Query         psy14694
Match_columns 102
No_of_seqs    113 out of 1848
Neff          11.4
Searched_HMMs 46136
Date          Fri Aug 16 18:15:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14694.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14694hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 1.7E-32 3.8E-37  156.2   4.0   92    2-102   162-253 (279)
  2 KOG2462|consensus               99.9 5.3E-28 1.1E-32  138.0   3.5   95    2-102   131-225 (279)
  3 KOG3576|consensus               99.8 2.2E-21 4.7E-26  107.2  -0.4   92    2-100   118-220 (267)
  4 KOG3623|consensus               99.8   2E-20 4.3E-25  118.8  -0.0   70   33-102   891-960 (1007)
  5 KOG3623|consensus               99.7 6.1E-19 1.3E-23  112.2   1.0   78    1-85    894-971 (1007)
  6 KOG3576|consensus               99.6 1.6E-17 3.4E-22   92.1  -0.8   70   33-102   114-183 (267)
  7 KOG3608|consensus               99.5 7.7E-15 1.7E-19   87.4   2.5   91    1-101   237-330 (467)
  8 PLN03086 PRLI-interacting fact  99.5 1.1E-13 2.4E-18   87.6   6.0   88    2-102   454-551 (567)
  9 KOG1074|consensus               99.4 9.2E-14   2E-18   90.1   2.0   67   35-101   604-677 (958)
 10 KOG3608|consensus               99.4 8.3E-14 1.8E-18   83.1   0.3   67   34-102   235-302 (467)
 11 PHA02768 hypothetical protein;  99.3 5.1E-13 1.1E-17   59.9   1.7   44   36-81      5-48  (55)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.3 5.2E-13 1.1E-17   51.8   0.5   24   79-102     1-24  (26)
 13 PHA00733 hypothetical protein   99.3 3.3E-12 7.2E-17   67.6   3.7   54   33-88     70-123 (128)
 14 PHA02768 hypothetical protein;  99.3 1.3E-12 2.8E-17   58.6   1.7   37   64-102     5-41  (55)
 15 KOG1074|consensus               99.3 1.6E-12 3.4E-17   84.5   2.7   83    1-90    605-694 (958)
 16 PHA00733 hypothetical protein   99.2 4.9E-12 1.1E-16   67.0   2.0   68   33-102    37-109 (128)
 17 PF13465 zf-H2C2_2:  Zinc-finge  99.1   5E-11 1.1E-15   46.2   1.5   25   51-75      1-25  (26)
 18 PLN03086 PRLI-interacting fact  99.0 1.5E-09 3.2E-14   69.4   6.4   93    3-102   409-514 (567)
 19 PHA00616 hypothetical protein   99.0 1.1E-10 2.4E-15   50.1   0.6   34   64-97      1-34  (44)
 20 KOG3993|consensus               98.7 1.1E-09 2.3E-14   67.2  -0.8   81    2-89    268-381 (500)
 21 PHA00732 hypothetical protein   98.7 8.7E-09 1.9E-13   50.2   2.2   47   36-88      1-48  (79)
 22 PHA00616 hypothetical protein   98.6 3.7E-08 8.1E-13   42.3   1.9   33    1-40      1-33  (44)
 23 PHA00732 hypothetical protein   98.5 1.2E-07 2.6E-12   46.2   2.9   47    1-60      1-48  (79)
 24 PF00096 zf-C2H2:  Zinc finger,  98.2 2.9E-07 6.3E-12   34.3   0.3   23   65-87      1-23  (23)
 25 PF05605 zf-Di19:  Drought indu  98.2 6.6E-06 1.4E-10   37.3   4.5   49    2-58      3-51  (54)
 26 KOG3993|consensus               98.1 2.7E-07 5.8E-12   57.0  -1.6   51   37-87    268-318 (500)
 27 PF00096 zf-C2H2:  Zinc finger,  98.1 2.9E-06 6.3E-11   31.5   1.7   22    2-24      1-22  (23)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.1 1.4E-06 3.1E-11   33.7   0.8   25   64-88      1-25  (27)
 29 PRK04860 hypothetical protein;  98.1 1.9E-06 4.1E-11   47.4   1.5   35   64-102   119-153 (160)
 30 PF05605 zf-Di19:  Drought indu  98.0 9.5E-06 2.1E-10   36.7   2.9   50   36-88      2-53  (54)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.0 4.2E-06 9.2E-11   32.3   1.3   25    1-26      1-25  (27)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.9 4.2E-06 9.1E-11   31.2   0.9   23   65-87      1-23  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.3E-05 2.8E-10   40.5   1.4   73    3-87      1-73  (100)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.7 3.8E-05 8.1E-10   28.4   2.1   23    2-25      1-23  (24)
 35 PF09237 GAGA:  GAGA factor;  I  97.7 2.5E-05 5.4E-10   34.4   1.4   32   61-92     21-52  (54)
 36 COG5189 SFP1 Putative transcri  97.7 2.6E-05 5.6E-10   47.0   1.7   40   62-101   347-407 (423)
 37 smart00355 ZnF_C2H2 zinc finge  97.6 4.1E-05 8.8E-10   28.8   1.6   24   65-88      1-24  (26)
 38 PRK04860 hypothetical protein;  97.5 9.2E-05   2E-09   40.9   2.4   39   36-78    119-157 (160)
 39 smart00355 ZnF_C2H2 zinc finge  97.3 0.00035 7.6E-09   26.1   2.4   23    2-25      1-23  (26)
 40 PF09237 GAGA:  GAGA factor;  I  97.1 0.00031 6.6E-09   31.1   1.3   32   33-64     21-52  (54)
 41 COG5189 SFP1 Putative transcri  97.1 0.00038 8.3E-09   42.2   1.9   53   33-85    346-419 (423)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00044 9.5E-09   26.6   1.3   22   65-86      2-23  (27)
 43 PF12874 zf-met:  Zinc-finger o  97.0  0.0002 4.4E-09   26.9   0.3   22   65-86      1-22  (25)
 44 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00023   5E-09   26.5   0.3   23   65-88      1-23  (24)
 45 cd00350 rubredoxin_like Rubred  96.7   0.001 2.3E-08   26.9   1.3    9   91-99     16-24  (33)
 46 PF12874 zf-met:  Zinc-finger o  96.7  0.0012 2.7E-08   24.7   1.4   23    2-25      1-23  (25)
 47 COG5048 FOG: Zn-finger [Genera  96.6  0.0016 3.5E-08   40.7   2.0   62   35-96    288-355 (467)
 48 PF12756 zf-C2H2_2:  C2H2 type   96.1  0.0016 3.4E-08   32.8   0.0   59   38-102     1-60  (100)
 49 COG2888 Predicted Zn-ribbon RN  95.9  0.0049 1.1E-07   28.2   1.2   32   64-100    27-58  (61)
 50 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0061 1.3E-07   23.0   1.2   21   65-86      3-23  (25)
 51 PF09986 DUF2225:  Uncharacteri  95.5  0.0067 1.4E-07   35.3   1.2   10   93-102    49-58  (214)
 52 smart00451 ZnF_U1 U1-like zinc  95.5   0.014   3E-07   23.6   1.8   23    1-24      3-25  (35)
 53 KOG2893|consensus               95.3  0.0071 1.5E-07   35.6   0.8   42   42-87     16-58  (341)
 54 cd00729 rubredoxin_SM Rubredox  95.2   0.013 2.8E-07   23.8   1.2    8   92-99     18-25  (34)
 55 TIGR00622 ssl1 transcription f  94.8    0.12 2.6E-06   27.0   4.3   26   63-88     80-105 (112)
 56 PRK14890 putative Zn-ribbon RN  94.8   0.019 4.1E-07   26.3   1.2   32   64-100    25-56  (59)
 57 COG1592 Rubrerythrin [Energy p  94.6   0.021 4.6E-07   31.9   1.4   23   64-99    134-156 (166)
 58 PF09723 Zn-ribbon_8:  Zinc rib  94.6   0.015 3.2E-07   24.8   0.6   29   65-100     6-34  (42)
 59 PRK00464 nrdR transcriptional   94.3   0.022 4.7E-07   31.5   1.0   12   65-76     29-40  (154)
 60 PF13719 zinc_ribbon_5:  zinc-r  94.3   0.035 7.6E-07   23.0   1.4   11   64-74     25-35  (37)
 61 TIGR02098 MJ0042_CXXC MJ0042 f  94.2   0.029 6.4E-07   23.2   1.1   10   92-101    25-34  (38)
 62 smart00834 CxxC_CXXC_SSSS Puta  94.2   0.019 4.2E-07   24.0   0.5   11   65-75      6-16  (41)
 63 TIGR02605 CxxC_CxxC_SSSS putat  94.1    0.02 4.3E-07   25.5   0.5   11   37-47      6-16  (52)
 64 KOG2186|consensus               93.5   0.035 7.6E-07   32.9   0.9   49   36-87      3-51  (276)
 65 PF13717 zinc_ribbon_4:  zinc-r  93.4   0.068 1.5E-06   22.0   1.5    9   92-100    25-33  (36)
 66 PHA00626 hypothetical protein   93.4   0.041 8.9E-07   24.9   0.9   15   63-77     22-36  (59)
 67 PRK00398 rpoP DNA-directed RNA  93.1   0.034 7.3E-07   24.1   0.4   12   36-47      3-14  (46)
 68 COG5048 FOG: Zn-finger [Genera  92.9   0.035 7.6E-07   34.8   0.4   61    1-68    289-355 (467)
 69 PF07754 DUF1610:  Domain of un  92.7   0.044 9.6E-07   20.5   0.3    9   92-100    16-24  (24)
 70 COG3357 Predicted transcriptio  92.6   0.082 1.8E-06   26.4   1.3   27   63-99     57-83  (97)
 71 smart00659 RPOLCX RNA polymera  92.6   0.089 1.9E-06   22.7   1.3   26   37-73      3-28  (44)
 72 TIGR00373 conserved hypothetic  92.2    0.12 2.6E-06   28.7   1.9   19   34-52    107-125 (158)
 73 PF13240 zinc_ribbon_2:  zinc-r  91.8    0.11 2.5E-06   19.1   1.0    7   95-101    16-22  (23)
 74 smart00531 TFIIE Transcription  91.7    0.18 3.9E-06   27.6   2.1   34   63-100    98-131 (147)
 75 PRK06266 transcription initiat  91.1    0.18 3.8E-06   28.6   1.8   13   65-77    118-130 (178)
 76 PF14353 CpXC:  CpXC protein     91.0   0.094   2E-06   27.9   0.6   10   38-47      3-12  (128)
 77 KOG2186|consensus               90.8    0.16 3.5E-06   30.3   1.4   46    2-57      4-49  (276)
 78 KOG2893|consensus               90.6     0.1 2.2E-06   30.9   0.5   41    4-55     13-53  (341)
 79 COG1996 RPC10 DNA-directed RNA  90.1    0.14 3.1E-06   22.6   0.7   12   35-46      5-16  (49)
 80 PF13451 zf-trcl:  Probable zin  89.7    0.13 2.9E-06   22.7   0.4   15   63-77      3-17  (49)
 81 PF09538 FYDLN_acid:  Protein o  89.6    0.35 7.6E-06   25.2   2.0   17   33-49     23-39  (108)
 82 COG1997 RPL43A Ribosomal prote  88.4    0.35 7.7E-06   24.0   1.4   33   35-77     34-66  (89)
 83 PRK03824 hypA hydrogenase nick  87.5    0.32   7E-06   26.3   1.0   12   65-76     71-82  (135)
 84 COG4049 Uncharacterized protei  87.5    0.17 3.7E-06   22.9  -0.0   26   33-58     14-39  (65)
 85 KOG1146|consensus               87.4    0.28   6E-06   35.8   0.9   24   63-86    517-540 (1406)
 86 PF05443 ROS_MUCR:  ROS/MUCR tr  84.9    0.48   1E-05   25.6   0.9   27   63-92     71-97  (132)
 87 PF10571 UPF0547:  Uncharacteri  84.4    0.48   1E-05   18.0   0.6    9   94-102    16-24  (26)
 88 KOG1146|consensus               84.3    0.37 8.1E-06   35.2   0.4   27   60-86    461-487 (1406)
 89 PF03604 DNA_RNApol_7kD:  DNA d  84.2     0.9   2E-05   18.2   1.3    7   65-71     18-24  (32)
 90 PF12760 Zn_Tnp_IS1595:  Transp  83.7    0.61 1.3E-05   20.2   0.8   11   90-100    35-45  (46)
 91 smart00614 ZnF_BED BED zinc fi  83.6    0.84 1.8E-05   20.1   1.3   21   65-85     19-44  (50)
 92 COG1773 Rubredoxin [Energy pro  83.0    0.98 2.1E-05   20.5   1.3   13   36-48      3-15  (55)
 93 PF02892 zf-BED:  BED zinc fing  82.8    0.65 1.4E-05   19.7   0.7   24   62-85     14-41  (45)
 94 PF08274 PhnA_Zn_Ribbon:  PhnA   82.8    0.51 1.1E-05   18.6   0.3    8   92-99     19-26  (30)
 95 COG5236 Uncharacterized conser  82.3     1.3 2.8E-05   28.0   2.1   51   46-97    198-252 (493)
 96 TIGR02300 FYDLN_acid conserved  81.9     1.4 3.1E-05   23.6   1.9   17   33-49     23-39  (129)
 97 PF01780 Ribosomal_L37ae:  Ribo  81.6    0.31 6.7E-06   24.5  -0.6   32   35-76     34-65  (90)
 98 COG3091 SprT Zn-dependent meta  81.3    0.75 1.6E-05   25.4   0.7   33   63-100   116-148 (156)
 99 TIGR00100 hypA hydrogenase nic  81.1    0.81 1.8E-05   24.1   0.8   12   65-76     71-82  (115)
100 PRK09678 DNA-binding transcrip  80.8    0.71 1.5E-05   22.2   0.5   41   37-79      2-44  (72)
101 smart00440 ZnF_C2C2 C2C2 Zinc   80.5    0.82 1.8E-05   19.2   0.6    9   65-73     29-37  (40)
102 PF11789 zf-Nse:  Zinc-finger o  80.4    0.64 1.4E-05   21.2   0.3   33   62-98     22-54  (57)
103 COG0068 HypF Hydrogenase matur  80.0    0.39 8.4E-06   33.0  -0.7   56   38-100   125-181 (750)
104 PRK12380 hydrogenase nickel in  79.8    0.99 2.1E-05   23.7   0.9   12   65-76     71-82  (113)
105 PF09845 DUF2072:  Zn-ribbon co  79.0     1.2 2.6E-05   24.0   1.1   15   64-78      1-15  (131)
106 PF14311 DUF4379:  Domain of un  78.9     1.6 3.5E-05   19.6   1.3   15   65-79     29-43  (55)
107 COG1198 PriA Primosomal protei  78.7     1.3 2.8E-05   30.8   1.3   22   79-100   462-483 (730)
108 PRK03564 formate dehydrogenase  78.4     1.7 3.7E-05   27.1   1.7   10   90-99    250-259 (309)
109 PRK03681 hypA hydrogenase nick  76.0     1.2 2.7E-05   23.3   0.6   11   65-75     71-81  (114)
110 PRK00564 hypA hydrogenase nick  75.6     1.5 3.2E-05   23.2   0.8   12   65-76     72-83  (117)
111 smart00734 ZnF_Rad18 Rad18-lik  75.2     2.4 5.1E-05   16.0   1.1   19   66-85      3-21  (26)
112 PF04810 zf-Sec23_Sec24:  Sec23  75.0     1.6 3.5E-05   18.3   0.7    9   63-71     23-31  (40)
113 PF03811 Zn_Tnp_IS1:  InsA N-te  74.8     1.8 3.8E-05   17.8   0.8   31   65-99      6-36  (36)
114 PF01428 zf-AN1:  AN1-like Zinc  74.8    0.68 1.5E-05   19.7  -0.5   11   92-102    13-23  (43)
115 PF12907 zf-met2:  Zinc-binding  74.2    0.51 1.1E-05   20.0  -0.9   26   65-90      2-31  (40)
116 TIGR01206 lysW lysine biosynth  73.9       2 4.4E-05   19.4   0.9    9   38-46      4-12  (54)
117 PF07282 OrfB_Zn_ribbon:  Putat  73.8     1.9 4.1E-05   20.2   0.9   14   62-75     44-57  (69)
118 smart00154 ZnF_AN1 AN1-like Zi  73.6     1.6 3.4E-05   18.3   0.5   11   92-102    12-22  (39)
119 TIGR01562 FdhE formate dehydro  73.5     3.6 7.9E-05   25.6   2.2   10   90-99    250-259 (305)
120 COG5432 RAD18 RING-finger-cont  73.4     1.5 3.2E-05   27.1   0.5   26   70-101    43-68  (391)
121 PF12013 DUF3505:  Protein of u  73.1     2.2 4.8E-05   22.0   1.1   26   64-89     80-109 (109)
122 KOG3408|consensus               72.4     1.5 3.4E-05   23.3   0.4   26   61-86     54-79  (129)
123 PF02176 zf-TRAF:  TRAF-type zi  72.4     2.1 4.6E-05   19.3   0.9   41   35-75      8-53  (60)
124 PF15269 zf-C2H2_7:  Zinc-finge  72.2     2.1 4.5E-05   18.5   0.7   21   65-85     21-41  (54)
125 PF14787 zf-CCHC_5:  GAG-polypr  72.1     1.9   4E-05   17.8   0.5    9   94-102     4-12  (36)
126 PF01155 HypA:  Hydrogenase exp  71.7     1.3 2.7E-05   23.3  -0.0   13   65-77     71-83  (113)
127 smart00132 LIM Zinc-binding do  71.6     2.6 5.6E-05   16.7   1.0    8   93-100    28-35  (39)
128 COG1675 TFA1 Transcription ini  71.2     5.4 0.00012   22.8   2.4    7   65-71    133-139 (176)
129 KOG0978|consensus               70.4     1.7 3.7E-05   30.0   0.4   16   87-102   673-688 (698)
130 PRK14714 DNA polymerase II lar  70.2     7.8 0.00017   29.0   3.4   12   64-75    692-703 (1337)
131 COG3677 Transposase and inacti  70.2     2.2 4.8E-05   23.0   0.7   15   88-102    49-63  (129)
132 PF01096 TFIIS_C:  Transcriptio  69.8    0.63 1.4E-05   19.4  -1.1    9   93-101    29-37  (39)
133 PF04959 ARS2:  Arsenite-resist  69.5    0.79 1.7E-05   26.9  -1.1   27   64-90     77-103 (214)
134 PTZ00255 60S ribosomal protein  69.5     2.1 4.5E-05   21.6   0.5   34   34-77     34-67  (90)
135 COG1571 Predicted DNA-binding   68.7     3.7 8.1E-05   26.7   1.6   14   64-77    367-380 (421)
136 PF04423 Rad50_zn_hook:  Rad50   68.4     1.3 2.8E-05   19.8  -0.3    9   94-102    22-30  (54)
137 COG3364 Zn-ribbon containing p  67.9     3.5 7.6E-05   21.3   1.1   12   36-47      2-13  (112)
138 cd00065 FYVE FYVE domain; Zinc  66.7     5.3 0.00011   17.7   1.5   28   38-77      4-31  (57)
139 PF07295 DUF1451:  Protein of u  66.5     3.2 6.9E-05   22.9   0.9    8   65-72    113-120 (146)
140 PF02891 zf-MIZ:  MIZ/SP-RING z  66.5     1.2 2.5E-05   19.8  -0.7    8   93-100    42-49  (50)
141 PF11672 DUF3268:  Protein of u  65.4     5.3 0.00011   20.7   1.5    7   65-71     32-38  (102)
142 PF13878 zf-C2H2_3:  zinc-finge  65.1      10 0.00022   15.9   2.4   23    3-25     15-38  (41)
143 PF15135 UPF0515:  Uncharacteri  64.9     9.8 0.00021   23.1   2.7   57   33-102   109-165 (278)
144 PF13824 zf-Mss51:  Zinc-finger  64.1     4.3 9.2E-05   18.5   0.9   13   89-101    11-23  (55)
145 PF10263 SprT-like:  SprT-like   63.1     2.5 5.5E-05   23.1   0.1   30   64-101   123-152 (157)
146 PF13453 zf-TFIIB:  Transcripti  63.1     3.4 7.5E-05   17.3   0.5   19   63-81     18-36  (41)
147 COG1655 Uncharacterized protei  62.9     2.6 5.6E-05   25.2   0.1   26   33-58     16-41  (267)
148 PRK00762 hypA hydrogenase nick  62.1     4.2 9.1E-05   21.7   0.8   10   65-75     71-80  (124)
149 PF08209 Sgf11:  Sgf11 (transcr  61.0     2.3   5E-05   17.1  -0.2   10   92-101     4-13  (33)
150 PF07975 C1_4:  TFIIH C1-like d  60.9     4.3 9.3E-05   18.2   0.6   25   63-87     20-44  (51)
151 TIGR03831 YgiT_finger YgiT-typ  60.8     3.2   7E-05   17.4   0.2   13   89-101    29-41  (46)
152 PLN02294 cytochrome c oxidase   60.6     3.8 8.1E-05   23.3   0.5   17   85-102   135-151 (174)
153 PRK04023 DNA polymerase II lar  60.6      10 0.00022   27.8   2.5    9   92-100   663-671 (1121)
154 PF14205 Cys_rich_KTR:  Cystein  60.5     4.9 0.00011   18.2   0.7    9   64-72     28-36  (55)
155 PF08790 zf-LYAR:  LYAR-type C2  60.1     3.6 7.9E-05   15.9   0.3    9   66-74      2-10  (28)
156 PRK05978 hypothetical protein;  60.0     6.1 0.00013   21.9   1.2   10   66-75     54-63  (148)
157 PF14634 zf-RING_5:  zinc-RING   59.6     9.8 0.00021   16.0   1.6   11   90-100    34-44  (44)
158 PF02591 DUF164:  Putative zinc  59.6     5.2 0.00011   18.0   0.8   10   90-99     44-53  (56)
159 PF01927 Mut7-C:  Mut7-C RNAse   59.5     5.3 0.00011   21.9   0.9   13   90-102   122-134 (147)
160 smart00064 FYVE Protein presen  57.8     8.2 0.00018   17.9   1.3   28   37-76     11-38  (68)
161 smart00661 RPOL9 RNA polymeras  57.5     9.8 0.00021   16.5   1.5   14   64-77     20-33  (52)
162 COG4957 Predicted transcriptio  57.4       5 0.00011   21.9   0.6   25   65-92     77-101 (148)
163 PF14446 Prok-RING_1:  Prokaryo  57.3     7.7 0.00017   17.6   1.1   11   63-73     20-30  (54)
