Diaphorina citri psyllid: psy14578

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MFKNAYQGRFISIFYSIGSKPLSLWDTDVHNGYIRRITDYDLNSLALEIISTTVMNTYITCPNYRFKSLGIKLPYLCLIIKNLNKHFSFEVQIIDSKNTKRRIRFSNYHSCSKINPFIVTFPICLNEGWNEVRIDLQDFVYKSYKTLYLETLQIKMHANCRLRRIFFADKLYDSKDIPAEYKLFRKEDQLATSKIMDEFPYPPSYLGENEDMNEDEMGQGDFFNENLMPKYSADFLEMPAGGEDGGNENQENPEPDAAGGDDNEDQGDEP
ccccccccccEEEEEccccccccccccccccccEEEEEcccccEEEEEEEEccccCEEEEccccccccccEEccEEEEEEEEccccEEEEEEEEcccccEEEEEEEEcEEEEEEcccEEEEcccccccCEEEEEEHHHHHHHHHccccEEEEEEEEEccEEEEEEEEccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MFKNAYQGRFISIFYSIGSKPLSLWDTDVHNGYIRRITDYDLNSLALEIISTTVMNTYITCPNYRFKSLGIKLPYLCLIIKNLNKHFSFEVQIIDSKNTKRRIRFSNYHSCSKINPFIVTFPICLNEGWNEVRIDLQDFVYKSYKTLYLETLQIKMHANCRLRRIFFADKLYDSKDIPAEYKLFRKEDQL********************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKNAYQGRFISIFYSIGSKPLSLWDTDVHNGYIRRITDYDLNSLALEIISTTVMNTYITCPNYRFKSLGIKLPYLCLIIKNLNKHFSFEVQIIDSKNTKRRIRFSNYHSCSKINPFIVTFPICLNEGWNEVRIDLQDFVYKSYKTLYLETLQIKMHANCRLRRIFFADKLYDSKDIPAEYKLFRKEDQLATSKIMDEFPYPPSYLGENEDMNEDEMGQGDFFNENLMPKYSADFLEMPAGGEDGGNENQENPEPDAAGGDDNEDQGDEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UPF0468 protein C16orf80 homolog confidentQ86D25
UPF0468 protein C16orf80 homolog confidentQ8BTU1
UPF0468 protein C16orf80 homolog confidentQ6B857

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted