Psyllid ID: psy14555


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFLADLTATRSSSSGLLSPEVNLNSKSPEQDRFYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK
cccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccHHccHHHHHHHHHHccccccccccHHHHHHccccccccccccccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccc
cccHHHcHHHHHcccccHcHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccHHccHHHHHHHHHHHcccccHcccHHHHHccccHEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccEEEEEEEEccccc
MNVIFLTqysvnssyspqadiwSLGCTIVematgkppfielgspqaaLYRVgfhkmhpeipaelSDKAKQFILRCFekdpdkratagelledpfladltatrssssgllspevnlnskspeqdrfYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK
MNVIFLTqysvnssyspqADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFLADLTATrssssgllspevnlnskspeqDRFYLCKKDSQRRITlsgvldqdrdHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK
MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFLADLTATRSSSSGLLSPEVNLNSKSPEQDRFYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK
**VIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFE***********************************************FYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFH***
MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFL***************************************************************************LEILMQGMRDNIAEQQKS****KIAQLKQELNFDSVAINQIHFAIYLFHE**
MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFLADLTATRSSSSGLLSPEVNLNSKSPEQDRFYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK
*NVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFLADLT********LLSPEVNLNSKSPEQDRFYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHE**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEKDPDKRATAGELLEDPFLADLTATRSSSSGLLSPEVNLNSKSPEQDRFYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q6ZN16 1313 Mitogen-activated protein yes N/A 0.932 0.157 0.347 5e-38
A2AQW0 1331 Mitogen-activated protein yes N/A 0.936 0.156 0.332 1e-34
Q99683 1374 Mitogen-activated protein no N/A 0.360 0.058 0.682 6e-29
O35099 1380 Mitogen-activated protein no N/A 0.360 0.057 0.682 7e-29
Q9WTR2 1291 Mitogen-activated protein no N/A 0.918 0.158 0.315 8e-28
O95382 1288 Mitogen-activated protein no N/A 0.441 0.076 0.571 4e-27
O22042 651 Mitogen-activated protein no N/A 0.387 0.132 0.476 4e-18
Q9FZ36 651 Mitogen-activated protein no N/A 0.387 0.132 0.430 1e-16
O22040 666 Mitogen-activated protein no N/A 0.5 0.166 0.419 1e-16
O743041436 MAP kinase kinase kinase yes N/A 0.360 0.055 0.506 1e-15
>sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 Back     alignment and function desciption
 Score =  157 bits (397), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 95/273 (34%), Positives = 138/273 (50%), Gaps = 66/273 (24%)

Query: 14   SYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFIL 73
             Y   ADIWSLGCTI+EMAT KPPF ELG PQAA+++VG  K+HPEIP  LS +A+ FIL
Sbjct: 827  GYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFIL 886

Query: 74   RCFEKDPDKRATAGELLEDPFLADLT-----------------------------ATRSS 104
             CFE DP KRAT  ELL + FL  +                              AT SS
Sbjct: 887  SCFEPDPHKRATTAELLREGFLRQVNKGKKNRIAFKPSEGPRGVVLALPTQGEPMATSSS 946

Query: 105  SSGLLSPEVNLN---------------------------------SKSPEQDR---FYLC 128
              G +SP+ +                                   + SPE DR    +L 
Sbjct: 947  EHGSVSPDSDAQPDALFERTRAPRHHLGHLLSVPDESSALEDRGLASSPE-DRDQGLFLL 1005

Query: 129  KKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMRDNIAEQQKS 188
            +KDS+RR  L  +L ++++ +     +C+ +  ++  LS  H++ ++  +RD I   +  
Sbjct: 1006 RKDSERRAILYKILWEEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHR 1065

Query: 189  CIETKIAQLKQELNFDSVAINQIHFAIYLFHEA 221
             + T I++LK +L+FDS +I+QIH  ++ F +A
Sbjct: 1066 VMATTISKLKVDLDFDSSSISQIHLVLFGFQDA 1098




May function in a signal transduction pathway that is activated by various cell stresses and leads to apoptosis.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 5
>sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=3 SV=1 Back     alignment and function description
>sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 Back     alignment and function description
>sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 Back     alignment and function description
>sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 Back     alignment and function description
>sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 Back     alignment and function description
>sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 Back     alignment and function description
>sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 Back     alignment and function description
>sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
270001582 1255 hypothetical protein TcasGA2_TC000430 [T 0.923 0.163 0.458 4e-58
189234710 1322 PREDICTED: similar to Protein kinase at 0.923 0.155 0.464 2e-57
328719231 1346 PREDICTED: mitogen-activated protein kin 0.932 0.153 0.430 1e-52
427780971 1153 Putative protein kinase at 92b [Rhipicep 0.936 0.180 0.429 1e-49
198454803 1357 Pk92B, isoform A [Drosophila pseudoobscu 0.936 0.153 0.405 7e-47
390179293 1194 Pk92B, isoform B [Drosophila pseudoobscu 0.936 0.174 0.405 1e-46
390336813 1517 PREDICTED: mitogen-activated protein kin 0.914 0.133 0.384 3e-43
444707473 989 Mitogen-activated protein kinase kinase 0.936 0.210 0.402 2e-39
281352953 1152 hypothetical protein PANDA_001829 [Ailur 0.932 0.179 0.360 7e-37
47077281 748 unnamed protein product [Homo sapiens] 0.932 0.276 0.347 2e-36
>gi|270001582|gb|EEZ98029.1| hypothetical protein TcasGA2_TC000430 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  230 bits (586), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 122/266 (45%), Positives = 162/266 (60%), Gaps = 61/266 (22%)

Query: 14   SYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFIL 73
             Y   ADIWSLGCT+VEMATGKPPFIELGSPQAA+++VG++K HP++P ELSD+AK FIL
Sbjct: 789  GYGAPADIWSLGCTVVEMATGKPPFIELGSPQAAVFKVGYYKDHPQVPEELSDRAKHFIL 848