164 COG4896 Uncharacterized protei  56.9     4.7  0.0001   18.7   0.4   51   38-92      4-55  (68)
165 KOG2907|consensus               56.9     7.6 0.00017   20.5   1.2   36   65-102    75-112 (116)
166 PRK01343 zinc-binding protein;  56.6       8 0.00017   17.8   1.1    9   65-73     10-18  (57)
167 PF01363 FYVE:  FYVE zinc finge  56.3     5.3 0.00012   18.6   0.6   28   36-75      9-36  (69)
168 smart00731 SprT SprT homologue  55.9     6.8 0.00015   21.4   1.0   31   64-101   112-142 (146)
169 COG1327 Predicted transcriptio  55.8     6.5 0.00014   21.9   0.9   13   64-76     28-40  (156)
170 COG4888 Uncharacterized Zn rib  55.6     2.3 5.1E-05   21.8  -0.8   38   34-75     20-57  (104)
171 KOG2593|consensus               55.4      12 0.00026   24.6   2.1   38   33-73    125-162 (436)
172 PF06397 Desulfoferrod_N:  Desu  55.1     4.5 9.8E-05   16.7   0.2   10   91-100     5-14  (36)
173 TIGR00244 transcriptional regu  55.1     6.6 0.00014   21.8   0.8   14   64-77     28-41  (147)
174 KOG4173|consensus               54.6     1.5 3.3E-05   25.6  -1.7   19    3-22    108-126 (253)
175 PRK00432 30S ribosomal protein  54.4     8.3 0.00018   17.1   1.0    9   64-72     37-45  (50)
176 PF10013 DUF2256:  Uncharacteri  54.2     5.9 0.00013   16.9   0.4    8   95-102    11-18  (42)
177 KOG4167|consensus               54.1     3.3 7.1E-05   29.0  -0.5   24    2-26    793-816 (907)
178 PHA02998 RNA polymerase subuni  53.8     5.8 0.00013   22.7   0.5   12   65-76    172-183 (195)
179 cd00924 Cyt_c_Oxidase_Vb Cytoc  53.7     5.5 0.00012   20.4   0.4   18   84-102    72-89  (97)
180 TIGR00595 priA primosomal prot  53.6     9.1  0.0002   25.6   1.4   21   80-100   241-261 (505)
181 COG1885 Uncharacterized protei  53.1     6.5 0.00014   20.4   0.6    9   93-101    50-58  (115)
182 COG0675 Transposase and inacti  52.2     7.7 0.00017   23.9   0.9   12   63-74    321-332 (364)
183 PRK05580 primosome assembly pr  52.1      11 0.00023   26.3   1.6   21   80-100   409-429 (679)
184 KOG3214|consensus               51.5     4.9 0.00011   20.6   0.0   13   65-77     48-60  (109)
185 PF09416 UPF1_Zn_bind:  RNA hel  50.5      19 0.00041   20.2   2.1   43    3-45     16-69  (152)
186 PF14369 zf-RING_3:  zinc-finge  50.2     6.3 0.00014   16.0   0.2    9   94-102    23-31  (35)
187 COG5216 Uncharacterized conser  49.6      12 0.00025   17.3   1.0   26   42-72     27-52  (67)
188 PRK14873 primosome assembly pr  49.5     8.6 0.00019   26.8   0.9   10   91-100   421-430 (665)
189 PRK08222 hydrogenase 4 subunit  49.4     9.5 0.00021   21.8   0.9   38   63-100   113-162 (181)
190 PF13248 zf-ribbon_3:  zinc-rib  49.4     6.6 0.00014   14.6   0.2    6   95-100    19-24  (26)
191 PF09963 DUF2197:  Uncharacteri  48.3     6.8 0.00015   17.9   0.2   36   37-72      3-39  (56)
192 COG1326 Uncharacterized archae  48.3      16 0.00034   21.4   1.6   36   35-76      5-42  (201)
193 PF00412 LIM:  LIM domain;  Int  47.7     7.9 0.00017   17.1   0.4   15   64-78     26-40  (58)
194 PRK14892 putative transcriptio  47.2      11 0.00024   19.4   0.9   11   65-75     43-53  (99)
195 PRK12387 formate hydrogenlyase  47.2     5.3 0.00012   22.7  -0.3   18   63-80    113-130 (180)
196 PF15616 TerY-C:  TerY-C metal   47.1     9.8 0.00021   20.7   0.7   14   88-101   101-114 (131)
197 PF10276 zf-CHCC:  Zinc-finger   47.0     5.2 0.00011   16.9  -0.3   11   92-102    29-39  (40)
198 KOG1729|consensus               46.9      12 0.00026   23.3   1.1   53   35-98    167-220 (288)
199 KOG2482|consensus               45.9      22 0.00048   22.8   2.1   29    2-31    196-224 (423)
200 PF10083 DUF2321:  Uncharacteri  45.8      13 0.00029   20.8   1.1   16   63-78     67-82  (158)
201 KOG0782|consensus               45.5     7.7 0.00017   26.6   0.2   24   79-102   240-263 (1004)
202 PTZ00448 hypothetical protein;  45.1      21 0.00047   23.0   2.0   23    2-25    315-337 (373)
203 PF09297 zf-NADH-PPase:  NADH p  45.1      12 0.00026   14.6   0.7   12   89-100    18-29  (32)
204 PF05129 Elf1:  Transcription e  44.9     4.3 9.4E-05   20.0  -0.8   39   34-76     20-58  (81)
205 PF08792 A2L_zn_ribbon:  A2L zi  44.8     7.9 0.00017   15.5   0.1    9   93-101    22-30  (33)
206 KOG2785|consensus               44.2      39 0.00085   22.0   3.0   23    3-26    168-190 (390)
207 PRK05452 anaerobic nitric oxid  44.1      16 0.00034   24.4   1.4   16   62-77    423-438 (479)
208 KOG0717|consensus               43.8      11 0.00023   25.2   0.6   22   65-86    293-314 (508)
209 KOG1409|consensus               43.5     4.8  0.0001   25.6  -0.9   37   65-102   283-319 (404)
210 PF00301 Rubredoxin:  Rubredoxi  43.5     9.9 0.00022   16.6   0.3    9   92-100    34-42  (47)
211 PF00130 C1_1:  Phorbol esters/  43.4      24 0.00053   15.3   1.6    8   64-71     28-35  (53)
212 KOG3002|consensus               43.3      34 0.00073   21.5   2.6   61   34-98     78-142 (299)
213 PRK04351 hypothetical protein;  43.2      12 0.00027   20.7   0.7   29   64-100   112-140 (149)
214 PRK14559 putative protein seri  42.8      32 0.00068   24.1   2.7    8    3-10      3-10  (645)
215 smart00109 C1 Protein kinase C  42.7      24 0.00053   14.7   1.6    7   65-71     28-34  (49)
216 PRK07591 threonine synthase; V  42.6      17 0.00036   23.8   1.3   27   36-75     18-44  (421)
217 PF15227 zf-C3HC4_4:  zinc fing  42.5      21 0.00045   15.0   1.3   27   70-98     16-42  (42)
218 cd00730 rubredoxin Rubredoxin;  42.0      11 0.00024   16.7   0.4    9   92-100    34-42  (50)
219 COG2331 Uncharacterized protei  41.8     8.1 0.00018   18.9  -0.1   10    2-11     13-22  (82)
220 PRK12496 hypothetical protein;  41.3      24 0.00052   19.9   1.7   12   37-48    128-139 (164)
221 PF14803 Nudix_N_2:  Nudix N-te  40.8      12 0.00025   15.2   0.3    7   93-99     23-29  (34)
222 KOG2923|consensus               40.8      34 0.00075   16.1   1.9   25   42-71     27-51  (67)
223 cd00974 DSRD Desulforedoxin (D  40.7      11 0.00025   14.9   0.3    9   92-100     4-12  (34)
224 KOG2231|consensus               40.6      49  0.0011   23.4   3.2   19   39-57    185-203 (669)
225 PF01286 XPA_N:  XPA protein N-  40.3     8.1 0.00018   15.7  -0.2   14   65-78      4-17  (34)
226 PF07649 C1_3:  C1-like domain;  39.2      11 0.00024   14.4   0.1   10   91-100    14-23  (30)
227 TIGR00319 desulf_FeS4 desulfof  39.1      12 0.00027   14.8   0.3    9   92-100     7-15  (34)
228 PTZ00043 cytochrome c oxidase   38.6      14  0.0003   22.2   0.5   15   88-102   177-191 (268)
229 smart00647 IBR In Between Ring  37.9      20 0.00043   16.1   0.9   17   61-77     37-53  (64)
230 PF01215 COX5B:  Cytochrome c o  37.6     9.4  0.0002   20.9  -0.2   18   84-102   105-122 (136)
231 PRK08270 anaerobic ribonucleos  37.5      23  0.0005   24.8   1.5    9   92-100   639-647 (656)
232 KOG2636|consensus               37.5      24 0.00052   23.5   1.4   27   57-83    394-421 (497)
233 PHA02942 putative transposase;  37.4      22 0.00048   23.0   1.3   11   90-100   340-350 (383)
234 PRK10220 hypothetical protein;  36.9      44 0.00096   17.6   2.1   18   33-50     17-34  (111)
235 PF10071 DUF2310:  Zn-ribbon-co  36.8      23  0.0005   21.7   1.2   28   65-99    221-248 (258)
236 cd04476 RPA1_DBD_C RPA1_DBD_C:  36.4      18 0.00039   20.1   0.8   12   63-74     50-61  (166)
237 PF04438 zf-HIT:  HIT zinc fing  36.3     9.1  0.0002   14.9  -0.3    9   92-100    13-21  (30)
238 PF14149 YhfH:  YhfH-like prote  36.1     5.6 0.00012   16.5  -1.0    7   94-100    15-21  (37)
239 COG4306 Uncharacterized protei  35.9      39 0.00084   18.3   1.8   16   62-77     66-81  (160)
240 TIGR00627 tfb4 transcription f  35.5      33 0.00071   21.3   1.7   25   64-102   255-279 (279)
241 PF05741 zf-nanos:  Nanos RNA b  35.3      15 0.00032   16.8   0.2    9   91-99     32-40  (55)
242 PF09082 DUF1922:  Domain of un  35.2      13 0.00029   17.7   0.1   14   60-74     16-29  (68)
243 TIGR00686 phnA alkylphosphonat  34.8      36 0.00077   17.9   1.6   17   34-50     17-33  (109)
244 PF11023 DUF2614:  Protein of u  34.7      17 0.00037   19.2   0.4   12   89-100    66-77  (114)
245 PF04032 Rpr2:  RNAse P Rpr2/Rp  34.5      16 0.00035   17.7   0.3   37   63-99     45-84  (85)
246 TIGR00280 L37a ribosomal prote  34.4      13 0.00029   18.8   0.0   10   92-101    53-62  (91)
247 COG4530 Uncharacterized protei  34.1      20 0.00044   18.9   0.6   11   92-102    26-36  (129)
