Diaphorina citri psyllid: psy14608


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
DKESKKDRNVPQIIETRLIEQSIEQEEQSNKSSADLRIRDTQLRMIEQSIEQEEQSNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEISKKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRTTTNEELEAMLDTGNPAVFTQGGEMIDRIEYHVEHAVDYVQTATQDTKKALKYQSKARR
ccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*******************************************************************TQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEISKKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRTTTNEELEAMLDTGNPAVFTQGGEMIDRIEYHVEHAVDYVQTATQDTKK**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DKESKKDRNVPQIIETRLIEQSIEQEEQSNKSSADLRIRDTQLRMIEQSIEQEEQSNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEISKKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRTTTNEELEAMLDTGNPAVFTQGGEMIDRIEYHVEHAVDYVQTATQDTKKALKYQSKARR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-1A Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.confidentP32850
Syntaxin-1A Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca(2+)-regulation of. exocytosis acrosomal reaction in sperm.confidentQ5R4L2
Syntaxin-1A Plays a critical role in several secretory processes, including cuticle secretion and neurotransmitter release, and probably assists in neuronal membrane maturation or the final stages of neuronal differentiation. Essential for embryonic viability and development. Required for coordinated peristaltic contractions.confidentQ24547

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0030672 [CC]synaptic vesicle membraneprobableGO:0008021, GO:0043229, GO:0045202, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0042641 [CC]actomyosinprobableGO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045921 [BP]positive regulation of exocytosisprobableGO:0032879, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0060627, GO:0065007, GO:0048522, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0017157
GO:0010646 [BP]regulation of cell communicationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0001948 [MF]glycoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009629 [BP]response to gravityprobableGO:0009628, GO:0050896, GO:0008150
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0070032 [CC]synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0031201
GO:0070033 [CC]synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0031201
GO:0006944 [BP]cellular membrane fusionprobableGO:0016044, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0023051 [BP]regulation of signalingprobableGO:0008150, GO:0065007, GO:0050789
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S94, chain A
Confidence level:very confident
Coverage over the Query: 23-90,123-130
View the alignment between query and template
View the model in PyMOL
Template: 1DN1, chain B
Confidence level:very confident
Coverage over the Query: 11-184
View the alignment between query and template
View the model in PyMOL