Query: 74   RCFEKDPDKRATAGELLEDPFL-------------------------------------- 95
            RCFE DPDKRA+A +LLEDPF+                                      
Sbjct: 849  RCFEPDPDKRASAAQLLEDPFIGVDRKKSVRLNTEFNRSVSVPVDKMLPRLPGCSAPNQT 908

Query: 96   -----ADLTAT--------------RSSSSGLLSPEVNLNSKSPEQDRFYLCKKDSQRRI 136
                 +DL +T              R+S+  LLSPEV+    S E D FYL KKDSQRR 
Sbjct: 909  PTTPESDLASTPSLEIESCQDDTERRNSTGTLLSPEVD---ASTETDGFYLLKKDSQRRT 965

Query: 137  TLSGVLDQDRDHICQVWLKCIQ-RDVDDCLLSKAHLEILMQGMRDNIAEQQKSCIETKIA 195
            TL+ VL QD   +C+VW+  I+ + + + +L++ HL  LM G++D + EQ  + +E+ + 
Sbjct: 966  TLAKVLAQDGAKVCEVWMHKIRDKYMGETVLTQKHLARLMDGLKDYLTEQSLTVVESAVR 1025

Query: 196  QLKQELNFDSVAINQIHFAIYLFHEA 221
             LK+EL+FDS AINQ+ FAIYL+ E+
Sbjct: 1026 LLKEELDFDSTAINQLQFAIYLYQES 1051




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234710|ref|XP_972515.2| PREDICTED: similar to Protein kinase at 92B CG4720-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328719231|ref|XP_001945657.2| PREDICTED: mitogen-activated protein kinase kinase kinase 15-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|427780971|gb|JAA55937.1| Putative protein kinase at 92b [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|198454803|ref|XP_001359730.2| Pk92B, isoform A [Drosophila pseudoobscura pseudoobscura] gi|198132960|gb|EAL28882.2| Pk92B, isoform A [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|390179293|ref|XP_003736857.1| Pk92B, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859790|gb|EIM52930.1| Pk92B, isoform B [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|390336813|ref|XP_797118.3| PREDICTED: mitogen-activated protein kinase kinase kinase 15 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|444707473|gb|ELW48748.1| Mitogen-activated protein kinase kinase kinase 15 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|281352953|gb|EFB28537.1| hypothetical protein PANDA_001829 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|47077281|dbj|BAD18559.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
FB|FBgn0014006 1367 Pk92B "Protein kinase at 92B" 0.373 0.060 0.674 8.9e-48
UNIPROTKB|A6NIA0 621 MAP3K5 "cDNA FLJ50139, highly 0.364 0.130 0.691 1e-40
ZFIN|ZDB-GENE-030827-3 1364 map3k5 "mitogen-activated prot 0.405 0.065 0.637 1.2e-40
UNIPROTKB|F1NKW3 1207 MAP3K15 "Uncharacterized prote 0.477 0.087 0.556 1.7e-40
UNIPROTKB|I3LMU4 621 I3LMU4 "Uncharacterized protei 0.364 0.130 0.679 6e-40
UNIPROTKB|F1NYS9998 F1NYS9 "Uncharacterized protei 0.441 0.098 0.642 1.2e-39
UNIPROTKB|Q99683 1374 MAP3K5 "Mitogen-activated prot 0.364 0.058 0.691 2.2e-39
MGI|MGI:1346876 1380 Map3k5 "mitogen-activated prot 0.364 0.058 0.691 2.8e-39
ZFIN|ZDB-GENE-091204-246 1331 si:dkey-108d10.2 "si:dkey-108d 0.364 0.060 0.703 4.1e-39
UNIPROTKB|F1PA02 1366 MAP3K5 "Uncharacterized protei 0.364 0.059 0.691 5.7e-39
FB|FBgn0014006 Pk92B "Protein kinase at 92B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 8.9e-48, Sum P(2) = 8.9e-48
 Identities = 56/83 (67%), Positives = 62/83 (74%)

Query:    15 YSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILR 74
             Y P ADIWS GCT VEMATGKPPFIELGS  AA+++VGF+K HP IP ELS  AK FILR
Sbjct:   767 YGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILR 826

Query:    75 CFEKDPDKRATAGELLEDPFLAD 97
             CF      R +A +LLEDPFL D
Sbjct:   827 CFAISVMDRPSASQLLEDPFLQD 849


GO:0006468 "protein phosphorylation" evidence=IEA;ISS;NAS
GO:0004709 "MAP kinase kinase kinase activity" evidence=ISS
GO:0004702 "receptor signaling protein serine/threonine kinase activity" evidence=NAS
GO:0012501 "programmed cell death" evidence=NAS
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0032874 "positive regulation of stress-activated MAPK cascade" evidence=IDA;IMP
GO:0048082 "regulation of adult chitin-containing cuticle pigmentation" evidence=IMP
GO:0046330 "positive regulation of JNK cascade" evidence=IDA
UNIPROTKB|A6NIA0 MAP3K5 "cDNA FLJ50139, highly similar to Mitogen-activated protein kinase kinase kinase 5(EC 2.7.11.25)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030827-3 map3k5 "mitogen-activated protein kinase kinase kinase 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKW3 MAP3K15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LMU4 I3LMU4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYS9 F1NYS9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q99683 MAP3K5 "Mitogen-activated protein kinase kinase kinase 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1346876 Map3k5 "mitogen-activated protein kinase kinase kinase 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-246 si:dkey-108d10.2 "si:dkey-108d10.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PA02 MAP3K5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 1e-46
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-39
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-31
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 6e-27
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-25
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 5e-24
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 7e-24
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 1e-21
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 6e-21
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-18
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-18
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-18
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-18
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 4e-18
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 6e-17
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-16
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-15
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 3e-15
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-15
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 6e-15
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 9e-15
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 9e-15
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 2e-14
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-14
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 3e-14
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 5e-14
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 6e-14
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 2e-13
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-13
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-13
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 5e-13
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 3e-12
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 3e-12
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 5e-12
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 5e-12
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 9e-12
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 1e-11
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-11
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-11
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 2e-11
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-11
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-11
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 3e-11
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 4e-11
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 4e-11
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 8e-11
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-10
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-10
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-10
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 3e-10
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 4e-10
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 8e-10
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 8e-10
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-09
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-09
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-09
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-09
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 7e-09
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 7e-09
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-09
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 8e-09
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 1e-08
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-08
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 2e-08
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 2e-08
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-08
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 3e-08
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 5e-08
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 6e-08
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 7e-08
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 8e-08
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-07
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 1e-07
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 1e-07
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-07
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 4e-07
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 6e-07
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 6e-07
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 7e-07
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 8e-07
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 8e-07
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 9e-07
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-06
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-06
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-06
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-06
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-06
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 3e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 4e-06
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 4e-06
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-06
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 5e-06
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 6e-06
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 6e-06
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 6e-06
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 6e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 7e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 8e-06
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 8e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 9e-06
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-05
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 2e-05
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-05
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-05
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 3e-05
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 3e-05
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-05
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 4e-05
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 4e-05
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-05
smart00750176 smart00750, KIND, kinase non-catalytic C-lobe doma 6e-05
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 7e-05
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 8e-05
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 9e-05
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 9e-05
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 1e-04
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 1e-04
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-04
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 1e-04
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-04
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 2e-04
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-04
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-04
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 3e-04
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 3e-04
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-04
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 3e-04
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 4e-04
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 4e-04
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 4e-04
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 4e-04
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 5e-04
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 5e-04
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 6e-04
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 6e-04
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 6e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 7e-04
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 8e-04
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 9e-04
cd08226328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 0.001
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 0.001
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 0.001
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 0.001
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 0.002
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 0.002
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 0.002
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.002
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 0.002
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 0.002
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 0.002
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 0.002
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.002
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 0.002
cd08227327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 0.002
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 0.003
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.003
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 0.003
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 0.003
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.004
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.004
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
 Score =  154 bits (392), Expect = 1e-46
 Identities = 61/81 (75%), Positives = 69/81 (85%)

Query: 15  YSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILR 74
           Y   ADIWSLGCTIVEMATGKPPFIELG PQAA+++VG  K+HPEIP  LS +AK FILR
Sbjct: 188 YGAPADIWSLGCTIVEMATGKPPFIELGEPQAAMFKVGMFKIHPEIPESLSAEAKNFILR 247

Query: 75  CFEKDPDKRATAGELLEDPFL 95
           CFE DPDKRA+A +LL+DPFL
Sbjct: 248 CFEPDPDKRASAHDLLQDPFL 268


Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It plays important roles in cytokine and stress responses, as well as in reactive oxygen species (ROS)-mediated cellular responses. ASK1 is implicated in various diseases mediated by oxidative stress including inschemic heart disease, hypertension, vessel injury, brain ischemia, Fanconi anemia, asthma, and pulmonary edema, among others. ASK2 (also called MAPKKK6) functions only in a heteromeric complex with ASK1, and can activate ASK1 by direct phosphorylation. The function of MAPKKK15 is still unknown. Length = 268