248 COG4391 Uncharacterized protei  33.6      16 0.00035   17.0   0.2    8   93-100    49-56  (62)
249 PRK11032 hypothetical protein;  33.6      24 0.00051   20.0   0.9    7   65-71    125-131 (160)
250 PF04780 DUF629:  Protein of un  33.6      41  0.0009   22.6   2.1   24    2-26     58-81  (466)
251 CHL00174 accD acetyl-CoA carbo  33.5      25 0.00055   22.0   1.1   13   35-47     56-68  (296)
252 KOG2461|consensus               33.4      70  0.0015   21.1   3.0   57   44-100   339-395 (396)
253 PF02146 SIR2:  Sir2 family;  I  33.3      25 0.00054   19.8   1.0   12   65-76    106-117 (178)
254 KOG3507|consensus               33.1      24 0.00053   16.3   0.7   13   63-75     36-48  (62)
255 PRK03976 rpl37ae 50S ribosomal  32.6      15 0.00032   18.6   0.0   10   92-101    54-63  (90)
256 PF07503 zf-HYPF:  HypF finger;  32.5     3.4 7.3E-05   16.9  -1.9    7   66-72     23-29  (35)
257 PF05876 Terminase_GpA:  Phage   32.0      31 0.00068   23.6   1.4    8   93-100   230-237 (557)
258 PF00628 PHD:  PHD-finger;  Int  31.8      31 0.00068   14.7   1.0   38   62-99     12-49  (51)
259 PF14952 zf-tcix:  Putative tre  31.5      20 0.00042   15.5   0.3    6   94-99     13-18  (44)
260 cd01675 RNR_III Class III ribo  31.5      37  0.0008   23.3   1.7    9   92-100   532-540 (555)
261 PLN03238 probable histone acet  31.5      39 0.00084   21.1   1.6   26   62-87     46-71  (290)
262 COG1631 RPL42A Ribosomal prote  31.3      17 0.00038   18.4   0.1   10   92-101    68-77  (94)
263 PF04216 FdhE:  Protein involve  30.9     6.9 0.00015   24.0  -1.6   12   88-99    234-245 (290)
264 TIGR00515 accD acetyl-CoA carb  30.7      29 0.00064   21.6   1.0   11   37-47     46-56  (285)
265 COG5112 UFD2 U1-like Zn-finger  30.3      12 0.00027   19.5  -0.5   24   63-86     54-77  (126)
266 KOG0696|consensus               30.1      23 0.00051   23.7   0.6   36   64-99     92-128 (683)
267 TIGR02487 NrdD anaerobic ribon  30.1      37 0.00081   23.4   1.5    8   93-100   539-546 (579)
268 TIGR00310 ZPR1_znf ZPR1 zinc f  29.7      19 0.00042   20.9   0.2   13   64-76     30-42  (192)
269 cd01410 SIRT7 SIRT7: Eukaryoti  29.5      68  0.0015   18.8   2.4   12   64-75     95-106 (206)
270 PF04606 Ogr_Delta:  Ogr/Delta-  29.2      12 0.00026   16.2  -0.6   11   65-75     26-38  (47)
271 PF12230 PRP21_like_P:  Pre-mRN  29.1      18  0.0004   21.4   0.0   30   63-93    167-196 (229)
272 PRK14704 anaerobic ribonucleos  29.0      38 0.00083   23.6   1.4    7   93-99    573-579 (618)
273 cd01413 SIR2_Af2 SIR2_Af2: Arc  28.6      57  0.0012   19.3   2.0   15   63-77    112-126 (222)
274 KOG4602|consensus               28.5      30 0.00065   21.3   0.8   38   63-100   232-276 (318)
275 PF10609 ParA:  ParA/MinD ATPas  28.5      21 0.00046   17.6   0.2    8   93-100    66-73  (81)
276 COG1439 Predicted nucleic acid  28.4      30 0.00064   19.9   0.7   11   65-75    140-150 (177)
277 PF10058 DUF2296:  Predicted in  28.2      24 0.00051   15.9   0.3    8   92-99     44-51  (54)
278 PRK00481 NAD-dependent deacety  28.2      55  0.0012   19.6   1.9   15   63-77    121-135 (242)
279 COG5533 UBP5 Ubiquitin C-termi  28.0      27 0.00059   22.2   0.6   13   88-100   280-292 (415)
280 PF06220 zf-U1:  U1 zinc finger  27.7      47   0.001   13.7   1.1   11    2-12      4-14  (38)
281 KOG2071|consensus               27.6      41  0.0009   23.2   1.4   26   62-87    416-441 (579)
282 COG4338 Uncharacterized protei  27.4      22 0.00047   15.7   0.1    7   95-101    15-21  (54)
283 PF12677 DUF3797:  Domain of un  27.2      26 0.00056   15.5   0.3    6   94-99     15-20  (49)
284 PF03966 Trm112p:  Trm112p-like  27.0      20 0.00044   16.8  -0.0   16   87-102    48-63  (68)
285 PRK05654 acetyl-CoA carboxylas  26.8      35 0.00075   21.3   0.9   11   37-47     47-57  (292)
286 TIGR02159 PA_CoA_Oxy4 phenylac  26.8      14  0.0003   20.5  -0.7   35   65-102   106-140 (146)
287 PF10537 WAC_Acf1_DNA_bd:  ATP-  26.3 1.1E+02  0.0023   15.9   2.8   36    2-45      4-39  (102)
288 PF00935 Ribosomal_L44:  Riboso  26.2      24 0.00051   17.3   0.1   10   92-101    53-62  (77)
289 PRK07111 anaerobic ribonucleos  25.5      48   0.001   23.7   1.4    7   93-99    694-700 (735)
290 PF06524 NOA36:  NOA36 protein;  25.4      30 0.00064   21.4   0.4   11   63-73    208-218 (314)
291 TIGR00143 hypF [NiFe] hydrogen  25.2      12 0.00025   26.4  -1.4   55   38-99     92-147 (711)
292 KOG4118|consensus               24.9      33 0.00071   16.3   0.4   23   64-86     38-60  (74)
293 PF10367 Vps39_2:  Vacuolar sor  24.5      34 0.00074   17.2   0.5    7   95-101    81-87  (109)
294 PF05495 zf-CHY:  CHY zinc fing  24.4     8.3 0.00018   18.4  -1.7   30   64-101    41-70  (71)
295 TIGR02827 RNR_anaer_Bdell anae  24.2      54  0.0012   22.8   1.5    8   92-99    546-553 (586)
296 PF02748 PyrI_C:  Aspartate car  23.6      25 0.00055   15.7  -0.1   13   88-100    31-43  (52)
297 PF02318 FYVE_2:  FYVE-type zin  23.4      31 0.00068   18.2   0.3   49   36-100    54-102 (118)
298 COG1594 RPB9 DNA-directed RNA   23.4      33 0.00072   18.1   0.3    9   93-101   101-109 (113)
299 PRK06921 hypothetical protein;  23.1      43 0.00092   20.5   0.8   11   90-100    30-40  (266)
300 PF11931 DUF3449:  Domain of un  23.0      28  0.0006   20.4   0.0   25   59-83     96-121 (196)
301 COG0846 SIR2 NAD-dependent pro  23.0      52  0.0011   20.1   1.1   34   63-100   121-154 (250)
302 PRK12722 transcriptional activ  22.9      71  0.0015   18.7   1.6   28   64-99    134-161 (187)
303 PF02150 RNA_POL_M_15KD:  RNA p  22.8      26 0.00056   14.1  -0.1    7   66-72     22-28  (35)
304 COG2995 PqiA Uncharacterized p  22.6      63  0.0014   21.3   1.4   33   36-76     18-50  (418)
305 KOG4727|consensus               22.4      37 0.00079   19.5   0.4   21   64-84     75-95  (193)
306 smart00249 PHD PHD zinc finger  22.3      47   0.001   13.3   0.7   12   90-101    12-23  (47)
307 TIGR03830 CxxCG_CxxCG_HTH puta  22.3   1E+02  0.0022   16.0   2.1   19    2-21     32-50  (127)
308 PF06170 DUF983:  Protein of un  22.1      42 0.00091   16.8   0.5   10    3-12     10-19  (86)
309 TIGR03829 YokU_near_AblA uncha  21.9      83  0.0018   16.0   1.5   16    2-18     36-51  (89)
310 COG1579 Zn-ribbon protein, pos  21.8      67  0.0014   19.6   1.4   11   89-99    218-228 (239)
311 PRK03922 hypothetical protein;  21.8      42 0.00091   17.7   0.5    7   95-101    52-58  (113)
312 PRK08271 anaerobic ribonucleos  21.5      72  0.0016   22.4   1.6    8   92-99    580-587 (623)
313 PF08271 TF_Zn_Ribbon:  TFIIB z  21.5      41 0.00088   14.1   0.4    8   65-72     20-27  (43)
314 KOG1280|consensus               21.3      95  0.0021   20.2   2.0   23   64-86     79-101 (381)
315 cd02335 ZZ_ADA2 Zinc finger, Z  21.3      94   0.002   13.4   1.9    8   35-42     14-21  (49)
316 PRK02935 hypothetical protein;  21.3      44 0.00095   17.5   0.5   13   88-100    66-78  (110)
317 PTZ00303 phosphatidylinositol   21.2      75  0.0016   23.3   1.7   32   37-75    461-492 (1374)
318 PF01485 IBR:  IBR domain;  Int  21.1      38 0.00083   15.1   0.3    9   93-101    41-49  (64)
319 PRK07218 replication factor A;  21.0      61  0.0013   21.5   1.2   10   65-74    298-307 (423)
320 PLN00104 MYST -like histone ac  21.0      52  0.0011   22.0   0.9   26   62-87    196-221 (450)
321 PRK12860 transcriptional activ  20.9      80  0.0017   18.5   1.5   29   63-99    133-161 (189)
322 PF09855 DUF2082:  Nucleic-acid  20.8      52  0.0011   15.5   0.7    9   65-73      1-9   (64)
323 PTZ00064 histone acetyltransfe  20.6      61  0.0013   22.2   1.1   26   62-87    278-303 (552)
324 PF13696 zf-CCHC_2:  Zinc knuck  20.5      42 0.00092   13.4   0.3    8   93-100     9-16  (32)
325 PRK05767 rpl44e 50S ribosomal   20.5      36 0.00078   17.4   0.1    9   93-101    68-76  (92)
326 PF14690 zf-ISL3:  zinc-finger   20.4      54  0.0012   13.7   0.7    6    3-8       4-9   (47)
327 PRK08579 anaerobic ribonucleos  20.3      76  0.0016   22.3   1.6    8   92-99    582-589 (625)
328 KOG1088|consensus               20.2      54  0.0012   17.6   0.7   22   58-79     92-113 (124)
329 KOG1008|consensus               20.1      39 0.00084   23.9   0.2   38   65-102   737-776 (783)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=1.7e-32  Score=156.21  Aligned_cols=92  Identities=18%  Similarity=0.361  Sum_probs=86.3

