Query         psy1455
Match_columns 221
No_of_seqs    189 out of 917
Neff          7.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:43:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1455.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1455hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00075 RNase_H:  RNase H;  In  98.3 3.4E-07 7.3E-12   69.8   2.4   31   65-95    100-131 (132)
  2 PRK08719 ribonuclease H; Revie  98.2 7.9E-07 1.7E-11   70.2   2.2   29   67-95    117-145 (147)
  3 PRK00203 rnhA ribonuclease H;   98.1 8.7E-07 1.9E-11   70.0   1.7   32   67-98    112-143 (150)
  4 PRK06548 ribonuclease H; Provi  97.9 4.1E-06 8.8E-11   67.1   1.7   29   68-96    113-141 (161)
  5 COG0328 RnhA Ribonuclease HI [  97.6 2.2E-05 4.8E-10   62.2   1.6   28   69-96    117-144 (154)
  6 cd06222 RnaseH RNase H (RNase   97.2 0.00028 6.2E-09   51.6   2.7   29   66-94    101-129 (130)
  7 KOG3752|consensus               97.0 0.00048   1E-08   61.4   3.0   30   66-95    334-363 (371)
  8 PRK13907 rnhA ribonuclease H;   75.9     1.7 3.7E-05   32.7   1.6   23   69-95    103-125 (128)
  9 PRK07708 hypothetical protein;  60.8     7.2 0.00016   32.7   2.5   26   68-97    183-208 (219)
 10 PF13456 RVT_3:  Reverse transc  53.5     9.6 0.00021   25.8   1.8   24   68-95     62-85  (87)
 11 PRK07238 bifunctional RNase H/  46.4      12 0.00027   33.5   1.8   23   68-94    107-129 (372)
 12 PF09107 SelB-wing_3:  Elongati  37.2      50  0.0011   20.9   3.0   26  193-218    15-40  (50)
 13 PF04433 SWIRM:  SWIRM domain;   34.3      60  0.0013   22.6   3.4   25  195-219    60-85  (86)
 14 PF04863 EGF_alliinase:  Alliin  27.8      13 0.00027   24.3  -0.9   24  160-184    18-41  (56)
 15 PF01022 HTH_5:  Bacterial regu  27.6      59  0.0013   19.8   2.2   28  193-220    20-47  (47)
 16 PF08097 Toxin_26:  Conotoxin T  26.8      24 0.00052   15.1   0.2    8   18-25      3-10  (11)
 17 PF00325 Crp:  Bacterial regula  24.5 1.1E+02  0.0023   17.6   2.7   26  193-218     7-32  (32)
 18 PF04182 B-block_TFIIIC:  B-blo  20.2      99  0.0021   21.0   2.3   28  193-220    23-50  (75)

No 1  
>PF00075 RNase_H:  RNase H;  InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site. This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids.  The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D ....
Probab=98.30  E-value=3.4e-07  Score=69.79  Aligned_cols=31  Identities=35%  Similarity=0.787  Sum_probs=27.9

Q ss_pred             hcCCcceeeeccCCCCC-ccchhHhHHHhhcc
Q psy1455          65 DAGNNVKIIWIPSHCGI-AGNEEVDKAAQSFT   95 (221)
Q Consensus        65 ~~g~~v~~~wvPgH~gI-~GNE~AD~~Ak~~~   95 (221)
                      ..+.+|.|.|||||+|+ .|||.||++||.++
T Consensus       100 ~~~~~v~~~~V~~H~~~~~~N~~aD~lAk~a~  131 (132)
T PF00075_consen  100 SRGIKVRFRWVPGHSGVPQGNERADRLAKEAA  131 (132)
T ss_dssp             HHSSEEEEEESSSSSSSHHHHHHHHHHHHHHH
T ss_pred             ccceEEeeeeccCcCCCchhHHHHHHHHHHhc
Confidence            45789999999999999 69999999999764


No 2  
>PRK08719 ribonuclease H; Reviewed
Probab=98.18  E-value=7.9e-07  Score=70.20  Aligned_cols=29  Identities=34%  Similarity=0.479  Sum_probs=26.4