>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG4279|consensus 1226 100.0
KOG0033|consensus355 99.89
KOG0598|consensus357 99.87
KOG0610|consensus459 99.86
KOG0605|consensus550 99.86
KOG0986|consensus591 99.86
KOG0581|consensus364 99.85
KOG0616|consensus355 99.84
KOG0575|consensus 592 99.84
KOG0578|consensus550 99.84
KOG0694|consensus694 99.84
KOG0615|consensus475 99.83
KOG0592|consensus 604 99.82
KOG0604|consensus400 99.82
KOG0201|consensus467 99.82
KOG0198|consensus313 99.81
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.79
KOG0597|consensus 808 99.79
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.78
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.78
KOG0032|consensus382 99.78
KOG0603|consensus612 99.77
KOG0583|consensus370 99.77
KOG0588|consensus 786 99.77
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.77
PTZ00284467 protein kinase; Provisional 99.76
KOG0599|consensus411 99.76
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.76
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.76
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.76
PTZ00036440 glycogen synthase kinase; Provisional 99.76
KOG0696|consensus683 99.76
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.75
KOG0690|consensus516 99.75
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.75
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.75
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.75
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.74
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.74
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.74
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.74
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.74
KOG0582|consensus516 99.74
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.74
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.74
KOG0660|consensus359 99.74
KOG0596|consensus677 99.74
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.74
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.73
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.73
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.73
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.73
KOG0614|consensus732 99.73
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.73
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.73
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.73
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.73
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.73
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.72
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.72
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.72
KOG4721|consensus 904 99.72
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.72
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.72
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.72
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.72
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.72
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.72
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.72
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.72
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.72
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.71
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.71
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.71
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.71
KOG4717|consensus 864 99.71
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.71
KOG0192|consensus362 99.71
PTZ00283496 serine/threonine protein kinase; Provisional 99.71
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.71
KOG0591|consensus375 99.71
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.71
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.71
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.7
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.7
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.7
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.7
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.7
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.7
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.7
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.7
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.7
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.7
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.7
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.7
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.7
PHA02988283 hypothetical protein; Provisional 99.7
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.7
KOG0579|consensus 1187 99.7
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.7
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.7
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.69
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.69
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.69
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.69
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.69
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.69
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.68
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.68
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.68
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.68
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.68
PTZ00267478 NIMA-related protein kinase; Provisional 99.68
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.68
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.68
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.68
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.68
KOG0667|consensus586 99.68
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.68
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.68
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.68
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.68
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.68
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.68
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.68
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.68
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.68
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.67
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.67
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.67
KOG0983|consensus391 99.67
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.67
PHA03212391 serine/threonine kinase US3; Provisional 99.67
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.67
KOG0580|consensus281 99.67
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.67
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.67
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.67
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.67
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.67
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.66
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.66
KOG4645|consensus1509 99.66
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.66
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.66
PHA03207392 serine/threonine kinase US3; Provisional 99.66
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.66
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.66
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.66
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.66
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.66
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.66
KOG0593|consensus396 99.66
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.66
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.66
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.65
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.65
KOG0661|consensus 538 99.65
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.65
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.65
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.65
KOG0695|consensus593 99.65
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.65
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.65
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.65
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.65
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.65
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.65
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.65
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.65
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.65
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.65
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.65
PHA03209357 serine/threonine kinase US3; Provisional 99.65
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.65
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.65
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.65
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.65
KOG0589|consensus426 99.65
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.64
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.64
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.64
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.64
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.64
KOG0612|consensus 1317 99.64
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.64
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.64
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.64
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.64
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.64
KOG0196|consensus996 99.64
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.64
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.63
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.63
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.63
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.63
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.63
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.63
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.63
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.63
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.63
KOG0197|consensus468 99.63
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.63
KOG0607|consensus463 99.62
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.62
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.62
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.62
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.62
KOG0574|consensus502 99.62
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.62
PLN00181 793 protein SPA1-RELATED; Provisional 99.62
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.62
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.62
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.62
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.62
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.62
KOG0595|consensus429 99.62
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.61
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.61
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.61
PHA03211461 serine/threonine kinase US3; Provisional 99.61
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.61
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.61
PLN00009294 cyclin-dependent kinase A; Provisional 99.61
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.61
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.61
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.61
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.61
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.61
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.61
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.6
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.6
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.6
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.6
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.6
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.6
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.6
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.6
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.6
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.6
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.6
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.59
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.59
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.59
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.59
KOG0659|consensus318 99.59
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.59
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.59
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.59
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.59
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.59
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.59
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.58
KOG1026|consensus774 99.58
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.58
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.58
KOG0671|consensus415 99.58
KOG0585|consensus576 99.58
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.58
KOG0663|consensus419 99.58
KOG0658|consensus364 99.58
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.58
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.58
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.58
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.58
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.58
PHA03210501 serine/threonine kinase US3; Provisional 99.58
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.58
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.58
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.57
KOG0577|consensus 948 99.57
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.57
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.57
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.57
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.57
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.57
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.57
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.57
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.57
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.57
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.56
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.56
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.56
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.56
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.56
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.56
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.56
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.56
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.56
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.56
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.56
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.55
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.55
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.55
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.55
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.55
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.55
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.55
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.55
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.55
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.54
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.54
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.54
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.54
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.54
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.54
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.54
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.54
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.54
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.54
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.54
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.54
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.54
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.54
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.54
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.54
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.54
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.54
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.53
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.53
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.53
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.53
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.53
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.53
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.52
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.52
KOG2345|consensus302 99.52
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.52
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.52
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.52
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.51
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.51
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.51
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.51
KOG1290|consensus590 99.51
KOG1024|consensus563 99.51
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.51
KOG1095|consensus1025 99.51
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.5
KOG0584|consensus 632 99.5
PHA02882294 putative serine/threonine kinase; Provisional 99.5
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.5
KOG0608|consensus1034 99.5
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.49
KOG0665|consensus369 99.49
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.49
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.49
KOG0600|consensus560 99.49
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.49
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.49
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.49
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.48
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.48
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.48
KOG0200|consensus609 99.47
KOG0193|consensus678 99.47
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.47
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.47
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.45
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.45
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.45
KOG4236|consensus888 99.45
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.44
KOG0670|consensus752 99.44
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.44
KOG0594|consensus323 99.44
KOG1006|consensus361 99.44
KOG4257|consensus 974 99.43
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.42
KOG0199|consensus 1039 99.42
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.41
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.39
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.38
KOG1989|consensus 738 99.37
KOG4278|consensus 1157 99.37
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.36
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.36
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.36
PLN03224507 probable serine/threonine protein kinase; Provisio 99.35
KOG1035|consensus 1351 99.34
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.34
KOG0666|consensus438 99.32
KOG1151|consensus775 99.32
KOG0587|consensus 953 99.32
KOG0586|consensus 596 99.31
KOG0606|consensus 1205 99.3
KOG0669|consensus376 99.29
KOG0611|consensus 668 99.26
KOG1027|consensus903 99.24
KOG0194|consensus474 99.19
KOG0603|consensus 612 99.17
KOG1025|consensus1177 99.13
KOG1094|consensus807 99.11
KOG0668|consensus338 99.09
KOG0195|consensus448 99.08
KOG0662|consensus292 99.02
KOG0576|consensus 829 99.0
KOG0664|consensus449 98.98
KOG0590|consensus601 98.95
KOG1167|consensus418 98.94
KOG1187|consensus361 98.94
KOG1033|consensus516 98.86
KOG0984|consensus282 98.77
KOG0606|consensus1205 98.7
KOG4250|consensus 732 98.57
KOG1240|consensus 1431 98.44
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 98.41
KOG1023|consensus 484 98.24
KOG2052|consensus513 98.2
KOG0590|consensus 601 98.18
COG0515384 SPS1 Serine/threonine protein kinase [General func 98.11
KOG1345|consensus378 98.02
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 97.96
KOG4158|consensus598 97.94
KOG3653|consensus534 97.85
KOG2137|consensus 700 96.96
KOG1266|consensus458 96.6
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 95.27
KOG0601|consensus524 94.73
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 94.53
KOG1093|consensus 725 94.24
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 94.16
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 93.73
KOG1164|consensus322 93.56
cd0503088 calgranulins Calgranulins: S-100 domain found in p 92.78
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 92.3
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 92.01
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 91.87
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 91.39
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 89.38
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 89.07
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 89.03
KOG0044|consensus193 88.94
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 88.54
cd0021388 S-100 S-100: S-100 domain, which represents the la 87.23
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 86.38
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 84.44
KOG0034|consensus187 82.19
>KOG4279|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-37  Score=264.53  Aligned_cols=222  Identities=40%  Similarity=0.691  Sum_probs=190.8

Q ss_pred             CcceecCcccCCC--CCCchhhHHHHHHHHHHHHhCCCCCCCCCChHHHHHHhhhccCCCCCCccccHHHHHHHHHhccc
Q psy14555          1 MNVIFLTQYSVNS--SYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFILRCFEK   78 (222)
Q Consensus         1 t~~y~aPe~~~~~--~y~~~~DiWS~Gvil~ell~g~~Pf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~l~~   78 (222)
                      |..|||||++-.+  +|++++|||||||.+.||.+|+|||.+++.+...+++++..+.+|+.|..++.++++||.+|+.+
T Consensus       739 TLQYMAPEvIDqG~RGYG~aADIWS~GCT~vEMATGrPPF~ElgspqAAMFkVGmyKvHP~iPeelsaeak~FilrcFep  818 (1226)
T KOG4279|consen  739 TLQYMAPEVIDQGPRGYGKAADIWSFGCTMVEMATGRPPFVELGSPQAAMFKVGMYKVHPPIPEELSAEAKNFILRCFEP  818 (1226)
T ss_pred             chhhhChHhhccCCcCCCchhhhhhccceeEeeccCCCCeeecCChhHhhhhhcceecCCCCcHHHHHHHHHHHHHHcCC
Confidence            6789999988654  69999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhhhhcCccccccccccC--------------CCCC-------------------------------------
Q psy14555         79 DPDKRATAGELLEDPFLADLTATRS--------------SSSG-------------------------------------  107 (222)
Q Consensus        79 ~p~~R~s~~~~l~h~~~~~~~~~~~--------------~~~~-------------------------------------  107 (222)
                      +|.+||++.+++.+||++.......              .+..                                     
T Consensus       819 d~~~R~sA~~LL~DpFlq~~~kk~r~~ls~~ha~~~e~~rS~S~Ptp~~vs~T~s~~f~~s~sp~~~P~S~~t~~~s~~~  898 (1226)
T KOG4279|consen  819 DPCDRPSAKDLLQDPFLQHNNKKPRPKLSLNHANQREMLRSISHPTPEPVSATLSAGFFSSSSPVSQPSSPITRCTSHGH  898 (1226)
T ss_pred             CcccCccHHHhccCcccccCCCCCCCCCCcccCCChhhccccCCCCCcccccccccCccCCCCCccCCCCCCcccCCCCC
Confidence            9999999999999999975310000              0000                                     


Q ss_pred             ---CCCCCCCC-----CCCCccccccccccccccccchhhhhcccchhHHHHHHHHhhhcccCCcccCHHHHHHHHHHHH
Q psy14555        108 ---LLSPEVNL-----NSKSPEQDRFYLCKKDSQRRITLSGVLDQDRDHICQVWLKCIQRDVDDCLLSKAHLEILMQGMR  179 (222)
Q Consensus       108 ---~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~~~i~~l~~~~~  179 (222)
                         +..|....     .++......+|...++++++.++..++..+.+.+..+|...+.+..+...+-+.+++.++.+++
T Consensus       899 vs~ir~p~e~~~~s~~~s~ee~~S~~fmL~kdseRRasl~~~l~~e~d~i~~sl~tsl~q~se~~~l~r~~~e~llr~l~  978 (1226)
T KOG4279|consen  899 VSPIRSPLESALHSRPISPEESSSGFFMLQKDSERRASLGQFLQDEKDLIIDSLSTSLIQQSETELLVRVHMEMLLRGLR  978 (1226)
T ss_pred             cCCCCCcccchhhcCCCChhhcCCcceeeechhHHHHHHHHHhccchhhhhHHHHHHHHhccccchhHHHHHHHHHHHHH
Confidence               00000000     0011113468899999999999999999999999999998888888889999999999999999


Q ss_pred             HhhhcchhhHHHHHHHHHHHHcCCCccchhhHHHhhcccccCC
Q psy14555        180 DNIAEQQKSCIETKIAQLKQELNFDSVAINQIHFAIYLFHEAK  222 (222)
Q Consensus       180 ~~~~~~~~~~~~~~i~~l~~~ld~d~~g~~~~~~~~~~~~~~~  222 (222)
                      .++...|+.++++.+++|+..||.|++||.|++++||||+|||
T Consensus       979 ~~v~~~d~~kia~~l~~lkg~ld~d~~~ia~~~~~lf~f~DaV 1021 (1226)
T KOG4279|consen  979 DFVLKKDRTKIAKMLDDLKGLLDADTAGIAQINLALFHFSDAV 1021 (1226)
T ss_pred             HHHhcccHHHHHHHHHHHhhhccccccchhhhhhhhccchHHH
Confidence            9999999999999999999999999999999999999999997



>KOG0033|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 9e-30
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 1e-29
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 1e-11
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-11
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-11
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 4e-11
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 4e-11
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 6e-11
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-10
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-10
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-10
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 2e-10
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 2e-10
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-10
4fie_A423 Full-Length Human Pak4 Length = 423 3e-10
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-10
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-10
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-10
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 5e-10
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 6e-10
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 6e-10
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 7e-10
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 7e-10
3a7f_A303 Human Mst3 Kinase Length = 303 7e-10
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 8e-10
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-09
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-09
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-08
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 2e-08
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 7e-08
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 9e-08
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 1e-07
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 1e-07
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-07
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 2e-07
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 2e-07
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 4e-07
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 7e-07
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-06
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-06
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-06
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-06
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-06
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-06
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-06
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 3e-06
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-06
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-06
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 3e-06
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-06
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 3e-06
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 4e-06
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 4e-06
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 4e-06
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 4e-06
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 4e-06
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 4e-06
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 5e-06
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 5e-06
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 5e-06
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 5e-06
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 5e-06
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 5e-06
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 6e-06
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 6e-06
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 6e-06
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 6e-06
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 6e-06
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 6e-06
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 6e-06
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 7e-06
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 7e-06
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 7e-06
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 7e-06
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 7e-06
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 9e-06
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-05
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 2e-05
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 2e-05
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-05
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-05
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 2e-05
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-05
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-05
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-05
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 3e-05
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 3e-05
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 3e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 3e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 3e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 3e-05
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 3e-05
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 3e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 3e-05
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-05
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 3e-05
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 3e-05
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 3e-05
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-05
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 3e-05
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 3e-05
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 3e-05
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 3e-05
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 3e-05
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-05
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 3e-05
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-05
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 3e-05
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 3e-05
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 4e-05
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 4e-05
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 5e-05
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 5e-05
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 6e-05
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 7e-05
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 7e-05
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 7e-05
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 8e-05
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 9e-05
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-04
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 1e-04
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-04
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-04
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-04
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 1e-04
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-04
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-04
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-04
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 2e-04
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 2e-04
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-04
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-04
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 2e-04
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 2e-04
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 2e-04
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 2e-04
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 2e-04
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-04
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 2e-04
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 2e-04
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 3e-04
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 3e-04
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-04
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 3e-04
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 3e-04
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 3e-04
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-04
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 3e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-04
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 3e-04
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 3e-04
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 3e-04
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 3e-04
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 3e-04
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 4e-04
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 4e-04
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 5e-04
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 6e-04
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 6e-04
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 6e-04
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 6e-04
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 6e-04
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 6e-04
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 6e-04
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 6e-04
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 6e-04
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 6e-04
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 6e-04
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 7e-04
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 7e-04
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 7e-04
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 7e-04
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 7e-04
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 7e-04
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 7e-04
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 7e-04
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-04
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 7e-04
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 7e-04
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 7e-04
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-04
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 7e-04
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 8e-04
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 8e-04
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 8e-04
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 8e-04
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 8e-04
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 8e-04
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 8e-04
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 8e-04
3bhy_A283 Crystal Structure Of Human Death Associated Protein 8e-04
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 8e-04
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 8e-04
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 9e-04
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure

Iteration: 1

Score = 126 bits (317), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 56/82 (68%), Positives = 65/82 (79%) Query: 14 SYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQFIL 73 Y ADIWSLGCTI+EMATGKPPF ELG PQAA+++VG K+HPEIP +S +AK FIL Sbjct: 201 GYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFIL 260 Query: 74 RCFEKDPDKRATAGELLEDPFL 95 +CFE DPDKRA A +LL D FL Sbjct: 261 KCFEPDPDKRACANDLLVDEFL 282
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-45
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 3e-35
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 3e-31
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 7e-28
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 8e-28
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 5e-27
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 9e-27
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-25
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-23
3fme_A290 Dual specificity mitogen-activated protein kinase; 1e-22
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-22
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 6e-22
3aln_A327 Dual specificity mitogen-activated protein kinase; 6e-22
2dyl_A318 Dual specificity mitogen-activated protein kinase 3e-21
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 7e-21
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-20
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-20
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-20
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-20
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-20
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 7e-20
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 8e-20
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 9e-20
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 1e-18
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-17
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-17
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-16
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-16
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 5e-16
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-16
3eqc_A360 Dual specificity mitogen-activated protein kinase; 3e-15
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-15
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 8e-15
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-14
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-14
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-14
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-14
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-14
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 7e-14
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 1e-13
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-13
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-13
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 2e-13
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 3e-13
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-13
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-12
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-12
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-12
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-12
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-12
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-12
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-12
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-12
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 4e-12
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 4e-12
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 4e-12
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-12
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 5e-12
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 6e-12
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 8e-12
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 9e-12
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 9e-12
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-11
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-11
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-11
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-11
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-11
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-11
3uqc_A286 Probable conserved transmembrane protein; structur 2e-11
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-11
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-11
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-11
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-11
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-11
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 3e-11
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-11
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-11
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 6e-11
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-10
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-10
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 1e-10
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-10
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-10
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-10
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 1e-10
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-10
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 2e-10
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-10
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-10
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-10
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-10
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-10
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 3e-10
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 3e-10
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-10
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 4e-10
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-10
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 5e-10
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 6e-10
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 6e-10
3bhy_A283 Death-associated protein kinase 3; death associate 6e-10
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 8e-10
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 9e-10
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-09
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-09
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 1e-09
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-09
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 1e-09
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-09
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 2e-09
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-09
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 2e-09
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 3e-09
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 3e-09
2fst_X367 Mitogen-activated protein kinase 14; active mutant 3e-09
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 3e-09
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 4e-09
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 5e-09
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 5e-09
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 5e-09
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 6e-09
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 6e-09
3niz_A311 Rhodanese family protein; structural genomics, str 7e-09
3dls_A335 PAS domain-containing serine/threonine-protein KI; 7e-09
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-08
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-08
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-08
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 1e-08
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-08
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-08
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-08
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-08
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 2e-08
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-08
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 3e-08
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 4e-08
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 4e-08
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 5e-08
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 5e-08
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-08
2eue_A275 Carbon catabolite derepressing protein kinase; kin 5e-08
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 7e-08
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 7e-08
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 1e-07
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 1e-07
3q4u_A301 Activin receptor type-1; structural genomics conso 1e-07
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-07
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-07
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-07
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-07
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 3e-07
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-07
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-07
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 4e-07
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 5e-07
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 5e-07
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 5e-07
3o0g_A292 Cell division protein kinase 5; kinase activator c 5e-07
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 5e-07
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 6e-07
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 6e-07
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 8e-07
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-06
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-06
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-06
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-06
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-05
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3rp9_A458 Mitogen-activated protein kinase; structural genom 3e-04
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 5e-04
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 8e-04
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
 Score =  152 bits (386), Expect = 1e-45
 Identities = 57/97 (58%), Positives = 69/97 (71%)

Query: 12  NSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQF 71
              Y   ADIWSLGCTI+EMATGKPPF ELG PQAA+++VG  K+HPEIP  +S +AK F
Sbjct: 199 PRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAF 258

Query: 72  ILRCFEKDPDKRATAGELLEDPFLADLTATRSSSSGL 108
           IL+CFE DPDKRA A +LL D FL   +  + +   L
Sbjct: 259 ILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKL 295


