Diaphorina citri psyllid: psy14581


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MAKNERCYSEIKYDGERVQVHKKGNEFKYFSRSLKPVLEHKAQPVWEISGAEFSQAEIHTADGISIRFPRVTKIRDDKDWKTATNLPELKVLFKKSKETSDFTLKPKYDRIKNLKLQKARCISY
cccccHHHHHHHHcccccEEccccccccccccccccccccccccEEEEEccccccccccccccEEEEccccEEEcccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccc
*****RCYSEIKYDGERVQVHKKGNEFKYFSRSLKPVLEHKAQPVWEISGAEFSQAEIHTADGISIRFPRVTKIRDDKDWKTATNLPELKVLFK*************YDRI*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNERCYSEIKYDGERVQVHKKGNEFKYFSRSLKPVLEHKAQPVWEISGAEFSQAEIHTADGISIRFPRVTKIRDDKDWKTATNLPELKVLFKKSKETSDFTLKPKYDRIKNLKLQKARCISY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA ligase 3 Interacts with DNA-repair protein XRCC1 and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.confidentP49916
DNA ligase 3 The alpha isoform interacts with DNA-repair protein XRCC1 and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents. The beta isoform does not interact with XRCC1 and may be specifically involved in the completion of homologous recombination events that occur during meiotic prophase.confidentP97386

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033151 [BP]V(D)J recombinationprobableGO:0090304, GO:0034641, GO:0006807, GO:0007275, GO:0044699, GO:0006139, GO:0044260, GO:0071704, GO:1901360, GO:0002200, GO:0046483, GO:0032502, GO:0032501, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0002520, GO:0006310, GO:0002562, GO:0044707, GO:0048856, GO:0044237, GO:0043170, GO:0002376, GO:0006259, GO:0048731, GO:0016444
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005488 [MF]bindingprobableGO:0003674
GO:0000795 [CC]synaptonemal complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003909 [MF]DNA ligase activityprobableGO:0003824, GO:0003674, GO:0016874, GO:0016886
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L2P, chain A
Confidence level:very confident
Coverage over the Query: 43-97
View the alignment between query and template
View the model in PyMOL
Template: 3L2P, chain A
Confidence level:very confident
Coverage over the Query: 5-69
View the alignment between query and template
View the model in PyMOL