Q ss_pred             CCcceeeeccCCCCCccchhHhHHHhhcc
Q psy1455          67 GNNVKIIWIPSHCGIAGNEEVDKAAQSFT   95 (221)
Q Consensus        67 g~~v~~~wvPgH~gI~GNE~AD~~Ak~~~   95 (221)
                      ...|.|.|||||+|++|||.||.+|+.++
T Consensus       117 ~~~i~~~~VkgH~g~~~Ne~aD~lA~~a~  145 (147)
T PRK08719        117 RKYVEVEKVTAHSGIEGNEAADMLAQAAA  145 (147)
T ss_pred             CCcEEEEEecCCCCChhHHHHHHHHHHHh
Confidence            45799999999999999999999999765


No 3  
>PRK00203 rnhA ribonuclease H; Reviewed
Probab=98.15  E-value=8.7e-07  Score=69.97  Aligned_cols=32  Identities=25%  Similarity=0.463  Sum_probs=28.3

Q ss_pred             CCcceeeeccCCCCCccchhHhHHHhhccccc
Q psy1455          67 GNNVKIIWIPSHCGIAGNEEVDKAAQSFTNAQ   98 (221)
Q Consensus        67 g~~v~~~wvPgH~gI~GNE~AD~~Ak~~~~~~   98 (221)
                      ...|.|.|||||+|++|||.||++|+.+...+
T Consensus       112 ~~~v~~~wV~~H~~~~~N~~AD~lA~~a~~~~  143 (150)
T PRK00203        112 RHQIKWHWVKGHAGHPENERCDELARAGAEEA  143 (150)
T ss_pred             cCceEEEEecCCCCCHHHHHHHHHHHHHHHHh
Confidence            36799999999999999999999999876544


No 4  
>PRK06548 ribonuclease H; Provisional
Probab=97.93  E-value=4.1e-06  Score=67.11  Aligned_cols=29  Identities=31%  Similarity=0.589  Sum_probs=26.3

Q ss_pred             CcceeeeccCCCCCccchhHhHHHhhccc
Q psy1455          68 NNVKIIWIPSHCGIAGNEEVDKAAQSFTN   96 (221)
Q Consensus        68 ~~v~~~wvPgH~gI~GNE~AD~~Ak~~~~   96 (221)
                      ..|+|.|||||+|.+|||.||.+|++++.
T Consensus       113 ~~v~~~wVkgHsg~~gNe~aD~LA~~aa~  141 (161)
T PRK06548        113 RNIRMSWVNAHTGHPLNEAADSLARQAAN  141 (161)
T ss_pred             CceEEEEEecCCCCHHHHHHHHHHHHHHH
Confidence            47999999999999999999999987653


No 5  
>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair]
Probab=97.63  E-value=2.2e-05  Score=62.24  Aligned_cols=28  Identities=29%  Similarity=0.426  Sum_probs=25.8

Q ss_pred             cceeeeccCCCCCccchhHhHHHhhccc
Q psy1455          69 NVKIIWIPSHCGIAGNEEVDKAAQSFTN   96 (221)
Q Consensus        69 ~v~~~wvPgH~gI~GNE~AD~~Ak~~~~   96 (221)
                      .|.+.|||||.|-++||+||++|+.+..
T Consensus       117 ~v~~~WVkgH~g~~~NeraD~LA~~~~~  144 (154)
T COG0328         117 LVFWEWVKGHAGHPENERADQLAREAAR  144 (154)
T ss_pred             eEEEEEeeCCCCChHHHHHHHHHHHHHH
Confidence            7899999999999999999999987754


No 6  
>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication.  RNase H knockout mice lack mitochondrial DNA replication and die as embryos. The retroviral reverse transcriptase contains an RNase H domain that plays an important role in converting a single stranded retroviral genomic RNA into a dsDNA for integration into host chromosomes. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription.
Probab=97.17  E-value=0.00028  Score=51.63  Aligned_cols=29  Identities=38%  Similarity=0.713  Sum_probs=26.3

Q ss_pred             cCCcceeeeccCCCCCccchhHhHHHhhc
Q psy1455          66 AGNNVKIIWIPSHCGIAGNEEVDKAAQSF   94 (221)
Q Consensus        66 ~g~~v~~~wvPgH~gI~GNE~AD~~Ak~~   94 (221)
                      .+..+.|.|||+|+++.+|+.||.+|+.+
T Consensus       101 ~~~~~~i~~v~~h~~~~~n~~ad~la~~~  129 (130)
T cd06222         101 RFHKVRFEWVPGHSGIEGNERADALAKEA  129 (130)
T ss_pred             CCCeEEEEEcCCCCCCcchHHHHHHHHhh
Confidence            46689999999999999999999999864


