Query         psy14591
Match_columns 164
No_of_seqs    123 out of 150
Neff          2.6 
Searched_HMMs 46136
Date          Fri Aug 16 23:50:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14591.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14591hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06371 Drf_GBD:  Diaphanous G  99.4 8.7E-14 1.9E-18  104.9   2.5   53  111-163   127-179 (187)
  2 KOG1924|consensus               98.6   7E-09 1.5E-13  101.1   0.3   51  113-163   205-255 (1102)
  3 PF11081 DUF2890:  Protein of u  71.7      10 0.00022   32.1   5.3   22  116-137   124-145 (187)
  4 PF09026 CENP-B_dimeris:  Centr  56.2     3.7 8.1E-05   32.0   0.0   14   83-96     46-59  (101)
  5 PF09026 CENP-B_dimeris:  Centr  52.1     4.8  0.0001   31.4   0.0    6   63-68     37-42  (101)
  6 KOG1572|consensus               49.7     6.1 0.00013   34.8   0.3   59   72-141   126-184 (249)
  7 KOG2963|consensus               46.2      39 0.00084   31.7   4.8   10   43-52    366-375 (405)
  8 KOG0329|consensus               36.7      11 0.00025   34.5  -0.0   51   69-122    23-74  (387)
  9 PF06375 BLVR:  Bovine leukaemi  30.2      17 0.00037   29.7   0.0   22   24-45     79-100 (154)
 10 PF08389 Xpo1:  Exportin 1-like  28.8 1.2E+02  0.0026   21.4   4.2   42  114-157   100-141 (148)
 11 KOG1999|consensus               25.4      21 0.00046   36.9  -0.3   34   31-64     57-90  (1024)
 12 PF10621 FpoO:  F420H2 dehydrog  24.9      58  0.0013   26.1   2.1   23  105-127    79-101 (119)
 13 PF14812 PBP1_TM:  Transmembran  24.7      25 0.00053   26.3   0.0    7   62-68     48-54  (81)
 14 cd00020 ARM Armadillo/beta-cat  23.9      54  0.0012   21.8   1.6   46  115-161    22-68  (120)
 15 KOG2963|consensus               23.3 1.8E+02   0.004   27.4   5.3   24   34-57    360-383 (405)
 16 PF10508 Proteasom_PSMB:  Prote  22.6      61  0.0013   29.7   2.1   47  114-163    52-98  (503)
 17 TIGR00927 2A1904 K+-dependent   22.1      41 0.00088   35.2   0.9   27   39-65    853-879 (1096)
 18 PRK04019 rplP0 acidic ribosoma  21.3      30 0.00065   30.3  -0.1   21   47-67    302-322 (330)
 19 TIGR02571 ComEB ComE operon pr  21.0      22 0.00047   28.2  -1.0   17  120-138    97-113 (151)
 20 cd00786 cytidine_deaminase-lik  20.8      28  0.0006   24.7  -0.4   16  120-137    76-91  (96)

No 1  
>PF06371 Drf_GBD:  Diaphanous GTPase-binding Domain;  InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division []. Drf proteins are characterised by a variety of shared domains: an N-terminal GTPase-binding domain (GBD), formin-homology domains FH1, FH2 (IPR003104 from INTERPRO) and FH3 (IPR010472 from INTERPRO), and a C-terminal conserved Dia-autoregulatory domain (DAD) that binds the GBD. This entry represents the GBD, which is a bifunctional autoinhibitory domain that interacts with and is regulated by activated Rho family members. Mammalian Drf3 contains a CRIB-like motif within its GBD for binding to Cdc42, which is required for Cdc42 to activate and guide Drf3 towards the cell cortex where it remodels the actin skeleton [].; GO: 0003779 actin binding, 0017048 Rho GTPase binding, 0030036 actin cytoskeleton organization; PDB: 3OBV_A 2BNX_A 3EG5_D 2BAP_B 3O4X_B 1Z2C_B 2F31_A.
Probab=99.41  E-value=8.7e-14  Score=104.90  Aligned_cols=53  Identities=38%  Similarity=0.689  Sum_probs=47.8

