Diaphorina citri psyllid: psy14675

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----

MSASASVKLSADERLSKLEPILKSGWKLVENRDAIYKEYLFKNFNEAFGFMTRTALLAEKMDHHPEWFNVYNKVQVTLSTHDCNGLSNKDIKLASFMDTIIKAES

ccccccccccHHHHHHHHccccccccEEEcccccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEcEEEEEEEccccccccHHHHHHHHHHHHHHHccc

************ER**KLEPILKSGWKLVENRDAIYKEYLFKNFNEAFGFMTRTALLAEKMDHHPEWFNVYNKVQVTLSTHDCNGLSNKDIKLASFMDTIIK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSASASVKLSADERLSKLEPILKSGWKLVENRDAIYKEYLFKNFNEAFGFMTRTALLAEKMDHHPEWFNVYNKVQVTLSTHDCNGLSNKDIKLASFMDTIIKAES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative pterin-4-alpha-carbinolamine dehydratase		very confident	A9AJD5
Putative pterin-4-alpha-carbinolamine dehydratase		very confident	P61734
Pterin-4-alpha-carbinolamine dehydratase	Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.	very confident	P61457

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0055114 [BP]	oxidation-reduction process	confident	GO:0044710, GO:0008150, GO:0008152
GO:0043496 [BP]	regulation of protein homodimerization activity	confident	GO:0008150, GO:0065007, GO:0065009, GO:0051098, GO:0043393
GO:0003713 [MF]	transcription coactivator activity	confident	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008124 [MF]	4-alpha-hydroxytetrahydrobiopterin dehydratase activity	confident	GO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	confident	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0004505 [MF]	phenylalanine 4-monooxygenase activity	confident	GO:0004497, GO:0016714, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0044444 [CC]	cytoplasmic part	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0051289 [BP]	protein homotetramerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0051291 [BP]	protein heterooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0006729 [BP]	tetrahydrobiopterin biosynthetic process	probable	GO:0006732, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0051188, GO:0042558, GO:0042559, GO:0071704, GO:0018130, GO:0009987, GO:0006725, GO:0009058, GO:0046146, GO:0008150, GO:0008152, GO:1901564, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0019438
GO:0005619 [CC]	ascospore wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0031160, GO:0071944, GO:0009277
GO:0006559 [BP]	L-phenylalanine catabolic process	probable	GO:0019752, GO:0044248, GO:0043436, GO:0006807, GO:0044281, GO:0044282, GO:1901360, GO:1901361, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:0006082, GO:1901605, GO:1901606, GO:0009987, GO:0044238, GO:1902222, GO:1902221, GO:0006725, GO:0044710, GO:0008150, GO:0008152, GO:0009074, GO:0009056, GO:0009072, GO:0009063, GO:1901564, GO:1901565, GO:0006558, GO:0046395, GO:0016054, GO:0044237, GO:0019439
GO:0071688 [BP]	striated muscle myosin thick filament assembly	probable	GO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0051146, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0034622, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030154, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0044763, GO:0009987, GO:0042692
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0030476 [BP]	ascospore wall assembly	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0043935, GO:0010927, GO:0009272, GO:0022607, GO:0022402, GO:0071940, GO:0070591, GO:0070590, GO:0044699, GO:0009653, GO:0000003, GO:0070726, GO:0048869, GO:0071840, GO:0016043, GO:0032989, GO:0071554, GO:0071555, GO:0007049, GO:0045229, GO:0048646, GO:0032502, GO:0032505, GO:0009987, GO:0044767, GO:0022414, GO:0030437, GO:0044763, GO:0022413, GO:0043934, GO:0071852, GO:0030435, GO:0042546, GO:0031505, GO:0003006, GO:0048856, GO:0042244, GO:0044085, GO:0034293, GO:0008150

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
4.2.-.-	Carbon-oxygen lyases.	probable
4.2.1.-	Hydro-lyases.	probable
4.2.1.96	4a-hydroxytetrahydrobiopterin dehydratase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RU0, chain A
Confidence level:very confident
Coverage over the Query: 5-103
View the alignment between query and template
View the model in PyMOL