No 7  
>KOG3752|consensus
Probab=97.01  E-value=0.00048  Score=61.42  Aligned_cols=30  Identities=30%  Similarity=0.450  Sum_probs=27.3

Q ss_pred             cCCcceeeeccCCCCCccchhHhHHHhhcc
Q psy1455          66 AGNNVKIIWIPSHCGIAGNEEVDKAAQSFT   95 (221)
Q Consensus        66 ~g~~v~~~wvPgH~gI~GNE~AD~~Ak~~~   95 (221)
                      .+..|.+.|||||.||.|||+||.+|+++.
T Consensus       334 ~~~~vq~~~V~Gh~gi~gne~Ad~lARkgs  363 (371)
T KOG3752|consen  334 SNKKVQQEYVGGHSGILGNEMADALARKGS  363 (371)
T ss_pred             ccCceEEEEecCcCCcchHHHHHHHHhhhh
Confidence            468899999999999999999999998764


No 8  
>PRK13907 rnhA ribonuclease H; Provisional
Probab=75.88  E-value=1.7  Score=32.71  Aligned_cols=23  Identities=35%  Similarity=0.458  Sum_probs=19.0

Q ss_pred             cceeeeccCCCCCccchhHhHHHhhcc
Q psy1455          69 NVKIIWIPSHCGIAGNEEVDKAAQSFT   95 (221)
Q Consensus        69 ~v~~~wvPgH~gI~GNE~AD~~Ak~~~   95 (221)
                      .+.+.|||.+    +|+.||.+|+.+.
T Consensus       103 ~~~~~~v~r~----~N~~Ad~LA~~a~  125 (128)
T PRK13907        103 LFFIKWIPSS----QNKVADELARKAI  125 (128)
T ss_pred             ceEEEEcCch----hchhHHHHHHHHH
Confidence            4567999985    8999999998765


No 9  
>PRK07708 hypothetical protein; Validated
Probab=60.80  E-value=7.2  Score=32.73  Aligned_cols=26  Identities=19%  Similarity=0.034  Sum_probs=20.0

Q ss_pred             CcceeeeccCCCCCccchhHhHHHhhcccc
Q psy1455          68 NNVKIIWIPSHCGIAGNEEVDKAAQSFTNA   97 (221)
Q Consensus        68 ~~v~~~wvPgH~gI~GNE~AD~~Ak~~~~~   97 (221)
                      ..+.+.|||-    ..|+.||.+|+.+.+.
T Consensus       183 l~~~~~~VpR----~~N~~AD~LAk~Al~~  208 (219)
T PRK07708        183 LTPVYEPISR----KQNKEADQLATQALEG  208 (219)
T ss_pred             ceEEEEECCc----hhhhHHHHHHHHHHhc
Confidence            3467788875    4699999999988753


No 10 
>PF13456 RVT_3:  Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B.
Probab=53.55  E-value=9.6  Score=25.81  Aligned_cols=24  Identities=29%  Similarity=0.227  Sum_probs=17.7

Q ss_pred             CcceeeeccCCCCCccchhHhHHHhhcc
Q psy1455          68 NNVKIIWIPSHCGIAGNEEVDKAAQSFT   95 (221)
Q Consensus        68 ~~v~~~wvPgH~gI~GNE~AD~~Ak~~~   95 (221)
                      ..+.+.|||    =++|..||.+||.+.
T Consensus        62 ~~~~~~~i~----r~~N~~A~~LA~~a~   85 (87)
T PF13456_consen   62 WNVSVSHIP----REQNKVADALAKFAL   85 (87)
T ss_dssp             SCEEEEE------GGGSHHHHHHHHHHH
T ss_pred             cceEEEEEC----hHHhHHHHHHHHHHh
Confidence            468899998    458999999998653


No 11 
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional
Probab=46.37  E-value=12  Score=33.47  Aligned_cols=23  Identities=35%  Similarity=0.601  Sum_probs=19.4

Q ss_pred             CcceeeeccCCCCCccchhHhHHHhhc
Q psy1455          68 NNVKIIWIPSHCGIAGNEEVDKAAQSF   94 (221)
Q Consensus        68 ~~v~~~wvPgH~gI~GNE~AD~~Ak~~   94 (221)
                      ..+.+.|||.    .+|+.||.+|+.+
T Consensus       107 ~~~~i~~v~r----~~N~~AD~LA~~a  129 (372)
T PRK07238        107 GRVTYTWIPR----ARNAHADRLANEA  129 (372)
T ss_pred             CceEEEECCc----hhhhHHHHHHHHH
Confidence            4689999997    5899999999855


No 12 
>PF09107 SelB-wing_3:  Elongation factor SelB, winged helix ;  InterPro: IPR015191 This entry represents a domain with a winged helix-type fold, which consists of a closed 3-helical bundle with a right-handed twist, and a small beta-sheet wing []. Different winged helix domains share a common structure, but can differ in sequence. This entry is designated "type 3".  The winged helix motif is involved in both DNA and RNA binding. In the elongation factor SelB, the winged helix domains recognise RNA, allowing the complex to wrap around the small ribosomal subunit. In bacteria, the incorporation of the amino acid selenocysteine into proteins requires elongation factor SelB, which binds both transfer RNA (tRNA) and mRNA. SelB binds to an mRNA hairpin formed by the selenocysteine insertion sequence (SECIS) with extremely high specificity []. ; GO: 0003723 RNA binding, 0003746 translation elongation factor activity, 0005525 GTP binding, 0001514 selenocysteine incorporation, 0005737 cytoplasm; PDB: 2PJP_A 2UWM_A 1WSU_B 1LVA_A 2PLY_A.
Probab=37.25  E-value=50  Score=20.95  Aligned_cols=26  Identities=19%  Similarity=0.411  Sum_probs=21.9

Q ss_pred             cHHhhhCCChHHHHHHHHHHHHcCCC
Q psy1455         193 QIKDILGDNPRTIDLLFKFLKDSNLL  218 (221)
Q Consensus       193 ~l~~~L~~~~~~~~~i~~Fl~~t~l~  218 (221)
                      +++++||..-+.+..+++||++.|+.
T Consensus        15 ~~rd~lg~sRK~ai~lLE~lD~~g~T   40 (50)
T PF09107_consen   15 EFRDLLGLSRKYAIPLLEYLDREGIT   40 (50)
T ss_dssp             HHHHHHTS-HHHHHHHHHHHHHTTSE
T ss_pred             HHHHHHCccHHHHHHHHHHHhccCCE
Confidence            66788998889999999999999874


No 13 
>PF04433 SWIRM:  SWIRM domain;  InterPro: IPR007526 The SWIRM domain is a small alpha-helical domain of about 85 amino acid residues found in eukaryotic chromosomal proteins. It is named after the proteins SWI3, RSC8 and MOIRA in which it was first recognised. This domain is predicted to mediate protein-protein interactions in the assembly of chromatin-protein complexes. The SWIRM domain can be linked to different domains, such as the ZZ-type zinc finger (IPR000433 from INTERPRO), the Myb DNA-binding domain (IPR001005 from INTERPRO), the HORMA domain (IPR003511 from INTERPRO), the amino-oxidase domain, the chromo domain (IPR000953 from INTERPRO), and the JAB1/PAD1 domain.; GO: 0005515 protein binding; PDB: 2Z3Y_A 2UXN_A 2Y48_A 2HKO_A 2XAF_A 2X0L_A 2XAJ_A 2UXX_A 2V1D_A 2L3D_A ....
Probab=34.29  E-value=60  Score=22.58  Aligned_cols=25  Identities=16%  Similarity=0.394  Sum_probs=20.3

Q ss_pred             HhhhC-CChHHHHHHHHHHHHcCCCC
Q psy1455         195 KDILG-DNPRTIDLLFKFLKDSNLLP  219 (221)
Q Consensus       195 ~~~L~-~~~~~~~~i~~Fl~~t~l~~  219 (221)
                      ...+. .+...+.+|++||..-|++|
T Consensus        60 ~~~i~~~d~~~~~ri~~FL~~~G~IN   85 (86)
T PF04433_consen   60 RKLIKGIDVNKIRRIYDFLERWGLIN   85 (86)
T ss_dssp             HHHTTSSSHHHHHHHHHHHHHTTSSS
T ss_pred             HHHccccCHHHHHHHHHHHHHcCccC
Confidence            34455 46788999999999999997


No 14 
>PF04863 EGF_alliinase:  Alliinase EGF-like domain;  InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species. Allicin is synthesised from sulphoxide cysteine derivatives by alliinase, whose C-S lyase activity cleaves C(beta)-S(gamma) bonds. It is thought that this enzyme forms part of a primitive plant defence system [].; GO: 0016846 carbon-sulfur lyase activity; PDB: 1LK9_B 2HOX_C 2HOR_A.
Probab=27.80  E-value=13  Score=24.33  Aligned_cols=24  Identities=25%  Similarity=0.223  Sum_probs=11.2

Q ss_pred             HHhcccccccccccCCCCCCCChhh
Q psy1455         160 LRIGHTRLTHGFLMERTDPPQCEIR  184 (221)
Q Consensus       160 lrTGH~~~~h~~~~~~~~~p~C~cR  184 (221)
                      --.|||+. |+..+...-.|.|+|.
T Consensus        18 ~CSGHGr~-flDg~~~dG~p~CECn   41 (56)
T PF04863_consen   18 SCSGHGRA-FLDGLIADGSPVCECN   41 (56)
T ss_dssp             --TTSEE---TTS-EETTEE--EE-
T ss_pred             CcCCCCee-eeccccccCCcccccc
Confidence            45799988 5555544445999993


No 15 
>PF01022 HTH_5:  Bacterial regulatory protein, arsR family;  InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities. One such group, termed arsR, includes several proteins that appear to dissociate from DNA in the presence of metal ions: arsR, which functions as a transcriptional repressor of an arsenic resistance operon; smtB from Synechococcus sp. (strain PCC 7942), which acts as a transcriptional repressor of the smtA gene that codes for a metallothionein; cadC, a protein required for cadmium-resistance; and hypothetical protein yqcJ from Bacillus subtilis. The HTH motif is thought to be located in the central part of these proteins []. The motif is characterised by a number of well-conserved residues: at its N-terminal extremity is a cysteine residue; a second Cys is found in arsR and cadC, but not in smtA; and at the C terminus lie one or two histidines. These residues may be involved in metal-binding (Zn in smtB; metal-oxyanions such as arsenite, antimonite and arsenate for arsR; and cadmium for cadC) []. It is believed that binding of a metal ion could induce a conformational change that would prevent the protein from binding DNA []. The crystal structure of the cyanobacterial smtB shows a fold of five alpha-helices (H) and a pair of antiparallel beta-strands (B) in the topology H1-H2-H3-H4-B1-B2-H5. Helices 3 and 4 comprise the helix-turn-helix motif and the beta-sheet is called the wing as in other wHTH, such as the dtxR-type or the merR-type. Helix 4 is termed the recognition helix, like in other HTHs where it binds the DNA major groove. Most arsR/smtB-like metalloregulators form homodimers []. The dimer interface is formed by helix 5 and an N-terminal part []. Two distinct metal-binding sites have been identified. The first site comprises cysteine thiolates located in the HTH in helix 3 and for some cases in the N terminus, called the alpha3(N) site []. The second metal-binding site is located in helix 5 (and C terminus) and is called the alpha5(C) site. The alpha3N site binds large thiophilic, toxic metals including Cd, Pb, and Bi, as in S. aureus cadC. ArsR lacks the N-terminal arm and its alpha3 site coordinates smaller thiophilic ions like As and Sb. The alpha5 site contains carboxylate and imidazole ligands and interacts preferentially with biologically required metal ions including Zn, Co, and Ni. ArsR-type metalloregulators contain one of these sites, both, or other potential metal-binding sites [, ]. Binding of metal ions to these sites leads to allosteric changes that can derepress the operator/promotor DNA. The metal-inducible operons contain one or two imperfect 12-2-12 inverted repeats, which can be recognised by multimeric arsR-type metalloregulators. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3CUO_A 1U2W_C 3F72_C 3F6V_A 3JTH_B 2P4W_B 1KU9_B 2LKP_B 1SMT_A 1R22_B ....
Probab=27.64  E-value=59  Score=19.81  Aligned_cols=28  Identities=25%  Similarity=0.415  Sum_probs=23.0

Q ss_pred             cHHhhhCCChHHHHHHHHHHHHcCCCCC
Q psy1455         193 QIKDILGDNPRTIDLLFKFLKDSNLLPK  220 (221)
Q Consensus       193 ~l~~~L~~~~~~~~~i~~Fl~~t~l~~~  220 (221)
                      .+.+.|+-.+.++..=++.|.+.|+++|
T Consensus        20 el~~~l~~s~~~vs~hL~~L~~~glV~~   47 (47)
T PF01022_consen   20 ELAEELGLSQSTVSHHLKKLREAGLVEK   47 (47)
T ss_dssp             HHHHHHTS-HHHHHHHHHHHHHTTSEEE
T ss_pred             hHHHhccccchHHHHHHHHHHHCcCeeC
Confidence            7778888777889999999999998764


No 16 
>PF08097 Toxin_26:  Conotoxin T-superfamily;  InterPro: IPR012631 This family consists of the T-superfamily of conotoxins. Eight different T-superfamily peptides from five Conus species were identified. These peptides share a consensus signal sequence, and a conserved arrangement of cysteine residues. T-superfamily peptides were found expressed in venom ducts of all major feeding types of Conus, suggesting that the T-superfamily is a large and diverse group of peptides, widely distributed in the 500 different Conus species [].; GO: 0005576 extracellular region
Probab=26.76  E-value=24  Score=15.10  Aligned_cols=8  Identities=38%  Similarity=0.800  Sum_probs=5.8

Q ss_pred             hhhhhccc
Q psy1455          18 RPIIEYGA   25 (221)
Q Consensus        18 ~p~l~Yg~   25 (221)
                      -|++.|++
T Consensus         3 cpvirycc   10 (11)
T PF08097_consen    3 CPVIRYCC   10 (11)
T ss_pred             cchhheec
Confidence            47888875


No 17 
>PF00325 Crp:  Bacterial regulatory proteins, crp family;  InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. This family groups together a range of proteins, including anr, crp, clp, cysR, fixK, flp, fnr, fnrN, hlyX and ntcA [, ]. Within this family, the HTH motif is situated towards the C terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2OZ6_A 1CGP_B 2GZW_C 1O3T_B 3ROU_A 2CGP_A 3RDI_A 1I5Z_A 3IYD_H 3FWE_B ....
Probab=24.46  E-value=1.1e+02  Score=17.59  Aligned_cols=26  Identities=31%  Similarity=0.462  Sum_probs=22.0

Q ss_pred             cHHhhhCCChHHHHHHHHHHHHcCCC
Q psy1455         193 QIKDILGDNPRTIDLLFKFLKDSNLL  218 (221)
Q Consensus       193 ~l~~~L~~~~~~~~~i~~Fl~~t~l~  218 (221)
                      ++.+.||--++....+++-|++.|++
T Consensus         7 diA~~lG~t~ETVSR~l~~l~~~glI   32 (32)
T PF00325_consen    7 DIADYLGLTRETVSRILKKLERQGLI   32 (32)
T ss_dssp             HHHHHHTS-HHHHHHHHHHHHHTTSE
T ss_pred             HHHHHhCCcHHHHHHHHHHHHHcCCC
Confidence            67788998889999999999999875


No 18 
>PF04182 B-block_TFIIIC:  B-block binding subunit of TFIIIC;  InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks. This family represents the subunit within TFIIIC involved in B-block binding []. Although defined as a yeast protein, it is also found in a number of other organisms.
Probab=20.19  E-value=99  Score=20.98  Aligned_cols=28  Identities=32%  Similarity=0.519  Sum_probs=25.1

Q ss_pred             cHHhhhCCChHHHHHHHHHHHHcCCCCC
Q psy1455         193 QIKDILGDNPRTIDLLFKFLKDSNLLPK  220 (221)
Q Consensus       193 ~l~~~L~~~~~~~~~i~~Fl~~t~l~~~  220 (221)
                      +|...++-||..+..+++.|.+-||+.|
T Consensus        23 ~L~~~~~~D~r~i~~~~k~L~~~gLI~k   50 (75)
T PF04182_consen   23 DLSKLLGIDPRSIFYRLKKLEKKGLIVK   50 (75)
T ss_pred             HHHHHhCCCchHHHHHHHHHHHCCCEEE
Confidence            7778889899999999999999999865


Done!