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLM   81 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~   81 (102)
                      +.|+.|++.|. +-..|..|+++|+        -++.|.+||+.|..++-|+.|+|+|+|||||.|..|+++|.+.+||+
T Consensus       162 ~~C~~C~K~Yv-SmpALkMHirTH~--------l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  162 FSCKYCGKVYV-SMPALKMHIRTHT--------LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             ccCCCCCceee-ehHHHhhHhhccC--------CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHH
Confidence            56888888888 8888888888864        67899999999999999999999999999999999999999999999


Q ss_pred             hhhhhcCCCCccccccccccC
Q psy14694         82 SHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        82 ~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .|+++|.+.|.|+|+.|+|+|
T Consensus       233 AHmQTHS~~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  233 AHMQTHSDVKKHQCPRCGKSF  253 (279)
T ss_pred             HHHHhhcCCccccCcchhhHH
Confidence            999999999999999999998


No 2  
>KOG2462|consensus
Probab=99.94  E-value=5.3e-28  Score=138.03  Aligned_cols=95  Identities=19%  Similarity=0.322  Sum_probs=88.5

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLM   81 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~   81 (102)
                      |+|..|++.+. ...+|..|..+|....   ..+-+.|..|++.+....+|.+|+++|+  .+++|.+||+.|.++=.|+
T Consensus       131 ~~c~eCgk~ys-T~snLsrHkQ~H~~~~---s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  131 YKCPECGKSYS-TSSNLSRHKQTHRSLD---SKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             eeccccccccc-cccccchhhccccccc---ccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhh
Confidence            68999999999 8899999999987444   4677899999999999999999999997  6899999999999999999


Q ss_pred             hhhhhcCCCCccccccccccC
Q psy14694         82 SHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        82 ~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .|+|+|||||||.|+.|+|+|
T Consensus       205 GHiRTHTGEKPF~C~hC~kAF  225 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAF  225 (279)
T ss_pred             cccccccCCCCccCCcccchh
Confidence            999999999999999999998


No 3  
>KOG3576|consensus
Probab=99.81  E-value=2.2e-21  Score=107.23  Aligned_cols=92  Identities=26%  Similarity=0.417  Sum_probs=83.6

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLM   81 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~   81 (102)
                      |.|..|++.|. ....|.+|++.|.      ..+.+-|..||+.|.....|.+|.++|+|.+||+|..|+++|.+.-.|.
T Consensus       118 ftCrvCgK~F~-lQRmlnrh~kch~------~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsle  190 (267)
T KOG3576|consen  118 FTCRVCGKKFG-LQRMLNRHLKCHS------DVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLE  190 (267)
T ss_pred             eeeehhhhhhh-HHHHHHHHhhhcc------HHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHH
Confidence            67999999998 8889999999988      8888999999999999999999999999999999999999999999999


Q ss_pred             hhhhh-c----------CCCCccccccccc
Q psy14694         82 SHPLV-Q----------ISDEQLRFKKIRI  100 (102)
Q Consensus        82 ~h~~~-~----------~~~~~~~C~~c~~  100 (102)
                      .|.+- |          ..++.|.|.+||.
T Consensus       191 shl~kvhgv~~~yaykerr~kl~vcedcg~  220 (267)
T KOG3576|consen  191 SHLKKVHGVQHQYAYKERRAKLYVCEDCGY  220 (267)
T ss_pred             HHHHHHcCchHHHHHHHhhhheeeecccCC
Confidence            99554 5          3467789999985


No 4  
>KOG3623|consensus
Probab=99.78  E-value=2e-20  Score=118.78  Aligned_cols=70  Identities=21%  Similarity=0.466  Sum_probs=65.6

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .+.+|.|+.|.+.|...+.|.+|...|+|.+||+|.+|.++|..+-.|..|.|.|.|||||.|++|+|.|
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRF  960 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRF  960 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhc
Confidence            5677999999999999999999999999999999999999999999999999999999999999999987


No 5  
>KOG3623|consensus
Probab=99.73  E-value=6.1e-19  Score=112.20  Aligned_cols=78  Identities=21%  Similarity=0.499  Sum_probs=73.3

Q ss_pred             CccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhh
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANL   80 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l   80 (102)
                      +|.|+.|+|+|. ..+.|.+|.-.|+      |.+||+|.+|.+.|.....|..|.|.|.|||||+|.+|++.|+....+
T Consensus       894 myaCDqCDK~Fq-KqSSLaRHKYEHs------GqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSY  966 (1007)
T KOG3623|consen  894 MYACDQCDKAFQ-KQSSLARHKYEHS------GQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSY  966 (1007)
T ss_pred             cchHHHHHHHHH-hhHHHHHhhhhhc------CCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccch
Confidence            588999999998 8888999999988      999999999999999999999999999999999999999999999888


Q ss_pred             hhhhh
Q psy14694         81 MSHPL   85 (102)
Q Consensus        81 ~~h~~   85 (102)
                      .+|+-
T Consensus       967 SQHMN  971 (1007)
T KOG3623|consen  967 SQHMN  971 (1007)
T ss_pred             Hhhhc
Confidence            88864


No 6  
>KOG3576|consensus
Probab=99.64  E-value=1.6e-17  Score=92.14  Aligned_cols=70  Identities=16%  Similarity=0.304  Sum_probs=66.6

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      +...+.|..|++.|....-|.+|+.-|...+.+-|..||+.|.+.-.|++|.|+|+|.+||+|..|+|+|
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaf  183 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAF  183 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHH
Confidence            4566899999999999999999999999999999999999999999999999999999999999999997


No 7  
>KOG3608|consensus
Probab=99.51  E-value=7.7e-15  Score=87.40  Aligned_cols=91  Identities=21%  Similarity=0.469  Sum_probs=66.3

Q ss_pred             CccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhh-hcCCCCccCCCCCCccCCchh
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRA-HIGDRPYKCFVCPYRSNQRAN   79 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~-h~~~~~~~c~~c~~~f~~~~~   79 (102)
                      ||.|..|.+.|. ....|..|+..|-        .-|+|+.|.......+.|..|++. |...|||+|..|++.+...+.
T Consensus       237 ~fqC~~C~KrFa-TeklL~~Hv~rHv--------n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esd  307 (467)
T KOG3608|consen  237 SFQCAQCFKRFA-TEKLLKSHVVRHV--------NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESD  307 (467)
T ss_pred             chHHHHHHHHHh-HHHHHHHHHHHhh--------hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHH
Confidence            466777777777 6667777776653        457777777777777888888775 677788888888888888888


Q ss_pred             hhhhhhhcCCCCcccccc--cccc
Q psy14694         80 LMSHPLVQISDEQLRFKK--IRIA  101 (102)
Q Consensus        80 l~~h~~~~~~~~~~~C~~--c~~~  101 (102)
                      |.+|..+|. +-.|+|+.  |..+
T Consensus       308 L~kH~~~HS-~~~y~C~h~~C~~s  330 (467)
T KOG3608|consen  308 LAKHVQVHS-KTVYQCEHPDCHYS  330 (467)
T ss_pred             HHHHHHhcc-ccceecCCCCCcHH
Confidence            888877777 55777765  6554


No 8  
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.48  E-value=1.1e-13  Score=87.64  Aligned_cols=88  Identities=15%  Similarity=0.241  Sum_probs=74.4

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCC-----
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQ-----   76 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~-----   76 (102)
                      +.|+.|++.|.  ...|..|+++++        +++.|+ |++.+ ....|..|+.+|.+++++.|..|++.+..     
T Consensus       454 ~~C~~Cgk~f~--~s~LekH~~~~H--------kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~  521 (567)
T PLN03086        454 VHCEKCGQAFQ--QGEMEKHMKVFH--------EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAM  521 (567)
T ss_pred             ccCCCCCCccc--hHHHHHHHHhcC--------CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCcccc
Confidence            57999999995  467889988863        678898 99755 56899999999999999999999999852     


Q ss_pred             -----chhhhhhhhhcCCCCccccccccccC
Q psy14694         77 -----RANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        77 -----~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                           .+.|..|..++ |.+++.|+.||+.|
T Consensus       522 d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~V  551 (567)
T PLN03086        522 DVRDRLRGMSEHESIC-GSRTAPCDSCGRSV  551 (567)
T ss_pred             chhhhhhhHHHHHHhc-CCcceEccccCCee
Confidence                 35799999986 99999999999865