>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.91
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.91
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.91
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.9
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.9
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.9
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.89
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.88
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.88
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.88
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.88
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.87
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.87
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.86
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.86
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.85
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.84
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.83
4aoj_A329 High affinity nerve growth factor receptor; transf 99.83
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.83
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.83
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.82
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.82
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.82
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.82
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.82
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.81
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.81
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.81
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.81
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.81
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.8
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.8
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.8
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.8
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.8
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.79
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.79
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.79
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.79
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.79
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.79
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.79
3niz_A311 Rhodanese family protein; structural genomics, str 99.79
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.79
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.78
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.78
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.78
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.78
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.78
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.78
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.78
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.78
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.78
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.78
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.77
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.77
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.77
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.77
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.77
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.77
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.77
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.77
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.77
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.77
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.77
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.77
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.77
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.77
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.77
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.77
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.76
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.76
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.76
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.76
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.76
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.76
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.76
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.76
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.76
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.76
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.76
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.76
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.76
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.76
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.76
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.76
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.75
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.75
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.75
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.75
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.75
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.75
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.75
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.75
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.75
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.75
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.75
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.75
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.75
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.75
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.75
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.75
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.75
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.75
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.75
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.75
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.74
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.74
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.74
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.74
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.74
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.74
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.74
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.74
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.74
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.74
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.74
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.74
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.74
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.74
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.74
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.73
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.73
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.73
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.73
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.73
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.73
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.73
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.72
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.72
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.72
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.72
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.72
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.72
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.72
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.72
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.72
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.72
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.71
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.71
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.71
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.71
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.71
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.71
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.7
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.7
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.7
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.7
3bhy_A283 Death-associated protein kinase 3; death associate 99.7
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.7
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.69
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.68
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.68
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.68
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.68
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.67
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.67
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.66
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.66
3ork_A311 Serine/threonine protein kinase; structural genomi 99.65
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.65
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.65
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.65
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.65
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.64
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.64
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.64
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.64
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.64
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.64
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.63
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.63
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.63
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.62
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.62
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.62
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.62
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.62
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.62
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.62
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.62
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.62
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.61
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.61
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.61
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.61
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.61
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.61
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.61
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.61
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.61
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.61
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.61
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.6
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.6
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.6
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.6
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.6
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.6
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.6
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.59
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.59
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.59
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.59
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.59
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.59
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.59
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.59
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.58
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.58
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.58
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.58
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.58
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.57
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.57
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.57
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.56
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.56
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.56
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.56
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.56
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.55
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.55
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.55
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.55
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.55
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.55
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.54
3q4u_A301 Activin receptor type-1; structural genomics conso 99.54
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.54
3soc_A322 Activin receptor type-2A; structural genomics cons 99.54
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.54
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.53
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.53
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.52
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.52
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.52
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.5
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.5
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.5
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.49
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.48
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.47
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.43
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.43
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.31
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.2
3uqc_A286 Probable conserved transmembrane protein; structur 99.2
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.19
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 95.7
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.64
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 95.06
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 94.54
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 94.46
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 94.45
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 94.34
3li6_A66 Calcium-binding protein; calcium signaling protein 94.15
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 93.63
1avs_A90 Troponin C; muscle contraction, calcium-activated, 93.16
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 93.03
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 92.9
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 92.76
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 92.53
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 92.52
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 92.37
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 92.17
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 91.89
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 91.85
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 91.83
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 91.76
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 91.72
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 91.7
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 91.67
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 91.32
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 91.26
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 90.8
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 90.67
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 90.36
1c07_A95 Protein (epidermal growth factor receptor pathway 89.96
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 89.95
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 89.6
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 89.41
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 89.33
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 89.15
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 89.06
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 88.93
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 88.78
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 88.69
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 88.6
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 88.58
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 88.52
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 88.34
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 88.16
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 86.4
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 86.33
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 86.15
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 86.14
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 85.92
2jq6_A139 EH domain-containing protein 1; metal binding prot 85.87
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 85.83
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 85.4
2jnf_A158 Troponin C; stretch activated muscle contraction, 85.37
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 85.18
3fwb_A161 Cell division control protein 31; gene gating, com 85.18
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 85.15
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 85.08
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 85.07
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 84.58
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 84.5
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 84.34
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 84.33
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 84.14
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 84.1
1qjt_A99 EH1, epidermal growth factor receptor substrate su 83.65
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 83.46
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 83.27
1exr_A148 Calmodulin; high resolution, disorder, metal trans 83.23
3fwb_A161 Cell division control protein 31; gene gating, com 83.14
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 83.06
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 82.92
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 82.58
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 82.55
2jnf_A158 Troponin C; stretch activated muscle contraction, 82.36
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 82.15
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 82.03
1exr_A148 Calmodulin; high resolution, disorder, metal trans 81.98
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 81.93
3a4u_B143 Multiple coagulation factor deficiency protein 2; 81.67
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 81.44
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 81.38
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 81.3
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 81.18
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 81.16
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 81.16
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 81.15
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 80.93
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 80.87
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 80.83
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 80.75
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 80.63
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 80.59
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 80.41
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 80.37
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 80.33
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.91  E-value=4.1e-25  Score=177.27  Aligned_cols=95  Identities=21%  Similarity=0.385  Sum_probs=76.9

Q ss_pred             CcceecCcccCCCCCCchhhHHHHHHHHHHHHhCCCCCCCCCChHHHHHHhhhcc-CCCCCCccccHHHHHHHHHhcccC
Q psy14555          1 MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHK-MHPEIPAELSDKAKQFILRCFEKD   79 (222)
Q Consensus         1 t~~y~aPe~~~~~~y~~~~DiWS~Gvil~ell~g~~Pf~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~li~~~l~~~   79 (222)
                      |+.|||||++. +.|+.++||||+||++|||++|++||.+.... ..+....... .+...+...++++++|+.+||..|
T Consensus       193 Tp~YmAPE~~~-~~y~~~~DiwSlGvilyelltg~~Pf~~~~~~-~~~~~~i~~~~~~~~~~~~~~~~~~~li~~~L~~d  270 (290)
T 3fpq_A          193 TPEFMAPEMYE-EKYDESVDVYAFGMCMLEMATSEYPYSECQNA-AQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQN  270 (290)
T ss_dssp             SCCCCCGGGGG-TCCCTHHHHHHHHHHHHHHHHSSCTTTTCSSH-HHHHHHHTTTCCCGGGGGCCCHHHHHHHHHHSCSS
T ss_pred             CccccCHHHcC-CCCCcHHHHHHHHHHHHHHHHCCCCCCCCCcH-HHHHHHHHcCCCCCCCCccCCHHHHHHHHHHccCC
Confidence            88999999876 46999999999999999999999999754333 3333333332 233445667899999999999999


