Query psy14602
Match_columns 66
No_of_seqs 51 out of 53
Neff 3.4
Searched_HMMs 46136
Date Fri Aug 16 15:55:36 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy14602.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14602hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG3692|consensus 100.0 2.5E-31 5.5E-36 216.7 2.2 62 2-64 481-542 (881)
2 PF10220 DUF2146: Uncharacteri 100.0 1.3E-30 2.8E-35 214.3 2.0 62 3-65 487-548 (895)
3 PF10170 C6_DPF: Cysteine-rich 45.1 7 0.00015 25.7 -0.0 23 23-48 35-58 (97)
4 PRK02264 N(5),N(10)-methenylte 42.2 9.2 0.0002 29.8 0.2 15 25-39 263-279 (317)
5 COG5081 Predicted membrane pro 41.4 13 0.00029 27.0 0.9 22 22-43 89-113 (180)
6 cd00545 MCH Methenyltetrahydro 39.0 8.5 0.00018 29.9 -0.4 15 25-39 262-278 (312)
7 TIGR03120 one_C_mch methenylte 38.6 8.6 0.00019 29.9 -0.4 15 25-39 262-278 (312)
8 PF02289 MCH: Cyclohydrolase ( 36.2 14 0.00031 28.6 0.5 15 25-39 262-278 (313)
9 PF12088 DUF3565: Protein of u 31.7 24 0.00052 21.7 0.8 13 13-25 15-27 (61)
10 smart00704 ZnF_CDGSH CDGSH-typ 27.7 30 0.00065 18.9 0.7 12 10-21 14-25 (38)
11 COG3252 Methenyltetrahydrometh 26.8 21 0.00045 27.9 -0.1 17 23-39 260-278 (314)
12 PF15207 TMEM240: TMEM240 fami 23.5 49 0.0011 24.0 1.3 28 1-28 39-66 (180)
13 PF15044 CLU_N: Mitochondrial 22.5 37 0.00081 20.5 0.5 17 16-32 50-66 (76)
14 PF09360 zf-CDGSH: Iron-bindin 21.5 37 0.0008 18.4 0.3 13 8-20 17-29 (38)
No 1
>KOG3692|consensus
Probab=99.96 E-value=2.5e-31 Score=216.68 Aligned_cols=62 Identities=53% Similarity=1.075 Sum_probs=60.8
Q ss_pred CcCCCceeeeecccCccccccCCCCchhhhchHHHHcccceeccccceeeeeccccCCCCCcc
Q psy14602 2 EHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFR 64 (66)
Q Consensus 2 ~HsSg~~~~saCnCGR~q~~ReDPF~lk~AN~~FY~~~~~~C~C~~l~~i~Fpvf~ps~~d~~ 64 (66)
.|+||++++|||||||+|+.|+|||+||+|||||||+++++| |++||+|||||||||++|++
T Consensus 481 ~Hns~~~~is~CnCGRkQ~~R~dPF~ik~ANydFY~h~~~kC-C~kl~~yqFpvfeps~~D~~ 542 (881)
T KOG3692|consen 481 YHNSRARSISACNCGRKQAPRDDPFDIKAANYDFYQHLEEKC-CGKLDHYQFPVFEPSTPDPA 542 (881)
T ss_pred eccccceeeeeeccccccCCCCCCcchhhccchHHHhhHHHH-hhhHhhccccccCCCCCCcc
Confidence 699999999999999999999999999999999999999999 99999999999999999985
No 2
>PF10220 DUF2146: Uncharacterized conserved protein (DUF2146); InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex. They suppress Smg-1 kinase activity in the isolated Smg-1 complex, and are involved in nonsense-mediated mRNA decay (NMD) in both mammals and nematodes []. NMD is a surveillance mechanism that detects and degrades mRNAs containing premature translation termination codons.
