Query         psy14602
Match_columns 66
No_of_seqs    51 out of 53
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 15:55:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14602.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14602hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3692|consensus              100.0 2.5E-31 5.5E-36  216.7   2.2   62    2-64    481-542 (881)
  2 PF10220 DUF2146:  Uncharacteri 100.0 1.3E-30 2.8E-35  214.3   2.0   62    3-65    487-548 (895)
  3 PF10170 C6_DPF:  Cysteine-rich  45.1       7 0.00015   25.7  -0.0   23   23-48     35-58  (97)
  4 PRK02264 N(5),N(10)-methenylte  42.2     9.2  0.0002   29.8   0.2   15   25-39    263-279 (317)
  5 COG5081 Predicted membrane pro  41.4      13 0.00029   27.0   0.9   22   22-43     89-113 (180)
  6 cd00545 MCH Methenyltetrahydro  39.0     8.5 0.00018   29.9  -0.4   15   25-39    262-278 (312)
  7 TIGR03120 one_C_mch methenylte  38.6     8.6 0.00019   29.9  -0.4   15   25-39    262-278 (312)
  8 PF02289 MCH:  Cyclohydrolase (  36.2      14 0.00031   28.6   0.5   15   25-39    262-278 (313)
  9 PF12088 DUF3565:  Protein of u  31.7      24 0.00052   21.7   0.8   13   13-25     15-27  (61)
 10 smart00704 ZnF_CDGSH CDGSH-typ  27.7      30 0.00065   18.9   0.7   12   10-21     14-25  (38)
 11 COG3252 Methenyltetrahydrometh  26.8      21 0.00045   27.9  -0.1   17   23-39    260-278 (314)
 12 PF15207 TMEM240:  TMEM240 fami  23.5      49  0.0011   24.0   1.3   28    1-28     39-66  (180)
 13 PF15044 CLU_N:  Mitochondrial   22.5      37 0.00081   20.5   0.5   17   16-32     50-66  (76)
 14 PF09360 zf-CDGSH:  Iron-bindin  21.5      37  0.0008   18.4   0.3   13    8-20     17-29  (38)

No 1  
>KOG3692|consensus
Probab=99.96  E-value=2.5e-31  Score=216.68  Aligned_cols=62  Identities=53%  Similarity=1.075  Sum_probs=60.8

Q ss_pred             CcCCCceeeeecccCccccccCCCCchhhhchHHHHcccceeccccceeeeeccccCCCCCcc
Q psy14602          2 EHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFR   64 (66)
Q Consensus         2 ~HsSg~~~~saCnCGR~q~~ReDPF~lk~AN~~FY~~~~~~C~C~~l~~i~Fpvf~ps~~d~~   64 (66)
                      .|+||++++|||||||+|+.|+|||+||+|||||||+++++| |++||+|||||||||++|++
T Consensus       481 ~Hns~~~~is~CnCGRkQ~~R~dPF~ik~ANydFY~h~~~kC-C~kl~~yqFpvfeps~~D~~  542 (881)
T KOG3692|consen  481 YHNSRARSISACNCGRKQAPRDDPFDIKAANYDFYQHLEEKC-CGKLDHYQFPVFEPSTPDPA  542 (881)
T ss_pred             eccccceeeeeeccccccCCCCCCcchhhccchHHHhhHHHH-hhhHhhccccccCCCCCCcc
Confidence            699999999999999999999999999999999999999999 99999999999999999985


No 2  
>PF10220 DUF2146:  Uncharacterized conserved protein (DUF2146);  InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex. They suppress Smg-1 kinase activity in the isolated Smg-1 complex, and are involved in nonsense-mediated mRNA decay (NMD) in both mammals and nematodes []. NMD is a surveillance mechanism that detects and degrades mRNAs containing premature translation termination codons.
Probab=99.96  E-value=1.3e-30  Score=214.31  Aligned_cols=62  Identities=63%  Similarity=1.265  Sum_probs=60.6

Q ss_pred             cCCCceeeeecccCccccccCCCCchhhhchHHHHcccceeccccceeeeeccccCCCCCccc
Q psy14602          3 HSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRC   65 (66)
Q Consensus         3 HsSg~~~~saCnCGR~q~~ReDPF~lk~AN~~FY~~~~~~C~C~~l~~i~Fpvf~ps~~d~~~   65 (66)
                      |+||++++|||||||+|++|+|||+||+||++||++++++| |++|++|+|||||||++|++-
T Consensus       487 H~Sg~~~~saCnCGr~q~~R~DPF~l~~AN~~FY~~~~~~C-C~~l~~~~Fpvfqps~~d~~~  548 (895)
T PF10220_consen  487 HSSGVRFLSACNCGRSQGLREDPFDLKEANYDFYQHLEFKC-CSKLERIQFPVFQPSTPDYRA  548 (895)
T ss_pred             ccCCCceeeecCCCCccCCCCCCcCHHHHhHHHHHHHHHHH-HHHHhhcccceecCCCCchhh
Confidence            99999999999999999999999999999999999999999 999999999999999999863


No 3  
>PF10170 C6_DPF:  Cysteine-rich domain;  InterPro: IPR018785  This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [, , ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed. 
Probab=45.08  E-value=7  Score=25.75  Aligned_cols=23  Identities=35%  Similarity=0.716  Sum_probs=18.4

Q ss_pred             CCCCchhhhchHHHHcccceec-cccc
Q psy14602         23 EDPFSLREANYEFYQNVGVECG-CVAL   48 (66)
Q Consensus        23 eDPF~lk~AN~~FY~~~~~~C~-C~~l   48 (66)
                      -|||+   ++-+.|-.|...|+ |+++
T Consensus        35 rDPF~---~~~~~~LvLGa~CS~C~~~   58 (97)
T PF10170_consen   35 RDPFS---PDKERFLVLGAPCSICGKP   58 (97)
T ss_pred             eCCCC---CCCccEEEECccccccCCc
Confidence            48994   67888889999998 8764


No 4  
>PRK02264 N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase; Provisional
Probab=42.23  E-value=9.2  Score=29.80  Aligned_cols=15  Identities=53%  Similarity=1.074  Sum_probs=12.6

Q ss_pred             CC--chhhhchHHHHcc
Q psy14602         25 PF--SLREANYEFYQNV   39 (66)
Q Consensus        25 PF--~lk~AN~~FY~~~   39 (66)
                      ||  .+|+||||||+.-
T Consensus       263 PF~eiFk~a~~DFykID  279 (317)
T PRK02264        263 PFAEIFKEANYDFYKID  279 (317)
T ss_pred             cHHHHHHHcCCChhhCC
Confidence            66  5799999999874


No 5  
>COG5081 Predicted membrane protein [Function unknown]
Probab=41.41  E-value=13  Score=26.97  Aligned_cols=22  Identities=18%  Similarity=0.474  Sum_probs=18.6

Q ss_pred             cCCCCchh---hhchHHHHccccee
Q psy14602         22 REDPFSLR---EANYEFYQNVGVEC   43 (66)
Q Consensus        22 ReDPF~lk---~AN~~FY~~~~~~C   43 (66)
                      --|||+..   ..|++|.++++++=
T Consensus        89 ~GtPFdfnggaYd~lTmWEQl~e~~  113 (180)
T COG5081          89 KGTPFDFNGGAYDNLTMWEQLDEET  113 (180)
T ss_pred             cCCCcccCCchhhhhhHHHHhcccc
Confidence            45899999   89999999998654


No 6  
>cd00545 MCH Methenyltetrahydromethanopterin (methenyl-H4MPT) cyclohydrolase (MCH). MCH is a cytoplasmic enzyme that has been identified in methanogenic archaea, sulfate- reducing archaea, and methylotrophic bacteria.  It catalyzes the reversible formation of N(5), N(10)-methenyltetrahydromethanopterin (methenyl-H4MPT+) from N(5)-formyltetrahydromethanopterin (formyl- H4MPT), in the third step of the reaction to reduce CO2 to CH4. The protein functions as a homodimer or homotrimer, depending on the organism.
Probab=38.96  E-value=8.5  Score=29.93  Aligned_cols=15  Identities=47%  Similarity=1.057  Sum_probs=12.5

Q ss_pred             CC--chhhhchHHHHcc
Q psy14602         25 PF--SLREANYEFYQNV   39 (66)
Q Consensus        25 PF--~lk~AN~~FY~~~   39 (66)
                      ||  .+|+||||||+.-
T Consensus       262 PF~eiFk~a~~DFykID  278 (312)
T cd00545         262 PFAEVFKEADYDFYKID  278 (312)
T ss_pred             cHHHHHHHcCCCceeCC
Confidence            66  5799999999874


No 7  
>TIGR03120 one_C_mch methenyltetrahydromethanopterin cyclohydrolase. Members of this protein family are the enzyme methenyltetrahydromethanopterin cyclohydrolase, a key enzyme for tetrahydromethanopterin (H4MPT)-linked C1 transfer metabolism.
Probab=38.59  E-value=8.6  Score=29.89  Aligned_cols=15  Identities=53%  Similarity=1.074  Sum_probs=12.5

Q ss_pred             CC--chhhhchHHHHcc
Q psy14602         25 PF--SLREANYEFYQNV   39 (66)
Q Consensus        25 PF--~lk~AN~~FY~~~   39 (66)
                      ||  .+|+||||||+.-
T Consensus       262 PF~eiFk~a~~DFykID  278 (312)
T TIGR03120       262 PFAEIFKEANYDFYKID  278 (312)
T ss_pred             cHHHHHHHcCCCceeCC
Confidence            66  5799999999874


No 8  
>PF02289 MCH:  Cyclohydrolase (MCH);  InterPro: IPR003209 Methenyltetrahydromethanopterin cyclohydrolase catalyses the interconversion of methenyltetrahydromethanopterin and N(5)formyltetrahydromethanopterin, and is found in both archaea and bacteria. In methanogenic archaea, such as Methanobacterium thermoautotrophicum (strain Marburg / DSM 2133), this enzyme is involved in the production of methane from carbon dioxide []. In the sulphate-reducer Archaeoglobus fulgidus, this enzyme is involved in the tetrahydromethanopterin-dependent oxidation of lactate []. In Gram-negative methylotrophic bacteria this enzyme is involved in the tetrahydromethanopterin-dependent oxidation of formaldehyde to formate [].; GO: 0018759 methenyltetrahydromethanopterin cyclohydrolase activity, 0006730 one-carbon metabolic process; PDB: 1QLM_A.
Probab=36.19  E-value=14  Score=28.60  Aligned_cols=15  Identities=47%  Similarity=1.063  Sum_probs=10.2

Q ss_pred             CCc--hhhhchHHHHcc
Q psy14602         25 PFS--LREANYEFYQNV   39 (66)
Q Consensus        25 PF~--lk~AN~~FY~~~   39 (66)
                      ||-  +|+||+|||+.-
T Consensus       262 pF~eiFk~~~~DFykID  278 (313)
T PF02289_consen  262 PFAEIFKEAGYDFYKID  278 (313)
T ss_dssp             -HHHHHHHTTT-GGGS-
T ss_pred             cHHHHHHHcCCChhhCC
Confidence            553  799999999874


No 9  
>PF12088 DUF3565:  Protein of unknown function (DUF3565);  InterPro: IPR021948  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 30 to 78 amino acids in length. This protein has two conserved sequence motifs: WVA and CGH. 
Probab=31.71  E-value=24  Score=21.74  Aligned_cols=13  Identities=54%  Similarity=0.974  Sum_probs=11.3

Q ss_pred             cccCccccccCCC
Q psy14602         13 CDCGRTQAQREDP   25 (66)
Q Consensus        13 CnCGR~q~~ReDP   25 (66)
                      =.||..|-.|-||
T Consensus        15 L~CGH~QHvRH~P   27 (61)
T PF12088_consen   15 LSCGHTQHVRHDP   27 (61)
T ss_pred             ecccccccccCCC
Confidence            3699999999986


No 10 
>smart00704 ZnF_CDGSH CDGSH-type zinc finger. Function unknown.
Probab=27.68  E-value=30  Score=18.88  Aligned_cols=12  Identities=33%  Similarity=0.913  Sum_probs=8.7

Q ss_pred             eeecccCccccc
Q psy14602         10 MSSCDCGRTQAQ   21 (66)
Q Consensus        10 ~saCnCGR~q~~   21 (66)
                      +.=|.||+|...
T Consensus        14 ~~lC~C~~S~~~   25 (38)
T smart00704       14 YALCRCGRSKNF   25 (38)
T ss_pred             EEEeeCCCCCCC
Confidence            456999998654


No 11 
>COG3252 Methenyltetrahydromethanopterin cyclohydrolase [Coenzyme metabolism]
Probab=26.75  E-value=21  Score=27.92  Aligned_cols=17  Identities=35%  Similarity=0.856  Sum_probs=13.8

Q ss_pred             CCCC--chhhhchHHHHcc
Q psy14602         23 EDPF--SLREANYEFYQNV   39 (66)
Q Consensus        23 eDPF--~lk~AN~~FY~~~   39 (66)
                      .+||  .+|+||||||..-
T Consensus       260 gkPF~evf~~adyDfykiD  278 (314)
T COG3252         260 GKPFYEVFKAADYDFYKID  278 (314)
T ss_pred             CChHHHHHhhccCcccccC
Confidence            4688  5899999999863


No 12 
>PF15207 TMEM240:  TMEM240 family
Probab=23.47  E-value=49  Score=23.97  Aligned_cols=28  Identities=25%  Similarity=0.578  Sum_probs=20.3

Q ss_pred             CCcCCCceeeeecccCccccccCCCCch
Q psy14602          1 MEHSSGLRFMSSCDCGRTQAQREDPFSL   28 (66)
Q Consensus         1 ~~HsSg~~~~saCnCGR~q~~ReDPF~l   28 (66)
                      +||.-|-.-+.-|||||--..=-=||+-
T Consensus        39 lp~~rG~~Rvchc~cgrhhvhyvipydg   66 (180)
T PF15207_consen   39 LPHMRGEDRVCHCNCGRHHVHYVIPYDG   66 (180)
T ss_pred             cccccccceeEecCCCcceeEEEeeecC
Confidence            3677788889999999976555555543


No 13 
>PF15044 CLU_N:  Mitochondrial function, CLU-N-term
Probab=22.53  E-value=37  Score=20.53  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=14.0

Q ss_pred             CccccccCCCCchhhhc
Q psy14602         16 GRTQAQREDPFSLREAN   32 (66)
Q Consensus        16 GR~q~~ReDPF~lk~AN   32 (66)
                      |-+....++||+.++|-
T Consensus        50 ~~~L~lve~pYt~r~a~   66 (76)
T PF15044_consen   50 GCVLELVEEPYTEREAR   66 (76)
T ss_pred             CcEEEEEecCCCHHHHH
Confidence            55777889999999984


No 14 
>PF09360 zf-CDGSH:  Iron-binding zinc finger CDGSH type;  InterPro: IPR018967 This entry represents iron-sulphur domain containing proteins that have a CDGSH sequence motif (although the Ser residue can also be an Ala or Thr), and is found in proteins from a wide range of organisms with the exception of fungi. The CDGSH-type domain binds a redox-active pH-labile 2Fe-2S cluster. The conserved sequence C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H is a defining feature of this family []. CDGSH-type domains are found in mitoNEET, an iron-containing integral protein of the outer mitochondrian membrane (OMM). MitoNEET forms a dimeric structure with a NEET fold, and contains two domains: a beta-cap region and a cluster-binding domain that coordinated two acid-labile 2Fe-2S clusters (one bound to each protomer) []. The CDGSH iron-sulphur domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by a more N-terminal domain found in higher vertebrates, (IPR019610 from INTERPRO) [, ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM. ; GO: 0051537 2 iron, 2 sulfur cluster binding, 0043231 intracellular membrane-bounded organelle; PDB: 3TBO_A 3FNV_B 3TBM_B 3TBN_A 3S2R_A 3S2Q_A 3LPQ_A 2QH7_A 3EW0_A 2R13_A ....
Probab=21.45  E-value=37  Score=18.37  Aligned_cols=13  Identities=23%  Similarity=0.777  Sum_probs=6.9

Q ss_pred             eeeeecccCcccc
Q psy14602          8 RFMSSCDCGRTQA   20 (66)
Q Consensus         8 ~~~saCnCGR~q~   20 (66)
                      ..+.=|.||+++.
T Consensus        17 ~~~~lC~Cg~S~~   29 (38)
T PF09360_consen   17 GTYALCRCGKSKN   29 (38)
T ss_dssp             SEEEE-SSS--TT
T ss_pred             CEEEEecCCCCCC
Confidence            4566799999873


Done!