Diaphorina citri psyllid: psy14655

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-

MIASSKGGVGKSTTTVNLATAMKICYPDKEIGILDADVFGPSIPILMNLPDTPLLNKDNLMIPLVNYGVKCLSMGNLITEKSAAIWRGLMVMQALNKLTVQVQWGPCDILFIDTPPGTGDTHLSLIQNLFIDTAIIITIPDTMSLQVAQRGYTMFKKLNIPVAGLVMNMNSVLCPSCNHMFELYENNLHQFEAKNFLKSYERKLYGIHMWNFLIPLCNLIIKIRNVAYGNSHGHGNTVHHHHVLNLIGEEDQKSGPYKKLK

ccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEEEEcccccEEEEEEccccccccEEEEHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccc

*********GKSTTTVNLATAMKICYPDKEIGILDADVFGPSIPILMNLPDTPLLNKDNLMIPLVNYGVKCLSMGNLITEKSAAIWRGLMVMQALNKLTVQVQWGPCDILFIDTPPGTGDTHLSLIQNLFIDTAIIITIPDTMSLQVAQRGYTMFKKLNIPVAGLVMNMNSVLCPSCNHMFELYENNLHQFEAKNFLKSYERKLYGIHMWNFLIPLCNLIIKIRNVAYG*SHGHGNTVHHHHVLNLIGEEDQKSGPY****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Iron-sulfur protein IND1	Required for the effective assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Probably facilitates the assembly of Fe-S cofactors and subunits of complex I.	confident	Q6CE48
Uncharacterized ATP-binding protein MJ0283		confident	Q57731
Uncharacterized ATP-binding protein PF1145		confident	Q8U1R0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]	binding	probable	GO:0003674

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PH1, chain A
Confidence level:very confident
Coverage over the Query: 3-193,204-239
View the alignment between query and template
View the model in PyMOL