Q ss_pred             CCCCCChhhhhcCccccc
Q psy14555         80 PDKRATAGELLEDPFLAD   97 (222)
Q Consensus        80 p~~R~s~~~~l~h~~~~~   97 (222)
                      |.+|||++++++||||++
T Consensus       271 P~~R~s~~e~l~Hp~~~~  288 (290)
T 3fpq_A          271 KDERYSIKDLLNHAFFQE  288 (290)
T ss_dssp             GGGSCCHHHHHTSGGGC-
T ss_pred             hhHCcCHHHHhcCccccC
Confidence            999999999999999975



>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-22
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-22
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 8e-22
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-21
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-21
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 6e-21
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 9e-21
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-20
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-20
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 8e-20
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-19
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-19
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-19
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-19
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-19
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-18
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-18
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 7e-18
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-17
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-17
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-17
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-17
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-17
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-17
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-16
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-16
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-16
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-16
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 6e-16
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 7e-16
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-15
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-15
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-15
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-15
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 7e-15
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-14
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-14
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-14
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-14
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-14
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-14
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-14
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-14
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-14
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-14
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 4e-14
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-14
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 6e-14
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-14
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-13
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-13
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-13
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-13
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-13
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 9e-13
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-12
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 5e-12
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-11
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-11
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-11
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-11
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 6e-10
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase wnk1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 90.4 bits (224), Expect = 1e-22
 Identities = 19/85 (22%), Positives = 34/85 (40%)

Query: 11  VNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHKMHPEIPAELSDKAKQ 70
               Y    D+++ G  ++EMAT + P+ E  +      RV               + K+
Sbjct: 185 YEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKE 244

Query: 71  FILRCFEKDPDKRATAGELLEDPFL 95
            I  C  ++ D+R +  +LL   F 
Sbjct: 245 IIEGCIRQNKDERYSIKDLLNHAFF 269


>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.9
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.89
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.89
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.89
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.89
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.89
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.88
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.88
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.88
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.88
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.88
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.88
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.88
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.88
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.87
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.86
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.86
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.86
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.85
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.84
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.84
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.83
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.82
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.82
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.82
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.81
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.81
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.81
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.8
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.8
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.8
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.79
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.79
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.79
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.79
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.79
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.79
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.79
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.78
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.78
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.78
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.78
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.78
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.77
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.77
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.77
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.77
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.77
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.76
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.76
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.76
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.75
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.75
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.75
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.72
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.72
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.72
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.67
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.6
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.58
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 96.11
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 95.63
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.38
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.29
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 95.22
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 95.16
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 95.08
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 94.92
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.85
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 94.84
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 94.53
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 94.41
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 94.2
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 93.99
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 93.92
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.88
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 93.87
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 93.73
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 93.63
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 93.46
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.44
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 93.42
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 93.35
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 93.07
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 93.04
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 92.78
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 92.77
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 92.64
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 92.44
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 92.43
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 92.01
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 91.84
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 91.39
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 91.09
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 90.37
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 90.29
d1jbaa_ 189 Guanylate cyclase activating protein 2, GCAP-2 {Co 90.11
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 89.72
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 89.57
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 88.75
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 88.44
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 88.29
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 87.62
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 86.95
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 86.76
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 85.72
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 85.63
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 85.5
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 83.85
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 83.82
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 81.87
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 81.73
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 80.97
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 80.92
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 80.81
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase wnk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=2.5e-24  Score=169.48  Aligned_cols=94  Identities=21%  Similarity=0.382  Sum_probs=76.3

Q ss_pred             CcceecCcccCCCCCCchhhHHHHHHHHHHHHhCCCCCCCCCChHHHHHHhhhcc-CCCCCCccccHHHHHHHHHhcccC
Q psy14555          1 MNVIFLTQYSVNSSYSPQADIWSLGCTIVEMATGKPPFIELGSPQAALYRVGFHK-MHPEIPAELSDKAKQFILRCFEKD   79 (222)
Q Consensus         1 t~~y~aPe~~~~~~y~~~~DiWS~Gvil~ell~g~~Pf~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~li~~~l~~~   79 (222)
                      |+.|||||++.+ .|+.++||||+||++|||++|+.||.+.... ..+....... .+...+...++++++|+.+||..+
T Consensus       176 T~~Y~aPE~~~~-~~~~~~DIwSlGvilyel~~g~~Pf~~~~~~-~~~~~~i~~~~~~~~~~~~~~~~~~~li~~~l~~d  253 (270)
T d1t4ha_         176 TPEFMAPEMYEE-KYDESVDVYAFGMCMLEMATSEYPYSECQNA-AQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQN  253 (270)
T ss_dssp             SCCCCCGGGGGT-CCCTHHHHHHHHHHHHHHHHSSCTTTTCSSH-HHHHHHHTTTCCCGGGGGCCCHHHHHHHHHHSCSS
T ss_pred             CccccCHHHhCC-CCCCcCchhhHHHHHHHHHHCCCCCCCcccH-HHHHHHHHcCCCCcccCccCCHHHHHHHHHHccCC
Confidence            789999998765 6999999999999999999999999754333 3333332222 223345667899999999999999


Q ss_pred             CCCCCChhhhhcCcccc
Q psy14555         80 PDKRATAGELLEDPFLA   96 (222)
Q Consensus        80 p~~R~s~~~~l~h~~~~   96 (222)
                      |.+|||++++++||||+
T Consensus       254 p~~R~s~~ell~Hp~fk  270 (270)
T d1t4ha_         254 KDERYSIKDLLNHAFFQ  270 (270)
T ss_dssp             GGGSCCHHHHHTSGGGC
T ss_pred             HhHCcCHHHHhCCcccC
Confidence            99999999999999995



>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure