen  218 GKPVIVFGRAFYAGWGLT  235 (269)
T ss_pred             CCceEEecCcccCCCCcc
Confidence            789999999999986553


No 31 
>TIGR02961 allantoicase allantoicase. A different but similarly named enzyme, allantoate amidohydrolase (EC 3.5.3.9), simultaneously breaks down the urea to ammonia and carbon dioxide.
Probab=25.03  E-value=44  Score=25.54  Aligned_cols=15  Identities=27%  Similarity=0.406  Sum_probs=12.1

Q ss_pred             eeccCCceEEEecCC
Q psy14529         11 QVGVDGPLLAVSDNI   25 (59)
Q Consensus        11 t~~vdg~~LavSDnm   25 (59)
                      +...-|++|++||.-
T Consensus         7 ~~~~Gg~vl~~sDe~   21 (322)
T TIGR02961         7 DRRLGGKVLFASDEF   21 (322)
T ss_pred             hhhcCCEEEEEccch
Confidence            456789999999865


No 32 
>smart00539 NIDO Extracellular domain of unknown function in nidogen (entactin) and hypothetical proteins.
Probab=24.49  E-value=1.1e+02  Score=20.38  Aligned_cols=29  Identities=38%  Similarity=0.513  Sum_probs=17.0

Q ss_pred             EEEEEEeeeccCCceEEEecCCCCCCceecCeE
Q psy14529          4 FQVVISTQVGVDGPLLAVSDNIPSEGWTSGGAT   36 (59)
Q Consensus         4 fqV~vstt~~vdg~~LavSDnmpseGW~tgG~t   36 (59)
                      ||+|+.|.    |.-.=+-=|-|..||+++.++
T Consensus        69 FQ~VL~td----g~~sfa~f~Y~~~~~~~~~~~   97 (152)
T smart00539       69 FQAVLATD----GSRTYAIFLYPSLGWTSDTTA   97 (152)
T ss_pred             eEEEEEEC----CCceEEEEEecCCCceeeccc
Confidence            89998883    221111122299999876543


No 33 
>PF03561 Allantoicase:  Allantoicase repeat;  InterPro: IPR015908 Allantoicase (also known as allantoate amidinohydrolase) is involved in purine degradation, facilitating the utilization of purines as secondary nitrogen sources under nitrogen-limiting conditions. While purine degradation converges to uric acid in all vertebrates, its further degradation varies from species to species. Uric acid is excreted by birds, reptiles, and some mammals that do not have a functional uricase gene, whereas other mammals produce allantoin. Amphibians and microorganisms produce ammonia and carbon dioxide using the uricolytic pathway. Allantoicase performs the second step in this pathway catalyzing the conversion of allantoate into ureidoglycolate and urea.   allantoate + H(2)0 = (S)-ureidoglycolate + urea  The structure of allantoicase is best described as being composed of two repeats (the allantoicase repeats: AR1 and AR2), which are connected by a flexible linker. The crystal structure, resolved at 2.4A resolution, reveals that AR1 has a very similar fold to AR2, both repeats being jelly-roll motifs, composed of four-stranded and five-stranded antiparallel beta-sheets []. Each jelly-roll motif has two conserved surface patches that probably constitute the active site [].  The mammalian proteins matched by this entry are thought to be non-functional as mammals do not appear to possess allantoicase activity [].; GO: 0004037 allantoicase activity; PDB: 1O59_A 1SG3_A.
Probab=24.20  E-value=46  Score=22.54  Aligned_cols=10  Identities=40%  Similarity=0.684  Sum_probs=4.9

Q ss_pred             CceEEEecCC
Q psy14529         16 GPLLAVSDNI   25 (59)
Q Consensus        16 g~~LavSDnm   25 (59)
                      |.++++||.-
T Consensus         2 g~vv~~SD~~   11 (152)
T PF03561_consen    2 GRVVACSDEF   11 (152)
T ss_dssp             -EEEEES--S
T ss_pred             CEEEEEcccc
Confidence            5677787743


No 34 
>PF11886 DUF3406:  Domain of unknown function (DUF3406);  InterPro: IPR024283 This C-terminal domain is found in chloroplast protein import component Toc86/159 [] and homologue Toc90 [], and in some uncharacterised proteins.
Probab=21.48  E-value=68  Score=24.33  Aligned_cols=21  Identities=38%  Similarity=0.640  Sum_probs=18.2

Q ss_pred             ceecCeEEEEecCccccceee
Q psy14529         30 WTSGGATVIIVGDNFFDGLQV   50 (59)
Q Consensus        30 W~tgG~tViiiG~nFf~GLqv   50 (59)
                      =|++|-+++.+|++.+-|+.+
T Consensus       132 kt~~G~S~T~lG~~~~~G~Kl  152 (273)
T PF11886_consen  132 KTTAGLSVTFLGDNVATGLKL  152 (273)
T ss_pred             cccceeEEEEecCeEEEEEee
Confidence            378999999999999999853


No 35 
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=21.25  E-value=31  Score=18.51  Aligned_cols=15  Identities=33%  Similarity=0.747  Sum_probs=12.1

Q ss_pred             cCCCCCCceecCeEE
Q psy14529         23 DNIPSEGWTSGGATV   37 (59)
Q Consensus        23 DnmpseGW~tgG~tV   37 (59)
                      +.+|.|-|-.||.++
T Consensus        44 ~e~~~~~w~~gG~~~   58 (63)
T TIGR00013        44 DEMPKNNYGIGGELV   58 (63)
T ss_pred             EEcCHHHeeECCEEh
Confidence            344999999999875


No 36 
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional
Probab=21.02  E-value=1.5e+02  Score=21.97  Aligned_cols=26  Identities=23%  Similarity=0.240  Sum_probs=19.7

Q ss_pred             CceEEEecCC-----CCCCceecCeEEEEec
Q psy14529         16 GPLLAVSDNI-----PSEGWTSGGATVIIVG   41 (59)
Q Consensus        16 g~~LavSDnm-----pseGW~tgG~tViiiG   41 (59)
                      .+++.|||.|     |..-..-||..|.+-+
T Consensus       266 ~~~~lvtDa~~~~G~~~g~y~l~~~~v~v~~  296 (382)
T PRK11170        266 DKLCLVTDATAPAGANIEQFIFAGKTIYYRD  296 (382)
T ss_pred             CcEEEEeccccCCCCCCCeEEECCEEEEEEC
Confidence            4689999999     5566777888887544


No 37 
>TIGR01554 major_cap_HK97 phage major capsid protein, HK97 family. This family represents the major capsid protein component of the heads (capsids) of bacteriophage HK97, phi-105, P27, and related phage. This model represents one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease.
Probab=20.75  E-value=1.1e+02  Score=22.21  Aligned_cols=29  Identities=17%  Similarity=0.296  Sum_probs=20.5

Q ss_pred             eeccCCceEEEec-CCCCCCceecCeEEEEecC
Q psy14529         11 QVGVDGPLLAVSD-NIPSEGWTSGGATVIIVGD   42 (59)
Q Consensus        11 t~~vdg~~LavSD-nmpseGW~tgG~tViiiG~   42 (59)
                      ...+.|..+-++| .||+   ...|...+++||
T Consensus       298 ~~tl~G~pV~~~~d~~~~---~~~~~~~i~~GD  327 (378)
T TIGR01554       298 PYSLLGRPVVELEDQMLD---IGAGKKPVIFGD  327 (378)
T ss_pred             CceeCCceEEEecccccC---CCCCcceEEEEc
Confidence            3456677777776 9987   345677888887


No 38 
>COG2986 HutH Histidine ammonia-lyase [Amino acid transport and metabolism]
Probab=20.52  E-value=26  Score=28.52  Aligned_cols=28  Identities=39%  Similarity=0.540  Sum_probs=18.9

Q ss_pred             ceEEEecCC---CCCCceecCeEEEEecCccccceeeEE
Q psy14529         17 PLLAVSDNI---PSEGWTSGGATVIIVGDNFFDGLQVVF   52 (59)
Q Consensus        17 ~~LavSDnm---pseGW~tgG~tViiiG~nFf~GLqvvf   52 (59)
                      .+=|++||.   +.++       -+|+|.|| .|-++.|
T Consensus       305 ElNsvtDNPlv~~~~~-------~ViSgGNF-hg~pva~  335 (498)
T COG2986         305 ELNSVTDNPLVFGDEE-------EVISGGNF-HGEPVAL  335 (498)
T ss_pred             hhhhcCCCCcccCCCC-------ccccCCCc-CchhHHH
Confidence            445789996   4444       45699999 6666543


No 39 
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.51  E-value=2.4e+02  Score=18.72  Aligned_cols=33  Identities=24%  Similarity=0.595  Sum_probs=23.5

Q ss_pred             EEEeeeccCCceEEEecCCCCCCceecC-eEEEE
Q psy14529          7 VISTQVGVDGPLLAVSDNIPSEGWTSGG-ATVII   39 (59)
Q Consensus         7 ~vstt~~vdg~~LavSDnmpseGW~tgG-~tVii   39 (59)
                      +.-+.-.++|-.|-+||++|+++=+.|+ .+++|
T Consensus        48 i~HA~l~i~g~~im~sd~~~~~~~~~~~~~s~~l   81 (136)
T COG2764          48 IMHAELRIGGSTIMLSDAFPDMGATEGGGTSLSL   81 (136)
T ss_pred             eEEEEEEECCEEEEEecCCCccCcccCCCeeEEE
Confidence            3445667889999999999999855543 44443


No 40 
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase. Chloroplast Nucleoids DNA-binding Protease catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) in senescent leaves of tobacco. Antisense tobacco with reduced amount of CND41 maintained green leaves and constant protein levels, especially Rubisco.  CND41 has DNA-binding as well as aspartic protease activities. The pepsin-like aspartic protease domain is located at the C-terminus of the protein. The enzyme is characterized by having two aspartic protease catalytic site motifs, the Asp-Thr-Gly-Ser in the N-terminal and Asp-Ser-Gly-Ser in the C-terminal region. Aspartic proteases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe may be evolved from the other through ancient gene-duplication event. This fami
Probab=20.43  E-value=64  Score=21.97  Aligned_cols=18  Identities=22%  Similarity=0.422  Sum_probs=15.0

Q ss_pred             EEEEecCccccceeeEEe
Q psy14529         36 TVIIVGDNFFDGLQVVFG   53 (59)
Q Consensus        36 tViiiG~nFf~GLqvvfG   53 (59)
                      ...|+||.|.....++|=
T Consensus       269 ~~~ilG~~fl~~~~vvfD  286 (299)
T cd05472         269 GLSIIGNVQQQTFRVVYD  286 (299)
T ss_pred             CCEEEchHHccceEEEEE
Confidence            356899999999999883


No 41 
>PRK10148 hypothetical protein; Provisional
Probab=20.41  E-value=2.5e+02  Score=18.01  Aligned_cols=36  Identities=25%  Similarity=0.370  Sum_probs=22.1

Q ss_pred             EEEeeeccCCceEEEecCCCCCCceecCeEEEEecC
Q psy14529          7 VISTQVGVDGPLLAVSDNIPSEGWTSGGATVIIVGD   42 (59)
Q Consensus         7 ~vstt~~vdg~~LavSDnmpseGW~tgG~tViiiG~   42 (59)
                      +.-+...+.|..|-+||++|.......+.++.|--|
T Consensus        59 i~Ha~l~i~g~~lm~sD~~~~~~~~~~~~~l~l~~~   94 (147)
T PRK10148         59 IAHANVRIAGSDIMMSDAIPSGKAHYSGFTLVLDTQ   94 (147)
T ss_pred             EEEEEEEECCEEEEEECCCCCcCCCCCeEEEEEECC
Confidence            445566778888999998865533222455554433


No 42 
>PHA02146 hypothetical protein
Probab=20.18  E-value=38  Score=21.76  Aligned_cols=10  Identities=60%  Similarity=1.092  Sum_probs=7.2

Q ss_pred             ecCCCCCCce
Q psy14529         22 SDNIPSEGWT   31 (59)
Q Consensus        22 SDnmpseGW~   31 (59)
                      ||--|+|||.
T Consensus        54 s~~ap~~gwa   63 (86)
T PHA02146         54 SAFAPSEGWA   63 (86)
T ss_pred             cccCcchhHH
Confidence            4444999993


No 43 
>PRK13257 allantoicase; Provisional
Probab=20.06  E-value=66  Score=24.79  Aligned_cols=15  Identities=27%  Similarity=0.384  Sum_probs=12.2

Q ss_pred             eeccCCceEEEecCC
Q psy14529         11 QVGVDGPLLAVSDNI   25 (59)
Q Consensus        11 t~~vdg~~LavSDnm   25 (59)
                      +...-|++|++||.-
T Consensus        22 s~~~Gg~vl~~sDe~   36 (336)
T PRK13257         22 DRRLGAQVLAASDEF   36 (336)
T ss_pred             hhhcCCEEEEEchhh
Confidence            556789999999965


Done!