Diaphorina citri psyllid: psy14673

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910--

MQPLVSNKQGPNSYGSASNVMQVPLIASNPSQPSGAAPPISGLQPQVPVSNSSLQTPLGSSNMMRPPLVTNRFQAPGATINSLSTPVPQQFQRPQQQNANHSQQTFRMPPNTYSQSSKTAPFNNGLTPLTNASLYQQQQQQQQQQQQQQQPIPNIPPLPNSQQNSSNFQPSNNLYNNIQVPPRAQPGNYPSVPAGYPSLNQAGYQQQQQQQQQQQQQQQTLNSQFSNLSVNQGMNKMWGYEPHDLLNTRDILPATKVEPPPIRLPQNLPEIHEQFLYDRNTEMFGDPYRRPEIQSATVEYLATADYTVRDPPQPAMYLFLLDVSQIAAQSGYLYTVCEVLLNQLKSMPGDRRTSIAIITYDSAVHFYSLAEGQTQPSQMILTDIDDIFLPSPENILVNLSECYDMIVDLLKQLPGKFKDSLDSGSALGPALQAAFKLLQPTGGRITIFQTCLPNRGPGALQSRENPNQRSNDDPPHMNPATDFYKKIALECTSFYIAVDLFILNSQYVDLATLSGVSKFSSGCIHHIPLYSGKNMSHVYQLDRMFSRYLTRKIGFESVMRIRCTKGMSIHTFHGNFFVRSTDLLALPNVNPDAGYGIQISIDENLTHIQYACFQVAVLYTSSKGDRRIRVHTLCLPVVSNINDVLVGADQACIAGLLAKMAVDRSLQHSLSDAREAFLNVVCDVLSTYKMTQAGHLTGSLLAPSSLKLLPLYVLALLKHPAFRIGQSTRLDDRLFAMTEMKCLPLNSLMLSIYPELYPIHTLDQDPTIEWNELQVPIPRILQLSAERLQATGTYLLNMPDLIIILVRHGTSPAICSGLFGFQSVAQMPETLFELPQLETQLSLKLNSFISYLNDDKAYVSPVKVIKDSSPDRMEFYDKLIEDKNAGGMAYYEFLLRIRDYQASVLTTTPPRQ

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccEEEEEEcccccccccccccEEEEEEEccHHHHHHccHHHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEccccccccccccccccccccccccccccEEcHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccCEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccEEEEEEEEEEEEcccccCCccccccccEEEEEEEEcccccccccEEEEEEEEEEcccccEEEEEEEccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEcccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccc

****************************************************************************************************************************************************************************************************P********************QQTLNSQFSNLSVNQGMNKMWGYEPHDLLNTRDILPATKVEPPPIRLPQNLPEIHEQFLYDRNTEMFGDPYRRPEIQSATVEYLATADYTVRDPPQPAMYLFLLDVSQIAAQSGYLYTVCEVLLNQLKSMPGDRRTSIAIITYDSAVHFYSLAEGQTQPSQMILTDIDDIFLPSPENILVNLSECYDMIVDLLKQLPGKFKDSLDSGSALGPALQAAFKLLQPTGGRITIFQTCLPNRGPG******************MNPATDFYKKIALECTSFYIAVDLFILNSQYVDLATLSGVSKFSSGCIHHIPLYSGKNMSHVYQLDRMFSRYLTRKIGFESVMRIRCTKGMSIHTFHGNFFVRSTDLLALPNVNPDAGYGIQISIDENLTHIQYACFQVAVLYTSSKGDRRIRVHTLCLPVVSNINDVLVGADQACIAGLLAKMAVDRSLQHSLSDAREAFLNVVCDVLSTYKMTQAGHLTGSLLAPSSLKLLPLYVLALLKHPAFRIGQSTRLDDRLFAMTEMKCLPLNSLMLSIYPELYPIHTLDQDPTIEWNELQVPIPRILQLSAERLQATGTYLLNMPDLIIILVRHGTSPAICSGLFGFQSVAQMPETLFELPQLETQLSLKLNSFISYLNDDKAYVSPVKVIKDSSPDRMEFYDKLIEDKNAGGMAYYEFLLRIRDYQASV********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQPLVSNKQGPNSYGSASNVMQVPLIASNPSQPSGAAPPISGLQPQVPVSNSSLQTPLGSSNMMRPPLVTNRFQAPGATINSLSTPVPQQFQRPQQQNANHSQQTFRMPPNTYSQSSKTAPFNNGLTPLTNASLYQQQQQQQQQQQQQQQPIPNIPPLPNSQQNSSNFQPSNNLYNNIQVPPRAQPGNYPSVPAGYPSLNQAGxxxxxxxxxxxxxxxxxxxxxFSNLSVNQGMNKMWGYEPHDLLNTRDILPATKVEPPPIRLPQNLPEIHEQFLYDRNTEMFGDPYRRPEIQSATVEYLATADYTVRDPPQPAMYLFLLDVSQIAAQSGYLYTVCEVLLNQLKSMPGDRRTSIAIITYDSAVHFYSLAEGQTQPSQMILTDIDDIFLPSPENILVNLSECYDMIVDLLKQLPGKFKDSLDSGSALGPALQAAFKLLQPTGGRITIFQTCLPNRGPGALQSRENPNQRSNDDPPHMNPATDFYKKIALECTSFYIAVDLFILNSQYVDLATLSGVSKFSSGCIHHIPLYSGKNMSHVYQLDRMFSRYLTRKIGFESVMRIRCTKGMSIHTFHGNFFVRSTDLLALPNVNPDAGYGIQISIDENLTHIQYACFQVAVLYTSSKGDRRIRVHTLCLPVVSNINDVLVGADQACIAGLLAKMAVDRSLQHSLSDAREAFLNVVCDVLSTYKMTQAGHLTGSLLAPSSLKLLPLYVLALLKHPAFRIGQSTRLDDRLFAMTEMKCLPLNSLMLSIYPELYPIHTLDQDPTIEWNELQVPIPRILQLSAERLQATGTYLLNMPDLIIILVRHGTSPAICSGLFGFQSVAQMPETLFELPQLETQLSLKLNSFISYLNDDKAYVSPVKVIKDSSPDRMEFYDKLIEDKNAGGMAYYEFLLRIRDYQASVLTTTPPRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein transport protein SEC24	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules.	confident	Q6CLE0
Protein transport protein Sec24B	Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.	confident	O95487
Protein transport protein SEC24	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules.	confident	Q0PVD8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0090110 [BP]	cargo loading into COPII-coated vesicle	probable	GO:0022607, GO:0070271, GO:0043933, GO:0006900, GO:0035459, GO:0061024, GO:0034622, GO:0044699, GO:0006888, GO:0071822, GO:0016044, GO:0016043, GO:0065003, GO:0071840, GO:0051641, GO:0006461, GO:0048193, GO:0006810, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0043623, GO:0051179, GO:0016482, GO:0006996, GO:0090114, GO:0016192, GO:0046907, GO:0016050, GO:0044085, GO:0008150, GO:0009987
GO:0070971 [CC]	endoplasmic reticulum exit site	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EH1, chain A
Confidence level:very confident
Coverage over the Query: 245-903
View the alignment between query and template
View the model in PyMOL