Q ss_pred             CCCCcchHHHHHHHHHHhccHHhHHHHhcchhHHHHHHHHhcCCCcceeeccc
Q psy14591        111 GDPKDDIHVCILCLRAIMNNKYGLNMVIKHTEAINSIALSLMHKSLRATLFDF  163 (164)
Q Consensus       111 ~s~kd~qHeCIrCLKAIMNNKyGl~~VLsH~eaIn~IAlSLds~NprTKaLVL  163 (164)
                      ..+.+.+|+|++|||||||+++|+..|+.|+.+|..|+.||++++++||.+|+
T Consensus       127 ~~~~~~~~~~l~Clkal~n~~~G~~~v~~~~~~v~~i~~~L~s~~~~~r~~~l  179 (187)
T PF06371_consen  127 EEDIDIEHECLRCLKALMNTKYGLEAVLSHPDSVNLIALSLDSPNIKTRKLAL  179 (187)
T ss_dssp             TTCHHHHHHHHHHHHHHTSSHHHHHHHHCSSSHHHHHHHT--TTSHHHHHHHH
T ss_pred             chhHHHHHHHHHHHHHHHccHHHHHHHHcCcHHHHHHHHHHCCCCHHHHHHHH
Confidence            45567899999999999999999999999999999999999999999999885


No 2  
>KOG1924|consensus
Probab=98.62  E-value=7e-09  Score=101.12  Aligned_cols=51  Identities=25%  Similarity=0.389  Sum_probs=47.7

Q ss_pred             CCcchHHHHHHHHHHhccHHhHHHHhcchhHHHHHHHHhcCCCcceeeccc
Q psy14591        113 PKDDIHVCILCLRAIMNNKYGLNMVIKHTEAINSIALSLMHKSLRATLFDF  163 (164)
Q Consensus       113 ~kd~qHeCIrCLKAIMNNKyGl~~VLsH~eaIn~IAlSLds~NprTKaLVL  163 (164)
                      ..+.+|++|+||||||||+||+..||...+++.++|++||+..|.+++-|+
T Consensus       205 ~~k~~~eiIrClka~mNn~~Gl~~vL~~e~~lllla~aldpr~pnmm~dvv  255 (1102)
T KOG1924|consen  205 DIKNLQEIIRCLKAFMNNKFGLVLVLRRERSLLLLARALDPREPNMMTDVV  255 (1102)
T ss_pred             HHHHHHHHHHHHHHHhccccceeeeecCCccHHHHHHhcCccCccHHHHHH
Confidence            788999999999999999999999999999999999999999999887553


No 3  
>PF11081 DUF2890:  Protein of unknown function (DUF2890);  InterPro: IPR021304  This entry contains the 33kDa and 22kDa phosphoproteins from vertebrate adenoviruses.
Probab=71.65  E-value=10  Score=32.07  Aligned_cols=22  Identities=18%  Similarity=0.024  Sum_probs=14.7

Q ss_pred             chHHHHHHHHHHhccHHhHHHH
Q psy14591        116 DIHVCILCLRAIMNNKYGLNMV  137 (164)
Q Consensus       116 ~qHeCIrCLKAIMNNKyGl~~V  137 (164)
                      .-+.|+-||-||.-..-|-...
T Consensus       124 lR~~I~~tLyaifqqsrG~~~~  145 (187)
T PF11081_consen  124 LRNRIFPTLYAIFQQSRGNEQE  145 (187)
T ss_pred             HHHHHHHHHHHHHHHhcCCccc
Confidence            3355999999997665554333


No 4  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=56.18  E-value=3.7  Score=31.95  Aligned_cols=14  Identities=7%  Similarity=0.173  Sum_probs=6.0

Q ss_pred             cCCCCCcccccccc
Q psy14591         83 LGHQRPSLDLASSP   96 (164)
Q Consensus        83 ~~~~~~~~d~~lt~   96 (164)
                      ++.+...++.+.+|
T Consensus        46 fgea~~~~~~v~rY   59 (101)
T PF09026_consen   46 FGEAMAYFTMVKRY   59 (101)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHhhcchHhhh
Confidence            44444444444333


No 5  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=52.09  E-value=4.8  Score=31.38  Aligned_cols=6  Identities=50%  Similarity=1.027  Sum_probs=0.0

Q ss_pred             HhhCCC
Q psy14591         63 EEEGLP   68 (164)
Q Consensus        63 ~~~~~~   68 (164)
                      +++++|
T Consensus        37 e~de~p   42 (101)
T PF09026_consen   37 EEDEVP   42 (101)
T ss_dssp             ------
T ss_pred             cccccc
Confidence            334444


No 6  
>KOG1572|consensus
Probab=49.73  E-value=6.1  Score=34.81  Aligned_cols=59  Identities=20%  Similarity=0.279  Sum_probs=40.6

Q ss_pred             CCCCcccCCCCcCCCCCccccccccccccccccccccccCCCCcchHHHHHHHHHHhccHHhHHHHhcch
Q psy14591         72 NPPANVISPQSLGHQRPSLDLASSPSVKKRSRHAARLNMGDPKDDIHVCILCLRAIMNNKYGLNMVIKHT  141 (164)
Q Consensus        72 ~~~~~~~~~~~~~~~~~~~d~~lt~~l~~rrr~i~k~~~~s~kd~qHeCIrCLKAIMNNKyGl~~VLsH~  141 (164)
                      +|+.|...-....++.--||..--|.|+++++.         +-+.-..|.|||.|||  |-+..||+..
T Consensus       126 ~P~~~~~~~~i~~~l~~lld~~N~P~Lihc~rG---------khRtg~lVgclRklq~--W~lssil~Ey  184 (249)
T KOG1572|consen  126 EPFVNIPDHSIRKALKVLLDKRNYPILIHCKRG---------KHRTGCLVGCLRKLQN--WSLSSILDEY  184 (249)
T ss_pred             CCCCCChHHHHHHHHHHHhcccCCceEEecCCC---------CcchhhhHHHHHHHhc--cchhHHHHHH
Confidence            777766655555566666676667777776653         2344568999999999  7777777653


No 7  
>KOG2963|consensus
Probab=46.24  E-value=39  Score=31.75  Aligned_cols=10  Identities=50%  Similarity=1.049  Sum_probs=4.0

Q ss_pred             CcccccccCC
Q psy14591         43 GGERTEEEGG   52 (164)
Q Consensus        43 ~~~~~~~~~~   52 (164)
                      ||+..+.+|+
T Consensus       366 G~~~s~~~~~  375 (405)
T KOG2963|consen  366 GGEGSEKDGD  375 (405)
T ss_pred             cccccCcCCC
Confidence            3333344444


No 8  
>KOG0329|consensus
Probab=36.72  E-value=11  Score=34.54  Aligned_cols=51  Identities=16%  Similarity=0.269  Sum_probs=31.8

Q ss_pred             CCCCCCCcccCCCCcCCCCCcc-ccccccccccccccccccccCCCCcchHHHHH
Q psy14591         69 ASTNPPANVISPQSLGHQRPSL-DLASSPSVKKRSRHAARLNMGDPKDDIHVCIL  122 (164)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~-d~~lt~~l~~rrr~i~k~~~~s~kd~qHeCIr  122 (164)
                      ..++||++..--.-.+.-++.+ |.++.|-+.   |++.-.-+.-....||+||-
T Consensus        23 ~~~~~~~~d~kgsyv~ihssgfrdfllkpell---raivdcgfehpsevqhecip   74 (387)
T KOG0329|consen   23 SAPAGPKKDKKGSYVSIHSSGFRDFLLKPELL---RAIVDCGFEHPSEVQHECIP   74 (387)
T ss_pred             CCCCCccccccCcEEEEeccchhhhhcCHHHH---HHHHhccCCCchHhhhhhhh
Confidence            4556777655544444445555 776666665   45555566667788999884


No 9  
>PF06375 BLVR:  Bovine leukaemia virus receptor (BLVR);  InterPro: IPR010474  Bovine leukemia virus (BLV) is one of the most common infectious cattle viruses, with between 30 and 40% of cows in the United States being infected. It is closely related to the human T-cell leukaemia virus type 1 (HTLV-1) and has highly conserved envelope glycoprotein functional domains []. BLV is an oncogenic C-type retrovirus, which results in the animals developing a malignant lymphoma. BLV, like the human and simian T cell leukaemia viruses, is a deltaretrovirus. 182 residues at the amino-terminal of the BLV envelope glycoprotein surface unit encompass the receptor-binding domain. The metabolic activity in B cells, T cells, and thymocytes is indicated by the expression of the BLV-binding receptor []. A candidate gene of the receptor (BLVR) is related, but unique, to a gene family of the delta subunit of the adaptor protein (AP) complex 3, AP-3 []. The AP-3 complex is not clathrin-associated but is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. ; PDB: 4AFI_B.
Probab=30.18  E-value=17  Score=29.65  Aligned_cols=22  Identities=32%  Similarity=0.515  Sum_probs=0.0

