Diaphorina citri psyllid: psy14654


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MSTLSIEVVYPEVMKPMLERKRRARINRCLDELKEIMVTSLQAEGENVSKLEKADILELTVRHLHKLRRQQSLGLTPEAAYADRFKAGFTHCAAEVSQYLASSMQQHQQQPSTEPTIDPSSG
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
******EVVYPEVMKPMLE*KRRARINRCLDELKEIMVTSLQAEGENVSKLEKADILELTVRHLHKLRRQQS*G**PEAAYADRFKAGFTHCAAEVSQY***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTLSIEVVYPEVMKPMLERKRRARINRCLDELKEIMVTSLQAEGENVSKLEKADILELTVRHLHKLRRQQSLGLTPEAAYADRFKAGFTHCAAEVSQYLASSMQQHQQQPSTEPTIDPSSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enhancer of split mbeta protein Transcriptional repressor of genes that require a bHLH protein for their transcription. May serve as a transcriptional regulator of the Achaete-scute complex (AS-C) genes. Contributes to the neural-epidermal lineage decision during early neurogenesis. Part of the Notch signaling pathway.confidentQ01069

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001756 [BP]somitogenesisprobableGO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0010001 [BP]glial cell differentiationprobableGO:0032502, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0044092 [BP]negative regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0050767 [BP]regulation of neurogenesisprobableGO:0030154, GO:0007275, GO:0044699, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0051101 [BP]regulation of DNA bindingprobableGO:0008150, GO:0065009, GO:0051098, GO:0065007
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0035939 [MF]microsatellite bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003696, GO:1901363
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0003712 [MF]transcription cofactor activityprobableGO:0003674, GO:0000989, GO:0000988
GO:0065003 [BP]macromolecular complex assemblyprobableGO:0022607, GO:0043933, GO:0016043, GO:0044085, GO:0008150, GO:0071840
GO:0000983 [MF]RNA polymerase II core promoter sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0051216 [BP]cartilage developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0001191 [MF]RNA polymerase II transcription factor binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AN4, chain A
Confidence level:very confident
Coverage over the Query: 8-71
View the alignment between query and template
View the model in PyMOL
Template: 2DB7, chain A
Confidence level:probable
Coverage over the Query: 77-103
View the alignment between query and template
View the model in PyMOL