BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy14668
         (266 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DQ8|A Chain A, Crystal Structure Of Acetate Kinase Acka From
           Mycobacterium Marinum
 pdb|4DQ8|B Chain B, Crystal Structure Of Acetate Kinase Acka From
           Mycobacterium Marinum
          Length = 391

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 51  YVIHRFLCESDVWPIRPDFFDRSSHGGC--------AKPVGDFREIVLRGSSVSQDMSVS 102
           Y I R L  +DVW IR   F  +SH            KP+GD  +IVL    +    S S
Sbjct: 155 YAIDREL--ADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLH---LGNGASAS 209

Query: 103 HLLKNKKLASLMGTTP 118
            +   + + + MG TP
Sbjct: 210 AVAGGRPVETSMGLTP 225


>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|I Chain I, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|J Chain J, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|K Chain K, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|L Chain L, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|2ONM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|I Chain I, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|J Chain J, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|K Chain K, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|L Chain L, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
          Length = 500

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|2VLE|A Chain A, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|B Chain B, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|C Chain C, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|D Chain D, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|E Chain E, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|F Chain F, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|G Chain G, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|H Chain H, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
          Length = 494

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 327 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 386

Query: 173 L 173
           +
Sbjct: 387 M 387


>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
          Length = 500

 Score = 27.3 bits (59), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|B Chain B, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|C Chain C, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|D Chain D, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|E Chain E, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|F Chain F, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|G Chain G, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|H Chain H, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1O04|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|B Chain B, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|C Chain C, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|D Chain D, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|E Chain E, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|F Chain F, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|G Chain G, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|H Chain H, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
          Length = 500

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|B Chain B, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|C Chain C, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|D Chain D, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|E Chain E, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|F Chain F, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|G Chain G, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|H Chain H, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N82|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|B Chain B, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|C Chain C, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|D Chain D, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|E Chain E, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|F Chain F, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|G Chain G, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|H Chain H, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N83|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|B Chain B, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|C Chain C, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|D Chain D, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|E Chain E, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|F Chain F, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|G Chain G, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|H Chain H, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
          Length = 500

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|B Chain B, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|C Chain C, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|D Chain D, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|E Chain E, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|F Chain F, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|G Chain G, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|H Chain H, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1NZX|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZZ|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1O00|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O01|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O02|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|3INJ|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3SZ9|A Chain A, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|B Chain B, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|C Chain C, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|D Chain D, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|E Chain E, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|F Chain F, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|G Chain G, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|H Chain H, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|4FQF|A Chain A, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
 pdb|4FQF|B Chain B, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
 pdb|4FQF|C Chain C, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
 pdb|4FQF|D Chain D, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
          Length = 500

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|B Chain B, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|C Chain C, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|D Chain D, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|E Chain E, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|F Chain F, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|G Chain G, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|H Chain H, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
          Length = 500

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
          Length = 500

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|B Chain B, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|C Chain C, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|D Chain D, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|E Chain E, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|F Chain F, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|G Chain G, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|H Chain H, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONO|A Chain A, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|B Chain B, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|C Chain C, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|D Chain D, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|E Chain E, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|F Chain F, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|G Chain G, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|H Chain H, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONP|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|B Chain B, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|C Chain C, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|D Chain D, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|E Chain E, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|F Chain F, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|G Chain G, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|H Chain H, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
          Length = 500

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 23/61 (37%), Gaps = 4/61 (6%)

Query: 117 TPPSKKTVQKTSYTEAQFPLSSDPIVASKFFGTRFACGSSVTGDDEIVIQ----GDVKDD 172
            P   KT Q     E QF      I   K  G +  CG  +  D    IQ    GDV+D 
Sbjct: 333 NPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDG 392

Query: 173 L 173
           +
Sbjct: 393 M 393


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.139    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,232,308
Number of Sequences: 62578
Number of extensions: 345268
Number of successful extensions: 567
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 566
Number of HSP's gapped (non-prelim): 10
length of query: 266
length of database: 14,973,337
effective HSP length: 97
effective length of query: 169
effective length of database: 8,903,271
effective search space: 1504652799
effective search space used: 1504652799
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)