Q ss_pred             hhhHHHHHHHhhhhhcCCCCcc
Q psy14591         24 QRKKAEEKKKKKRRAEGRGGGE   45 (164)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~   45 (164)
                      +.++...||+||....+..++.
T Consensus        79 ~~~~k~kKK~KKkkKkkKk~~k  100 (154)
T PF06375_consen   79 QKSKKKKKKKKKKKKKKKKSKK  100 (154)
T ss_dssp             ----------------------
T ss_pred             hhhhhhhhhccchhcccccCCC
Confidence            3333333443333333444444


No 10 
>PF08389 Xpo1:  Exportin 1-like protein;  InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane. Active transport of large molecules through these pore complexes require carrier proteins, called karyopherins (importins and exportins), which shuttle between the two compartments. This domain is found close to the N terminus of yeast exportin 1 (Xpo1, Crm1, P14068 from SWISSPROT), as well as adjacent to the N-terminal domain of importin-beta (IPR001494 from INTERPRO). Exportin 1 is a nuclear export receptor that translocates proteins out of the nucleus; it interacts with leucine-rich nuclear export signal (NES) sequences in proteins to be transported, as well as with RanGTP [, ]. Importin-beta is a nuclear import receptor that translocates proteins into the nucleus; it interacts with RanGTP and importin-alpha, the latter binding with the nuclear localisation signal (NLS) sequences in proteins to be transported []. More information about these proteins can be found at Protein of the Month: Importins [].; PDB: 3IBV_A 3ICQ_U 3M1I_C 3NC1_A 3NBY_D 3NBZ_D 3NC0_A 3GJX_D 2XWU_B 2X19_B ....
Probab=28.81  E-value=1.2e+02  Score=21.44  Aligned_cols=42  Identities=19%  Similarity=0.375  Sum_probs=31.4

Q ss_pred             CcchHHHHHHHHHHhccHHhHHHHhcchhHHHHHHHHhcCCCcc
Q psy14591        114 KDDIHVCILCLRAIMNNKYGLNMVIKHTEAINSIALSLMHKSLR  157 (164)
Q Consensus       114 kd~qHeCIrCLKAIMNNKyGl~~VLsH~eaIn~IAlSLds~Npr  157 (164)
                      ......++.|+++++. -.....+++++ -++.+...|.+++.+
T Consensus       100 ~~~~~~~L~~l~s~i~-~~~~~~i~~~~-~l~~~~~~l~~~~~~  141 (148)
T PF08389_consen  100 EELVKAALKCLKSWIS-WIPIELIINSN-LLNLIFQLLQSPELR  141 (148)
T ss_dssp             HHHHHHHHHHHHHHTT-TS-HHHHHSSS-HHHHHHHHTTSCCCH
T ss_pred             HHHHHHHHHHHHHHHH-hCCHHHhccHH-HHHHHHHHcCCHHHH
Confidence            4456679999999998 45777777755 889999988666653


No 11 
>KOG1999|consensus
Probab=25.42  E-value=21  Score=36.87  Aligned_cols=34  Identities=29%  Similarity=0.477  Sum_probs=19.1

Q ss_pred             HHHhhhhhcCCCCcccccccCCchhhhhhHHHHh
Q psy14591         31 KKKKKRRAEGRGGGERTEEEGGEEEEEEEEEEEE   64 (164)
Q Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   64 (164)
                      +|.||-+..|+-++++..+...+++++++|.|++
T Consensus        57 ~~~k~~s~~gf~~~e~dvDdeveddd~~~edEed   90 (1024)
T KOG1999|consen   57 EKDKKESGGGFIDREADVDDEVEDDDDDEEDEED   90 (1024)
T ss_pred             hhccccccccccccccccccccccccchhccCcc
Confidence            3445566667777777655555555444444443


