Diaphorina citri psyllid: psy14634


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MENGFYLENWSTLETFVFQKSKQIFPMGGLFLIPSAFQIVREKERFKPTPYNYAMKKTQLMKERDMAQSKIGESQPFRDGNLSSLPRAGIEPEIVEVVYKKDLISSAMFYGSVCDLTSWHIFSSHPQEIGEISGVCETGKIYSLGKTRTNKGLKLRHGNSERVFRLEFISNQEFTESEFIRWKDQCMTEGVALPTKDEVERKSKEIQNGMMYQWKEEDVEQIVREKERFKPTPYNYAMKKTQLMKERDMAQSKGDDEEASILQRKIDDLEERANELDKARTSTISSISYINNRNRRKNVEEAEKAIMVSCCCCCSGFSYRSVKSSASRKVIEYIETKEELNRIRLSRFKMEKLVHLPIFGQIVIGCFVRIGIGNNTGIPLYRVSENFC
ccccccccccccHHHHHHcccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccccEEEEEEEEEccccccccccEEEEEEEEEEEcccEEEcccCECcEEEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHcccccHHHHHccEEEEEEccccccccEEEEEccc
**NGFYLENWSTLETFVFQKSKQIFPMGGLFLIPSAFQIVREKERF*************************************SLPRAGIEPEIVEVVYKKDLISSAMFYGSVCDLTSWHIFSSHPQEIGEISGVCETGKIYSLGKTRTNKGLKLRHGNSERVFRLEFISNQEFTESEFIRWKDQCMTEGVALPTKDEVERKSKEIQNGMMYQWKEE*********************KKTQLMKERDM***********ILQ******************************NRRKNVEEAEKAIMVSCCCCCSGFSYRSVKSSASRKVIEYIETKEELNRIRLSRFKMEKLVHLPIFGQIVIGCFVRIGIGNNTGIPLYRVSENFC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENGFYLENWSTLETFVFQKSKQIFPMGGLFLIPSAFQIVREKERFKPTPYNYAMKKTQLMKERDMAQSKIGESQPFRDGNLSSLPRAGIEPEIVEVVYKKDLISSAMFYGSVCDLTSWHIFSSHPQEIGEISGVCETGKIYSLGKTRTNKGLKLRHGNSERVFRLEFISNQEFTESEFIRWKDQCMTEGVALPTKDEVERKSKEIQNGMMYQWKEEDVEQIVREKERFKPTPYNYAMKKTQLMKERDMAQxxxxxxxxxxxxxxxxxxxxxxxxxxxxRTSTISSISYINNRNRRKNVEEAEKAIMVSCCCCCSGFSYRSVKSSASRKVIEYIETKEELNRIRLSRFKMEKLVHLPIFGQIVIGCFVRIGIGNNTGIPLYRVSENFC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA polymerase-associated protein Rtf1 Plays a role in transcription-coupled histone modification. Required for methylation of 'Lys-4' of histone H3. Plays a role in regulation of transcription. Required for maximal induction of heat-shock genes. Plays a role in Notch signaling in the wing margins.confidentQ9W261
RNA polymerase-associated protein RTF1 homolog Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1; it promotes leukemogenesis though association with MLL-rearranged oncoproteins, such as MLL-MLLT3/AF9 and MLL-MLLT1/ENL. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. In case of infection by influenza A strain H3N2, PAF1C associates with viral NS1 protein, thereby regulating gene transcription. Binds single-stranded DNA. Required for maximal induction of heat-shock genes. Required for the trimethylation of histone H3 'Lys-4' (H3K4me3) on genes involved in stem cell pluripotency; this function is synergistic with CXXC1 indicative for an involvement of a SET1 complex.confidentQ92541
RNA polymerase-associated protein RTF1 homolog Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Binds single-stranded DNA (By similarity). Required for maximal induction of heat-shock genes. Required for the trimethylation of histone H3 'Lys-4' (H3K4me3) on genes involved in stem cell pluripotency; this function is synergistic with CXXC1 indicative for an involvement of a SET1 complex.confidentA2AQ19

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035327 [CC]transcriptionally active chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BZE, chain A
Confidence level:very confident
Coverage over the Query: 89-211
View the alignment between query and template
View the model in PyMOL
Template: 2BZE, chain A
Confidence level:very confident
Coverage over the Query: 328-388
View the alignment between query and template
View the model in PyMOL
Template: 1GP8, chain A
Confidence level:probable
Coverage over the Query: 236-269
View the alignment between query and template
View the model in PyMOL