Probab=99.96 E-value=1.3e-30 Score=214.31 Aligned_cols=62 Identities=63% Similarity=1.265 Sum_probs=60.6
Q ss_pred cCCCceeeeecccCccccccCCCCchhhhchHHHHcccceeccccceeeeeccccCCCCCccc
Q psy14602 3 HSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRC 65 (66)
Q Consensus 3 HsSg~~~~saCnCGR~q~~ReDPF~lk~AN~~FY~~~~~~C~C~~l~~i~Fpvf~ps~~d~~~ 65 (66)
|+||++++|||||||+|++|+|||+||+||++||++++++| |++|++|+|||||||++|++-
T Consensus 487 H~Sg~~~~saCnCGr~q~~R~DPF~l~~AN~~FY~~~~~~C-C~~l~~~~Fpvfqps~~d~~~ 548 (895)
T PF10220_consen 487 HSSGVRFLSACNCGRSQGLREDPFDLKEANYDFYQHLEFKC-CSKLERIQFPVFQPSTPDYRA 548 (895)
T ss_pred ccCCCceeeecCCCCccCCCCCCcCHHHHhHHHHHHHHHHH-HHHHhhcccceecCCCCchhh
Confidence 99999999999999999999999999999999999999999 999999999999999999863
No 3
>PF10170 C6_DPF: Cysteine-rich domain; InterPro: IPR018785 This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [, , ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed.
Probab=45.08 E-value=7 Score=25.75 Aligned_cols=23 Identities=35% Similarity=0.716 Sum_probs=18.4
Q ss_pred CCCCchhhhchHHHHcccceec-cccc
Q psy14602 23 EDPFSLREANYEFYQNVGVECG-CVAL 48 (66)
Q Consensus 23 eDPF~lk~AN~~FY~~~~~~C~-C~~l 48 (66)
-|||+ ++-+.|-.|...|+ |+++
T Consensus 35 rDPF~---~~~~~~LvLGa~CS~C~~~ 58 (97)
T PF10170_consen 35 RDPFS---PDKERFLVLGAPCSICGKP 58 (97)
T ss_pred eCCCC---CCCccEEEECccccccCCc
Confidence 48994 67888889999998 8764
No 4
>PRK02264 N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase; Provisional
Probab=42.23 E-value=9.2 Score=29.80 Aligned_cols=15 Identities=53% Similarity=1.074 Sum_probs=12.6
Q ss_pred CC--chhhhchHHHHcc
Q psy14602 25 PF--SLREANYEFYQNV 39 (66)
Q Consensus 25 PF--~lk~AN~~FY~~~ 39 (66)
|| .+|+||||||+.-
T Consensus 263 PF~eiFk~a~~DFykID 279 (317)
T PRK02264 263 PFAEIFKEANYDFYKID 279 (317)
T ss_pred cHHHHHHHcCCChhhCC
Confidence 66 5799999999874
No 5
>COG5081 Predicted membrane protein [Function unknown]
Probab=41.41 E-value=13 Score=26.97 Aligned_cols=22 Identities=18% Similarity=0.474 Sum_probs=18.6
Q ss_pred cCCCCchh---hhchHHHHccccee
Q psy14602 22 REDPFSLR---EANYEFYQNVGVEC 43 (66)
Q Consensus 22 ReDPF~lk---~AN~~FY~~~~~~C 43 (66)
--|||+.. ..|++|.++++++=
T Consensus 89 ~GtPFdfnggaYd~lTmWEQl~e~~ 113 (180)
T COG5081 89 KGTPFDFNGGAYDNLTMWEQLDEET 113 (180)
T ss_pred cCCCcccCCchhhhhhHHHHhcccc
Confidence 45899999 89999999998654
No 6
>cd00545 MCH Methenyltetrahydromethanopterin (methenyl-H4MPT) cyclohydrolase (MCH). MCH is a cytoplasmic enzyme that has been identified in methanogenic archaea, sulfate- reducing archaea, and methylotrophic bacteria. It catalyzes the reversible formation of N(5), N(10)-methenyltetrahydromethanopterin (methenyl-H4MPT+) from N(5)-formyltetrahydromethanopterin (formyl- H4MPT), in the third step of the reaction to reduce CO2 to CH4. The protein functions as a homodimer or homotrimer, depending on the organism.
Probab=38.96 E-value=8.5 Score=29.93 Aligned_cols=15 Identities=47% Similarity=1.057 Sum_probs=12.5
Q ss_pred CC--chhhhchHHHHcc
Q psy14602 25 PF--SLREANYEFYQNV 39 (66)
Q Consensus 25 PF--~lk~AN~~FY~~~ 39 (66)
|| .+|+||||||+.-
T Consensus 262 PF~eiFk~a~~DFykID 278 (312)
T cd00545 262 PFAEVFKEADYDFYKID 278 (312)
T ss_pred cHHHHHHHcCCCceeCC
Confidence 66 5799999999874
No 7
>TIGR03120 one_C_mch methenyltetrahydromethanopterin cyclohydrolase. Members of this protein family are the enzyme methenyltetrahydromethanopterin cyclohydrolase, a key enzyme for tetrahydromethanopterin (H4MPT)-linked C1 transfer metabolism.
Probab=38.59 E-value=8.6 Score=29.89 Aligned_cols=15 Identities=53% Similarity=1.074 Sum_probs=12.5
Q ss_pred CC--chhhhchHHHHcc
Q psy14602 25 PF--SLREANYEFYQNV 39 (66)
Q Consensus 25 PF--~lk~AN~~FY~~~ 39 (66)
|| .+|+||||||+.-
T Consensus 262 PF~eiFk~a~~DFykID 278 (312)
T TIGR03120 262 PFAEIFKEANYDFYKID 278 (312)
T ss_pred cHHHHHHHcCCCceeCC
Confidence 66 5799999999874
No 8
>PF02289 MCH: Cyclohydrolase (MCH); InterPro: IPR003209 Methenyltetrahydromethanopterin cyclohydrolase catalyses the interconversion of methenyltetrahydromethanopterin and N(5)formyltetrahydromethanopterin, and is found in both archaea and bacteria. In methanogenic archaea, such as Methanobacterium thermoautotrophicum (strain Marburg / DSM 2133), this enzyme is involved in the production of methane from carbon dioxide []. In the sulphate-reducer Archaeoglobus fulgidus, this enzyme is involved in the tetrahydromethanopterin-dependent oxidation of lactate []. In Gram-negative methylotrophic bacteria this enzyme is involved in the tetrahydromethanopterin-dependent oxidation of formaldehyde to formate [].; GO: 0018759 methenyltetrahydromethanopterin cyclohydrolase activity, 0006730 one-carbon metabolic process; PDB: 1QLM_A.
Probab=36.19 E-value=14 Score=28.60 Aligned_cols=15 Identities=47% Similarity=1.063 Sum_probs=10.2
Q ss_pred CCc--hhhhchHHHHcc
Q psy14602 25 PFS--LREANYEFYQNV 39 (66)
Q Consensus 25 PF~--lk~AN~~FY~~~ 39 (66)
||- +|+||+|||+.-
T Consensus 262 pF~eiFk~~~~DFykID 278 (313)
T PF02289_consen 262 PFAEIFKEAGYDFYKID 278 (313)
T ss_dssp -HHHHHHHTTT-GGGS-
T ss_pred cHHHHHHHcCCChhhCC
Confidence 553 799999999874
No 9
>PF12088 DUF3565: Protein of unknown function (DUF3565); InterPro: IPR021948 This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 30 to 78 amino acids in length. This protein has two conserved sequence motifs: WVA and CGH.
Probab=31.71 E-value=24 Score=21.74 Aligned_cols=13 Identities=54% Similarity=0.974 Sum_probs=11.3
Q ss_pred cccCccccccCCC
Q psy14602 13 CDCGRTQAQREDP 25 (66)
Q Consensus 13 CnCGR~q~~ReDP 25 (66)
=.||..|-.|-||
T Consensus 15 L~CGH~QHvRH~P 27 (61)
T PF12088_consen 15 LSCGHTQHVRHDP 27 (61)
T ss_pred ecccccccccCCC
Confidence 3699999999986
No 10
>smart00704 ZnF_CDGSH CDGSH-type zinc finger. Function unknown.
Probab=27.68 E-value=30 Score=18.88 Aligned_cols=12 Identities=33% Similarity=0.913 Sum_probs=8.7
Q ss_pred eeecccCccccc
Q psy14602 10 MSSCDCGRTQAQ 21 (66)
Q Consensus 10 ~saCnCGR~q~~ 21 (66)
+.=|.||+|...