No 12 
>PF10621 FpoO:  F420H2 dehydrogenase subunit FpoO ;  InterPro: IPR018288 This entry represents the FpoO subunit of membrane-bound multi-subunit F420H2 dehydrogenase, which oxidises the reduced coenzyme F420H2 to coenzyme F420 and feeds the electrons via an FeS cluster into an energy-conserving electron transport chain [, ]. This enzyme plays a role in the methanogenic pathway in methanogenic archaea. Reduced coenzyme F420H2 is the major cytoplasmic electron carrier of methanogens and a reversible hydride donor, much like NADH []. F420H2 + COB-S-S-CoM = F420 + CoM-SH + CoB-SH  Where CoB-S-S-CoM (the heterosulphide of 2-mercaptoethanesulphonate and 7-mercaptoheptanoylthreonine phosphate) is the terminal electron acceptor of the methanogenic pathway, and is reduced with the concomitant generation of a transmembrane proton potential and ATP synthesis.  The FpoO subunit of F420H2 dehydrogenase probably participates in the reduction of methanophenazine, where it acts as a special mechanism for the reduction of the methanogenic cofactor []. 
Probab=24.95  E-value=58  Score=26.12  Aligned_cols=23  Identities=35%  Similarity=0.717  Sum_probs=18.4

Q ss_pred             ccccccCCCCcchHHHHHHHHHH
Q psy14591        105 AARLNMGDPKDDIHVCILCLRAI  127 (164)
Q Consensus       105 i~k~~~~s~kd~qHeCIrCLKAI  127 (164)
                      |+..+-++..++.|.|-+||.|.
T Consensus        79 IPsFskg~~~~~~~lC~~CLe~~  101 (119)
T PF10621_consen   79 IPSFSKGSVKKDVHLCRRCLEAC  101 (119)
T ss_pred             cCCcccccchhHHHHHHHHHHHH
Confidence            34456677889999999999995


No 13 
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=24.71  E-value=25  Score=26.26  Aligned_cols=7  Identities=71%  Similarity=1.104  Sum_probs=0.0

Q ss_pred             HHhhCCC
Q psy14591         62 EEEEGLP   68 (164)
Q Consensus        62 ~~~~~~~   68 (164)
                      |||+-.|
T Consensus        48 eeee~m~   54 (81)
T PF14812_consen   48 EEEEPMP   54 (81)
T ss_dssp             -------
T ss_pred             hhccccc
Confidence            3444333


No 14 
>cd00020 ARM Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.
Probab=23.91  E-value=54  Score=21.76  Aligned_cols=46  Identities=7%  Similarity=0.070  Sum_probs=32.6

Q ss_pred             cchHHHHHHHHHHhcc-HHhHHHHhcchhHHHHHHHHhcCCCcceeec
Q psy14591        115 DDIHVCILCLRAIMNN-KYGLNMVIKHTEAINSIALSLMHKSLRATLF  161 (164)
Q Consensus       115 d~qHeCIrCLKAIMNN-KyGl~~VLsH~eaIn~IAlSLds~NprTKaL  161 (164)
                      +....++.||..+.-+ ......++. ..++..|...|.+++++++..
T Consensus        22 ~~~~~a~~~l~~l~~~~~~~~~~~~~-~~~i~~l~~~l~~~~~~v~~~   68 (120)
T cd00020          22 NVQREAAWALSNLSAGNNDNIQAVVE-AGGLPALVQLLKSEDEEVVKA   68 (120)
T ss_pred             HHHHHHHHHHHHHhcCCHHHHHHHHH-CCChHHHHHHHhCCCHHHHHH
Confidence            4456688888887655 455666655 478899999999888776543


No 15 
>KOG2963|consensus
Probab=23.34  E-value=1.8e+02  Score=27.44  Aligned_cols=24  Identities=42%  Similarity=0.688  Sum_probs=17.2

Q ss_pred             hhhhhcCCCCcccccccCCchhhh
Q psy14591         34 KKRRAEGRGGGERTEEEGGEEEEE   57 (164)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~~~~~~~   57 (164)
                      .+++|+|..|.+...+.++|+.++
T Consensus       360 e~~a~eG~~~s~~~~~~~de~~~~  383 (405)
T KOG2963|consen  360 EKRAAEGGEGSEKDGDMGDEDSSE  383 (405)
T ss_pred             HHHHhhcccccCcCCCcccccchh
Confidence            345778887777777777777666


No 16 
>PF10508 Proteasom_PSMB:  Proteasome non-ATPase 26S subunit;  InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells. 26S proteasome non-ATPase regulatory subunit 5 is one of a number of chaperones that are involved in the assembly of the proteasome. The chaperones dissociate before 26S proteasome formation is complete [].; GO: 0044183 protein binding involved in protein folding
Probab=22.60  E-value=61  Score=29.67  Aligned_cols=47  Identities=9%  Similarity=0.118  Sum_probs=37.3

Q ss_pred             CcchHHHHHHHHHHhccHHhHHHHhcchhHHHHHHHHhcCCCcceeeccc
Q psy14591        114 KDDIHVCILCLRAIMNNKYGLNMVIKHTEAINSIALSLMHKSLRATLFDF  163 (164)
Q Consensus       114 kd~qHeCIrCLKAIMNNKyGl~~VLsH~eaIn~IAlSLds~NprTKaLVL  163 (164)
                      .+..-.|+.||+-+|...++-..   -++....|...|.++++.+|.+++
T Consensus        52 ~e~v~~~~~iL~~~l~~~~~~~l---~~~~~~~L~~gL~h~~~~Vr~l~l   98 (503)
T PF10508_consen   52 REQVELICDILKRLLSALSPDSL---LPQYQPFLQRGLTHPSPKVRRLAL   98 (503)
T ss_pred             hHHHHHHHHHHHHHHhccCHHHH---HHHHHHHHHHHhcCCCHHHHHHHH
Confidence            34455588999999998877766   455678899999999999998864


No 17 
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=22.14  E-value=41  Score=35.16  Aligned_cols=27  Identities=63%  Similarity=0.916  Sum_probs=0.0

Q ss_pred             cCCCCcccccccCCchhhhhhHHHHhh
Q psy14591         39 EGRGGGERTEEEGGEEEEEEEEEEEEE   65 (164)
Q Consensus        39 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   65 (164)
                      +|++||.--+.|..++++||||+|||+
T Consensus       853 ~~~~~~d~~dse~~~~~~~~~e~~~~e  879 (1096)
T TIGR00927       853 DGGGGSDGGDSEEEEEEEEEEEEEEEE  879 (1096)
T ss_pred             cccCCCCcccccccccccchhhhcccc


No 18 
>PRK04019 rplP0 acidic ribosomal protein P0; Validated
Probab=21.31  E-value=30  Score=30.34  Aligned_cols=21  Identities=67%  Similarity=0.757  Sum_probs=0.0

Q ss_pred             ccccCCchhhhhhHHHHhhCC
Q psy14591         47 TEEEGGEEEEEEEEEEEEEGL   67 (164)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~   67 (164)
                      .+++..++|||+++++||++.
T Consensus       302 ~~~~~~~~~ee~~~~~ee~~~  322 (330)
T PRK04019        302 EEEEEEEEEEEEEEPSEEEAA  322 (330)
T ss_pred             ccccchhhhhhhcccchhhhh


No 19 
>TIGR02571 ComEB ComE operon protein 2. This protein is found in the ComE operon for "late competence" as characterized in B. subtilis. Proteins in this family contain homology to a cytidine/deoxycytidine deaminase domain family (pfam00383), and may carry out this activity.
Probab=20.97  E-value=22  Score=28.16  Aligned_cols=17  Identities=24%  Similarity=0.841  Sum_probs=14.4

Q ss_pred             HHHHHHHHhccHHhHHHHh
Q psy14591        120 CILCLRAIMNNKYGLNMVI  138 (164)
Q Consensus       120 CIrCLKAIMNNKyGl~~VL  138 (164)
                      |.+|.+||.+  .|+..|.
T Consensus        97 C~~Ca~ai~~--agI~~Vv  113 (151)
T TIGR02571        97 CLQCTKSIIQ--AGIKKIY  113 (151)
T ss_pred             cHHHHHHHHH--hCCCEEE
Confidence            9999999997  5777765


No 20 
>cd00786 cytidine_deaminase-like Cytidine and deoxycytidylate deaminase zinc-binding region. The family contains cytidine deaminases, nucleoside deaminases, deoxycytidylate deaminases and riboflavin deaminases. Also included are the apoBec family of mRNA editing enzymes.  All members are Zn dependent. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate.
Probab=20.85  E-value=28  Score=24.73  Aligned_cols=16  Identities=31%  Similarity=0.654  Sum_probs=12.2

Q ss_pred             HHHHHHHHhccHHhHHHH
Q psy14591        120 CILCLRAIMNNKYGLNMV  137 (164)
Q Consensus       120 CIrCLKAIMNNKyGl~~V  137 (164)
                      |.+|..||...  |+..|
T Consensus        76 C~mC~~ai~~~--gi~~V   91 (96)
T cd00786          76 CGACAQLIIEL--GIKDV   91 (96)
T ss_pred             hHHHHHHHHHh--CCCCE
Confidence            99999999874  55443


Done!