T Consensus 14 ~~lC~C~~S~~~ 25 (38)
T smart00704 14 YALCRCGRSKNF 25 (38)
T ss_pred EEEeeCCCCCCC
Confidence 456999998654
No 11
>COG3252 Methenyltetrahydromethanopterin cyclohydrolase [Coenzyme metabolism]
Probab=26.75 E-value=21 Score=27.92 Aligned_cols=17 Identities=35% Similarity=0.856 Sum_probs=13.8
Q ss_pred CCCC--chhhhchHHHHcc
Q psy14602 23 EDPF--SLREANYEFYQNV 39 (66)
Q Consensus 23 eDPF--~lk~AN~~FY~~~ 39 (66)
.+|| .+|+||||||..-
T Consensus 260 gkPF~evf~~adyDfykiD 278 (314)
T COG3252 260 GKPFYEVFKAADYDFYKID 278 (314)
T ss_pred CChHHHHHhhccCcccccC
Confidence 4688 5899999999863
No 12
>PF15207 TMEM240: TMEM240 family
Probab=23.47 E-value=49 Score=23.97 Aligned_cols=28 Identities=25% Similarity=0.578 Sum_probs=20.3
Q ss_pred CCcCCCceeeeecccCccccccCCCCch
Q psy14602 1 MEHSSGLRFMSSCDCGRTQAQREDPFSL 28 (66)
Q Consensus 1 ~~HsSg~~~~saCnCGR~q~~ReDPF~l 28 (66)
+||.-|-.-+.-|||||--..=-=||+-
T Consensus 39 lp~~rG~~Rvchc~cgrhhvhyvipydg 66 (180)
T PF15207_consen 39 LPHMRGEDRVCHCNCGRHHVHYVIPYDG 66 (180)
T ss_pred cccccccceeEecCCCcceeEEEeeecC
Confidence 3677788889999999976555555543
No 13
>PF15044 CLU_N: Mitochondrial function, CLU-N-term
Probab=22.53 E-value=37 Score=20.53 Aligned_cols=17 Identities=35% Similarity=0.548 Sum_probs=14.0
Q ss_pred CccccccCCCCchhhhc
Q psy14602 16 GRTQAQREDPFSLREAN 32 (66)
Q Consensus 16 GR~q~~ReDPF~lk~AN 32 (66)
|-+....++||+.++|-
T Consensus 50 ~~~L~lve~pYt~r~a~ 66 (76)
T PF15044_consen 50 GCVLELVEEPYTEREAR 66 (76)
T ss_pred CcEEEEEecCCCHHHHH
Confidence 55777889999999984
No 14
>PF09360 zf-CDGSH: Iron-binding zinc finger CDGSH type; InterPro: IPR018967 This entry represents iron-sulphur domain containing proteins that have a CDGSH sequence motif (although the Ser residue can also be an Ala or Thr), and is found in proteins from a wide range of organisms with the exception of fungi. The CDGSH-type domain binds a redox-active pH-labile 2Fe-2S cluster. The conserved sequence C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H is a defining feature of this family []. CDGSH-type domains are found in mitoNEET, an iron-containing integral protein of the outer mitochondrian membrane (OMM). MitoNEET forms a dimeric structure with a NEET fold, and contains two domains: a beta-cap region and a cluster-binding domain that coordinated two acid-labile 2Fe-2S clusters (one bound to each protomer) []. The CDGSH iron-sulphur domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by a more N-terminal domain found in higher vertebrates, (IPR019610 from INTERPRO) [, ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM. ; GO: 0051537 2 iron, 2 sulfur cluster binding, 0043231 intracellular membrane-bounded organelle; PDB: 3TBO_A 3FNV_B 3TBM_B 3TBN_A 3S2R_A 3S2Q_A 3LPQ_A 2QH7_A 3EW0_A 2R13_A ....
Probab=21.45 E-value=37 Score=18.37 Aligned_cols=13 Identities=23% Similarity=0.777 Sum_probs=6.9
Q ss_pred eeeeecccCcccc
Q psy14602 8 RFMSSCDCGRTQA 20 (66)
Q Consensus 8 ~~~saCnCGR~q~ 20 (66)
..+.=|.||+++.
T Consensus 17 ~~~~lC~Cg~S~~ 29 (38)
T PF09360_consen 17 GTYALCRCGKSKN 29 (38)
T ss_dssp SEEEE-SSS--TT
T ss_pred CEEEEecCCCCCC
Confidence 4566799999873
Done!