No 9  
>KOG1074|consensus
Probab=99.40  E-value=9.2e-14  Score=90.05  Aligned_cols=67  Identities=22%  Similarity=0.481  Sum_probs=52.2

Q ss_pred             CceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCc----cccc---ccccc
Q psy14694         35 KKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQ----LRFK---KIRIA  101 (102)
Q Consensus        35 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~----~~C~---~c~~~  101 (102)
                      .+-+|.+|.+..+-.++|++|.++|+||+||+|.+||++|..+.+|+.|+.+|....+    ++||   +|-+-
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~k  677 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKK  677 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccc
Confidence            3457888888888888888888888888888888888888888888888888876655    5577   66543


No 10 
>KOG3608|consensus
Probab=99.37  E-value=8.3e-14  Score=83.09  Aligned_cols=67  Identities=18%  Similarity=0.419  Sum_probs=49.4

Q ss_pred             CCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhh-cCCCCccccccccccC
Q psy14694         34 RKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLV-QISDEQLRFKKIRIAV  102 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~-~~~~~~~~C~~c~~~~  102 (102)
                      ..+|.|..|.+.|.....|..|++.|.  .-|+|+.|+.+...++.|.+|++. |..++||+|+.|++.|
T Consensus       235 ~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c  302 (467)
T KOG3608|consen  235 TNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRC  302 (467)
T ss_pred             CCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhh
Confidence            344555555555555555555555543  347888899999999999999988 9999999999998764


No 11 
>PHA02768 hypothetical protein; Provisional
Probab=99.34  E-value=5.1e-13  Score=59.88  Aligned_cols=44  Identities=23%  Similarity=0.325  Sum_probs=35.6

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhh
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLM   81 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~   81 (102)
                      .|.|+.||+.|...++|..|+++|+  ++++|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3678888888888888888888887  6788888888888777664


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.30  E-value=5.2e-13  Score=51.82  Aligned_cols=24  Identities=13%  Similarity=0.116  Sum_probs=19.6

Q ss_pred             hhhhhhhhcCCCCccccccccccC
Q psy14694         79 NLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        79 ~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      +|..|+++|+|++||.|+.|+++|
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEE
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCee
Confidence            467888888888888888888876


No 13 
>PHA00733 hypothetical protein
Probab=99.30  E-value=3.3e-12  Score=67.60  Aligned_cols=54  Identities=20%  Similarity=0.360  Sum_probs=34.3

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcC
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      ++++|.|..|++.|.....|..|++.+  +.++.|..|++.|.....|..|+...+
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            456666666666666666666666654  345666666666666666666665533


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.29  E-value=1.3e-12  Score=58.58  Aligned_cols=37  Identities=16%  Similarity=0.340  Sum_probs=27.3

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .|.|++||+.|+..++|..|+++|+  ++|+|..|+++|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f   41 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRIS   41 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCccccee
Confidence            4677777777777777777777777  577777777765


No 15 
>KOG1074|consensus
Probab=99.29  E-value=1.6e-12  Score=84.51  Aligned_cols=83  Identities=17%  Similarity=0.442  Sum_probs=74.6

Q ss_pred             CccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCC----CccCC---CCCCc
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDR----PYKCF---VCPYR   73 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~----~~~c~---~c~~~   73 (102)
                      |..|..|-+..+ -...|+.|.++|+      ||+||.|.+|++.|....+|..|+.+|...-    .+.|+   +|-+.
T Consensus       605 PNqCiiC~rVlS-C~saLqmHyrtHt------GERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~k  677 (958)
T KOG1074|consen  605 PNQCIICLRVLS-CPSALQMHYRTHT------GERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKK  677 (958)
T ss_pred             ccceeeeeeccc-chhhhhhhhhccc------CcCccccccccchhccccchhhcccccccCccccccccCCchhhhccc
Confidence            457888999998 9999999999999      9999999999999999999999999886543    37888   89999


Q ss_pred             cCCchhhhhhhhhcCCC
Q psy14694         74 SNQRANLMSHPLVQISD   90 (102)
Q Consensus        74 f~~~~~l~~h~~~~~~~   90 (102)
                      |.....|++|++.|.+.
T Consensus       678 ftn~V~lpQhIriH~~~  694 (958)
T KOG1074|consen  678 FTNAVTLPQHIRIHLGG  694 (958)
T ss_pred             ccccccccceEEeecCC
Confidence            99999999999999844


No 16 
>PHA00733 hypothetical protein
Probab=99.22  E-value=4.9e-12  Score=66.97  Aligned_cols=68  Identities=10%  Similarity=0.070  Sum_probs=55.0

Q ss_pred             CCCceeCCCCCCCCCCcchHHHH--hh---hhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRH--IR---AHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h--~~---~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      ..+++.|.+|...+.....|..+  +.   .+.+++||.|..|++.|.....|..|++.+  +.+|.|+.|+++|
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F  109 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEF  109 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCcc
Confidence            56788899988877776666555  11   234578999999999999999999999976  4579999999987


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.09  E-value=5e-11  Score=46.18  Aligned_cols=25  Identities=44%  Similarity=0.996  Sum_probs=21.7

Q ss_pred             hHHHHhhhhcCCCCccCCCCCCccC
Q psy14694         51 TMRRHIRAHIGDRPYKCFVCPYRSN   75 (102)
Q Consensus        51 ~l~~h~~~h~~~~~~~c~~c~~~f~   75 (102)
                      +|..|+++|+|++||.|..|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4778999999999999999998886


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.01  E-value=1.5e-09  Score=69.40  Aligned_cols=93  Identities=18%  Similarity=0.378  Sum_probs=69.6

Q ss_pred             cCCccccccccCHHHHHHHHhhhcc-------------ccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCC
Q psy14694          3 KCTHCKVDLNLDTEIILQHYKLCSE-------------GARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFV   69 (102)
Q Consensus         3 ~c~~c~~~f~~~~~~l~~h~~~~~~-------------~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~   69 (102)
                      .|+.|.+...  ...|..|.....-             ......++.+.|..|++.|. ...|..|+.++.  +++.|+ 
T Consensus       409 ~C~NC~~~i~--l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-  482 (567)
T PLN03086        409 ECRNCKHYIP--SRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-  482 (567)
T ss_pred             ECCCCCCccc--hhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-
Confidence            4778877764  4556666543310             01112346678999999886 578999999874  889999 


Q ss_pred             CCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         70 CPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        70 c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      |++.+ ....|..|+.+|.+++++.|+.|++.|
T Consensus       483 Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        483 CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            99765 568999999999999999999999864


No 19 
>PHA00616 hypothetical protein
Probab=98.99  E-value=1.1e-10  Score=50.07  Aligned_cols=34  Identities=18%  Similarity=0.392  Sum_probs=27.3

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCcccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKK   97 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~   97 (102)
                      ||+|..||+.|...+.|..|++.|+|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5788888888888888888888888888887753


No 20 
>KOG3993|consensus
Probab=98.74  E-value=1.1e-09  Score=67.17  Aligned_cols=81  Identities=23%  Similarity=0.387  Sum_probs=61.2

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhc--------C------------
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHI--------G------------   61 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~--------~------------   61 (102)
                      |.|..|...|. +.-.|-+|.-..=      ....|.|++|++.|+-..+|..|+|.|.        +            
T Consensus       268 yiCqLCK~kYe-D~F~LAQHrC~RI------V~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~ra  340 (500)
T KOG3993|consen  268 YICQLCKEKYE-DAFALAQHRCPRI------VHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRA  340 (500)
T ss_pred             HHHHHHHHhhh-hHHHHhhccCCee------EEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhh
Confidence            56777888887 7777777753211      2345889999999999999999988772        1            


Q ss_pred             -------------CCCccCCCCCCccCCchhhhhhhhhcCC
Q psy14694         62 -------------DRPYKCFVCPYRSNQRANLMSHPLVQIS   89 (102)
Q Consensus        62 -------------~~~~~c~~c~~~f~~~~~l~~h~~~~~~   89 (102)
                                   +..|.|..|++.|.+...|+.|+.+|..
T Consensus       341 e~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  341 EVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             hhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                         1247899999999999999999888653


No 21 
>PHA00732 hypothetical protein
Probab=98.72  E-value=8.7e-09  Score=50.17  Aligned_cols=47  Identities=28%  Similarity=0.458  Sum_probs=37.1

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhh-hcCCCCccCCCCCCccCCchhhhhhhhhcC
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRA-HIGDRPYKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~-h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      +|.|..|++.|.....|..|++. |.+   +.|..|++.|..   +..|.+++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~---l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR---LNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC---hhhhhcccC
Confidence            47799999999999999999874 653   579999999983   667776543


No 22 
>PHA00616 hypothetical protein
Probab=98.59  E-value=3.7e-08  Score=42.29  Aligned_cols=33  Identities=12%  Similarity=0.293  Sum_probs=19.3

Q ss_pred             CccCCccccccccCHHHHHHHHhhhccccccCCCCceeCC
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCF   40 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~   40 (102)
                      ||.|..||+.|. ....|..|++.++      +++++.++
T Consensus         1 pYqC~~CG~~F~-~~s~l~~H~r~~h------g~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFR-KKKEVIEHLLSVH------KQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHh-hHHHHHHHHHHhc------CCCcccee
Confidence            456666666665 5556666666555      55555543


No 23 
>PHA00732 hypothetical protein
Probab=98.52  E-value=1.2e-07  Score=46.21  Aligned_cols=47  Identities=17%  Similarity=0.345  Sum_probs=37.9

Q ss_pred             CccCCccccccccCHHHHHHHHhh-hccccccCCCCceeCCCCCCCCCCcchHHHHhhhhc
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKL-CSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHI   60 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~   60 (102)
                      ||.|+.|++.|. ....|..|++. |.      +   +.|..|++.|.   .+..|.....
T Consensus         1 py~C~~Cgk~F~-s~s~Lk~H~r~~H~------~---~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTV-TLFALKQHARRNHT------L---TKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccC-CHHHHHHHhhcccC------C---CccCCCCCEeC---ChhhhhcccC
Confidence            799999999998 99999999885 43      2   47999999997   4777776443


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.22  E-value=2.9e-07  Score=34.33  Aligned_cols=23  Identities=30%  Similarity=0.555  Sum_probs=17.2

Q ss_pred             ccCCCCCCccCCchhhhhhhhhc
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            46777888888888888877653


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.20  E-value=6.6e-06  Score=37.27  Aligned_cols=49  Identities=20%  Similarity=0.487  Sum_probs=26.2

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRA   58 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~   58 (102)
                      |.|+.|++.|  +...|..|....+    ....+.+.|++|...+.  .+|..|+..
T Consensus         3 f~CP~C~~~~--~~~~L~~H~~~~H----~~~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    3 FTCPYCGKGF--SESSLVEHCEDEH----RSESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             cCCCCCCCcc--CHHHHHHHHHhHC----cCCCCCccCCCchhhhh--hHHHHHHHH
Confidence            5677777743  4556666665543    11234566666665332  355555544


No 26 
>KOG3993|consensus
Probab=98.09  E-value=2.7e-07  Score=57.00  Aligned_cols=51  Identities=25%  Similarity=0.351  Sum_probs=42.9

Q ss_pred             eeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhc
Q psy14694         37 YDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        37 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      |.|.-|...|.....|.+|.-.-..-.-|+|.+|+|.|+-+.||-.|.|=|
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhccc
Confidence            778888888999999999986433334599999999999999999998876


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.08  E-value=2.9e-06  Score=31.53  Aligned_cols=22  Identities=18%  Similarity=0.474  Sum_probs=16.3

Q ss_pred             ccCCccccccccCHHHHHHHHhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKL   24 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~   24 (102)
                      |.|+.|++.|. ....|..|++.
T Consensus         1 y~C~~C~~~f~-~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFS-SKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEES-SHHHHHHHHHH
T ss_pred             CCCCCCCCccC-CHHHHHHHHhH
Confidence            56777888887 77777777765


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.07  E-value=1.4e-06  Score=33.72  Aligned_cols=25  Identities=20%  Similarity=0.378  Sum_probs=19.8

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcC
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5778888888888888888887764


No 29 
>PRK04860 hypothetical protein; Provisional
Probab=98.07  E-value=1.9e-06  Score=47.44  Aligned_cols=35  Identities=20%  Similarity=0.455  Sum_probs=29.7

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      +|.|. |+.   ....+..|.++|+++++|.|..|+..|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            58897 886   666788999999999999999998765


No 30 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.00  E-value=9.5e-06  Score=36.74  Aligned_cols=50  Identities=22%  Similarity=0.419  Sum_probs=38.2

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhh-hcCC-CCccCCCCCCccCCchhhhhhhhhcC
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRA-HIGD-RPYKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~-h~~~-~~~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      .|.|+.|++ ......|..|... |..+ +.+.|++|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            478999999 4556889999765 6554 5699999987654  48888987754


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.97  E-value=4.2e-06  Score=32.34  Aligned_cols=25  Identities=12%  Similarity=0.379  Sum_probs=19.8

Q ss_pred             CccCCccccccccCHHHHHHHHhhhc
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKLCS   26 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~~~   26 (102)
                      ||.|..|++.|. +...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~-~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFS-SLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEES-SHHHHHHHHCTTT
T ss_pred             CCCCCccCCccC-ChhHHHHHhHHhc
Confidence            678888888887 8888888877654


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.93  E-value=4.2e-06  Score=31.17  Aligned_cols=23  Identities=17%  Similarity=0.472  Sum_probs=16.1

Q ss_pred             ccCCCCCCccCCchhhhhhhhhc
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      |.|..|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56778888888888888887764


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.77  E-value=1.3e-05  Score=40.49  Aligned_cols=73  Identities=16%  Similarity=0.269  Sum_probs=21.1

Q ss_pred             cCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhh
Q psy14694          3 KCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMS   82 (102)
Q Consensus         3 ~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~   82 (102)
                      .|..|+..|. +...+..|+...+      +-..-    ....+.....+..+.+... ...+.|..|++.|.....|..
T Consensus         1 ~C~~C~~~f~-~~~~l~~H~~~~H------~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~   68 (100)
T PF12756_consen    1 QCLFCDESFS-SVDDLLQHMKKKH------GFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQE   68 (100)
T ss_dssp             ------------------------------------------------------------SSEEBSSSS-EESSHHHHHH
T ss_pred             Cccccccccc-ccccccccccccc------ccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHH
Confidence            4889999998 8888889986544      22110    0111222333333333222 236899999999999999999


Q ss_pred             hhhhc
Q psy14694         83 HPLVQ   87 (102)
Q Consensus        83 h~~~~   87 (102)
                      |++.+
T Consensus        69 Hm~~~   73 (100)
T PF12756_consen   69 HMRSK   73 (100)
T ss_dssp             HHHHT
T ss_pred             HHcCc
Confidence            99874


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.72  E-value=3.8e-05  Score=28.45  Aligned_cols=23  Identities=17%  Similarity=0.460  Sum_probs=15.2

Q ss_pred             ccCCccccccccCHHHHHHHHhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLC   25 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~   25 (102)
                      |.|+.|+..|. +...|..|+..+
T Consensus         1 ~~C~~C~~~~~-~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFR-SKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EES-SHHHHHHHHHHH
T ss_pred             CCCcCCCCcCC-cHHHHHHHHHhh
Confidence            56777777777 777777777654


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.68  E-value=2.5e-05  Score=34.44  Aligned_cols=32  Identities=22%  Similarity=0.365  Sum_probs=19.9

Q ss_pred             CCCCccCCCCCCccCCchhhhhhhhhcCCCCc
Q psy14694         61 GDRPYKCFVCPYRSNQRANLMSHPLVQISDEQ   92 (102)
Q Consensus        61 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   92 (102)
                      .+.|..|++|+..+.+..+|.+|+...++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            35677888888888888888888877776665


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.66  E-value=2.6e-05  Score=47.05  Aligned_cols=40  Identities=28%  Similarity=0.473  Sum_probs=27.6

Q ss_pred             CCCccCCC--CCCccCCchhhhhhhhh-c------------------CCCCcccccccccc
Q psy14694         62 DRPYKCFV--CPYRSNQRANLMSHPLV-Q------------------ISDEQLRFKKIRIA  101 (102)
Q Consensus        62 ~~~~~c~~--c~~~f~~~~~l~~h~~~-~------------------~~~~~~~C~~c~~~  101 (102)
                      +|||+|++  |++.+.....|+.|+.- |                  ..+|||.|++|+|.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KR  407 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKR  407 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchh
Confidence            46777755  66666666666666543 2                  35699999999985


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.63  E-value=4.1e-05  Score=28.80  Aligned_cols=24  Identities=21%  Similarity=0.390  Sum_probs=16.3

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcC
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      ++|..|+++|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            456777777777777777766543


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.51  E-value=9.2e-05  Score=40.89  Aligned_cols=39  Identities=31%  Similarity=0.525  Sum_probs=33.3

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCch
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRA   78 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~   78 (102)
                      +|.|. |+.   ....+..|.++++|+++|.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            58897 876   5678899999999999999999999887543


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.31  E-value=0.00035  Score=26.07  Aligned_cols=23  Identities=13%  Similarity=0.459  Sum_probs=14.9

Q ss_pred             ccCCccccccccCHHHHHHHHhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLC   25 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~   25 (102)
                      |.|..|++.|. ....+..|++.|
T Consensus         1 ~~C~~C~~~f~-~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFK-SKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhC-CHHHHHHHHHHh
Confidence            45667777776 666666666644


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.11  E-value=0.00031  Score=31.08  Aligned_cols=32  Identities=25%  Similarity=0.421  Sum_probs=23.2

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhhhcCCCC
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRP   64 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~   64 (102)
                      .+.|..|++|+..+.++.+|.+|+.+..+.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            67889999999999999999999988777665


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.07  E-value=0.00038  Score=42.22  Aligned_cols=53  Identities=28%  Similarity=0.572  Sum_probs=42.2

Q ss_pred             CCCceeCCC--CCCCCCCcchHHHHhhh-h------------------cCCCCccCCCCCCccCCchhhhhhhh
Q psy14694         33 SRKKYDCFM--CPYRTPYSGTMRRHIRA-H------------------IGDRPYKCFVCPYRSNQRANLMSHPL   85 (102)
Q Consensus        33 ~~~~~~c~~--c~~~~~~~~~l~~h~~~-h------------------~~~~~~~c~~c~~~f~~~~~l~~h~~   85 (102)
                      ++++|.|++  |.+.+.....|..|+.. |                  ...|||.|.+|++.+..-..|+.|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            458899976  88899998899888652 2                  23489999999999998888877754


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.03  E-value=0.00044  Score=26.58  Aligned_cols=22  Identities=18%  Similarity=0.295  Sum_probs=18.8

Q ss_pred             ccCCCCCCccCCchhhhhhhhh
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      |.|..|++.|.....+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5788999999999999888775


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.01  E-value=0.0002  Score=26.91  Aligned_cols=22  Identities=18%  Similarity=0.360  Sum_probs=16.6

Q ss_pred             ccCCCCCCccCCchhhhhhhhh
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      |.|..|++.|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4577788888888888777765


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.97  E-value=0.00023  Score=26.54  Aligned_cols=23  Identities=35%  Similarity=0.684  Sum_probs=14.6

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcC
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      |+|..|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            46777777776 777777776643


No 45 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=96.72  E-value=0.001  Score=26.89  Aligned_cols=9  Identities=0%  Similarity=-0.296  Sum_probs=5.2

Q ss_pred             Ccccccccc
Q psy14694         91 EQLRFKKIR   99 (102)
Q Consensus        91 ~~~~C~~c~   99 (102)
                      .++.||.||
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            455666665


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.70  E-value=0.0012  Score=24.67  Aligned_cols=23  Identities=17%  Similarity=0.433  Sum_probs=16.1

Q ss_pred             ccCCccccccccCHHHHHHHHhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLC   25 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~   25 (102)
                      |.|..|++.|. +...+..|++.+
T Consensus         1 ~~C~~C~~~f~-s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFS-SENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEES-SHHHHHHHHTTH
T ss_pred             CCCCCCCCCcC-CHHHHHHHHCcC
Confidence            45777777777 777777776543


No 47 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.56  E-value=0.0016  Score=40.72  Aligned_cols=62  Identities=24%  Similarity=0.415  Sum_probs=54.4

Q ss_pred             CceeCCCCCCCCCCcchHHHHhh--hhcCC--CCccCC--CCCCccCCchhhhhhhhhcCCCCccccc
Q psy14694         35 KKYDCFMCPYRTPYSGTMRRHIR--AHIGD--RPYKCF--VCPYRSNQRANLMSHPLVQISDEQLRFK   96 (102)
Q Consensus        35 ~~~~c~~c~~~~~~~~~l~~h~~--~h~~~--~~~~c~--~c~~~f~~~~~l~~h~~~~~~~~~~~C~   96 (102)
                      ....+..|...+.....+..|.+  .|.++  +++.|.  .|++.|.+...+..|...|++..+..+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            35778888899999999999999  89999  999999  7999999999999999999988877664


No 48 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.08  E-value=0.0016  Score=32.77  Aligned_cols=59  Identities=14%  Similarity=0.223  Sum_probs=9.1

Q ss_pred             eCCCCCCCCCCcchHHHHhhhhcCC-CCccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         38 DCFMCPYRTPYSGTMRRHIRAHIGD-RPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        38 ~c~~c~~~~~~~~~l~~h~~~h~~~-~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      +|..|+..|.....|..|+....+. .+ .    ...+.....+..+.+... ...+.|..|++.|
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-~----~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f   60 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-D----QKYLVDPNRLLNYLRKKV-KESFRCPYCNKTF   60 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EE
T ss_pred             Cccccccccccccccccccccccccccc-c----cccccccccccccccccc-CCCCCCCccCCCC
Confidence            4788999999999999999753332 22 1    111223333334444322 2379999999875


No 49 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=95.90  E-value=0.0049  Score=28.16  Aligned_cols=32  Identities=16%  Similarity=0.175  Sum_probs=20.9

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      .|.|+.||........     +--.-..+|.||+||+
T Consensus        27 ~F~CPnCGe~~I~Rc~-----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCA-----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhh-----hHHHcCCceECCCcCc
Confidence            4788889866554432     2222345899999986


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.85  E-value=0.0061  Score=23.00  Aligned_cols=21  Identities=19%  Similarity=0.406  Sum_probs=13.7

Q ss_pred             ccCCCCCCccCCchhhhhhhhh
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      ..|..|++.| .+..|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3677788888 34556677654


No 51 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=95.54  E-value=0.0067  Score=35.26  Aligned_cols=10  Identities=10%  Similarity=-0.124  Sum_probs=7.1

Q ss_pred             cccccccccC
Q psy14694         93 LRFKKIRIAV  102 (102)
Q Consensus        93 ~~C~~c~~~~  102 (102)
                      ..||.||.+|
T Consensus        49 ~vCP~CgyA~   58 (214)
T PF09986_consen   49 WVCPHCGYAA   58 (214)
T ss_pred             EECCCCCCcc
Confidence            4588888765


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.53  E-value=0.014  Score=23.55  Aligned_cols=23  Identities=26%  Similarity=0.411  Sum_probs=15.8

Q ss_pred             CccCCccccccccCHHHHHHHHhh
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYKL   24 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~~   24 (102)
                      +|.|+.|++.|. +...+..|+..
T Consensus         3 ~~~C~~C~~~~~-~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFT-DEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccC-CHHHHHHHHCh
Confidence            366777777776 66677766654


No 53 
>KOG2893|consensus
Probab=95.33  E-value=0.0071  Score=35.55  Aligned_cols=42  Identities=19%  Similarity=0.381  Sum_probs=23.1

Q ss_pred             CCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhh-hhhc
Q psy14694         42 CPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSH-PLVQ   87 (102)
Q Consensus        42 c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h-~~~~   87 (102)
                      |.+.|.....|.+|+.    .|-|+|.+|.+.+...-.|..| +++|
T Consensus        16 cnrefddekiliqhqk----akhfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   16 CNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             cccccchhhhhhhhhh----hccceeeeehhhhccCCCceeehhhhh
Confidence            5556666666666655    3446666666544444444444 4444


No 54 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.21  E-value=0.013  Score=23.84  Aligned_cols=8  Identities=0%  Similarity=-0.242  Sum_probs=4.3

Q ss_pred             cccccccc
Q psy14694         92 QLRFKKIR   99 (102)
Q Consensus        92 ~~~C~~c~   99 (102)
                      |..||.||
T Consensus        18 p~~CP~Cg   25 (34)
T cd00729          18 PEKCPICG   25 (34)
T ss_pred             CCcCcCCC
Confidence            44555555


No 55 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.82  E-value=0.12  Score=27.02  Aligned_cols=26  Identities=19%  Similarity=0.385  Sum_probs=16.7

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcC
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQI   88 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~   88 (102)
                      ..|.|..|...|-..-++..|...|.
T Consensus        80 ~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        80 HRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cceeCCCCCCccccccchhhhhhccC
Confidence            35777777777776666666655444


No 56 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=94.78  E-value=0.019  Score=26.31  Aligned_cols=32  Identities=13%  Similarity=0.114  Sum_probs=19.5

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      .|.|+.||......-     .+--.-..+|.||+||+
T Consensus        25 ~F~CPnCG~~~I~RC-----~~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRC-----EKCRKQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeec-----hhHHhcCCceECCCCCC
Confidence            478888886633322     12222245899999986


No 57 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=94.63  E-value=0.021  Score=31.86  Aligned_cols=23  Identities=17%  Similarity=0.294  Sum_probs=17.6

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      .|.|.+||.+             +.|+.|-.||.||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            5888888743             4557788898887


No 58 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=94.60  E-value=0.015  Score=24.82  Aligned_cols=29  Identities=14%  Similarity=0.277  Sum_probs=14.1

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      |.|..||..|.....      ... ..+-.||.||.
T Consensus         6 y~C~~Cg~~fe~~~~------~~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS------ISE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEE------cCC-CCCCcCCCCCC
Confidence            556666655553321      111 34555666654


No 59 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=94.29  E-value=0.022  Score=31.48  Aligned_cols=12  Identities=25%  Similarity=0.645  Sum_probs=8.6

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      ++|+.||++|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            677777777754


No 60 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=94.26  E-value=0.035  Score=22.98  Aligned_cols=11  Identities=18%  Similarity=0.301  Sum_probs=5.0

Q ss_pred             CccCCCCCCcc
Q psy14694         64 PYKCFVCPYRS   74 (102)
Q Consensus        64 ~~~c~~c~~~f   74 (102)
                      ..+|..|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            34455554443


No 61 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=94.19  E-value=0.029  Score=23.19  Aligned_cols=10  Identities=20%  Similarity=0.172  Sum_probs=5.0

Q ss_pred             cccccccccc
Q psy14694         92 QLRFKKIRIA  101 (102)
Q Consensus        92 ~~~C~~c~~~  101 (102)
                      ...|+.|+..
T Consensus        25 ~v~C~~C~~~   34 (38)
T TIGR02098        25 KVRCGKCGHV   34 (38)
T ss_pred             EEECCCCCCE
Confidence            3445555543


No 62 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=94.18  E-value=0.019  Score=24.05  Aligned_cols=11  Identities=27%  Similarity=0.630  Sum_probs=5.6

Q ss_pred             ccCCCCCCccC
Q psy14694         65 YKCFVCPYRSN   75 (102)
Q Consensus        65 ~~c~~c~~~f~   75 (102)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            45555555444


No 63 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=94.15  E-value=0.02  Score=25.48  Aligned_cols=11  Identities=36%  Similarity=0.781  Sum_probs=6.9

Q ss_pred             eeCCCCCCCCC
Q psy14694         37 YDCFMCPYRTP   47 (102)
Q Consensus        37 ~~c~~c~~~~~   47 (102)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            56666666554


No 64 
>KOG2186|consensus
Probab=93.53  E-value=0.035  Score=32.94  Aligned_cols=49  Identities=12%  Similarity=0.304  Sum_probs=35.8

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhc
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      .|+|..||....- ..+..|+..-.+ ..|.|..|++.|.+ ..+..|..--
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCI   51 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCI   51 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhc
Confidence            4789999887654 456678876555 66899999999988 5566776543


No 65 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=93.42  E-value=0.068  Score=21.98  Aligned_cols=9  Identities=22%  Similarity=0.231  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      ..+|+.|+.
T Consensus        25 ~v~C~~C~~   33 (36)
T PF13717_consen   25 KVRCSKCGH   33 (36)
T ss_pred             EEECCCCCC
Confidence            344444443


No 66 
>PHA00626 hypothetical protein
Probab=93.42  E-value=0.041  Score=24.88  Aligned_cols=15  Identities=27%  Similarity=0.744  Sum_probs=10.4

Q ss_pred             CCccCCCCCCccCCc
Q psy14694         63 RPYKCFVCPYRSNQR   77 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~   77 (102)
                      ..|+|..||..|+..
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            457888888777643


No 67 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=93.12  E-value=0.034  Score=24.14  Aligned_cols=12  Identities=25%  Similarity=0.694  Sum_probs=6.5

Q ss_pred             ceeCCCCCCCCC
Q psy14694         36 KYDCFMCPYRTP   47 (102)
Q Consensus        36 ~~~c~~c~~~~~   47 (102)
                      .|.|..||..+.
T Consensus         3 ~y~C~~CG~~~~   14 (46)
T PRK00398          3 EYKCARCGREVE   14 (46)
T ss_pred             EEECCCCCCEEE
Confidence            355666665443


No 68 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.92  E-value=0.035  Score=34.81  Aligned_cols=61  Identities=21%  Similarity=0.416  Sum_probs=49.9

Q ss_pred             CccCCccccccccCHHHHHHHHh--hhccccccCCC--CceeCC--CCCCCCCCcchHHHHhhhhcCCCCccCC
Q psy14694          1 ILKCTHCKVDLNLDTEIILQHYK--LCSEGARQSSR--KKYDCF--MCPYRTPYSGTMRRHIRAHIGDRPYKCF   68 (102)
Q Consensus         1 ~~~c~~c~~~f~~~~~~l~~h~~--~~~~~~~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~h~~~~~~~c~   68 (102)
                      ++.|..|...|. ....+..|.+  .|.      ++  +++.|+  .|++.|.....+..|...|.+..+..+.
T Consensus       289 ~~~~~~~~~~~s-~~~~l~~~~~~~~h~------~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         289 PIKSKQCNISFS-RSSPLTRHLRSVNHS------GESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             CCCCccccCCcc-ccccccccccccccc------cccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            356778888887 7888888888  566      88  899999  7999999999999999988877765553


No 69 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=92.65  E-value=0.044  Score=20.46  Aligned_cols=9  Identities=0%  Similarity=-0.027  Sum_probs=6.1

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      .|.||.||+
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            577777764


No 70 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=92.60  E-value=0.082  Score=26.41  Aligned_cols=27  Identities=22%  Similarity=0.450  Sum_probs=16.2

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      +|-.|..||+.|.+.          ...+|-.||.|.
T Consensus        57 ~Pa~CkkCGfef~~~----------~ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDD----------KIKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCcccccc----------ccCCcccCCcch
Confidence            466777777777652          113466677664


No 71 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.57  E-value=0.089  Score=22.72  Aligned_cols=26  Identities=27%  Similarity=0.582  Sum_probs=14.7

Q ss_pred             eeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCc
Q psy14694         37 YDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYR   73 (102)
Q Consensus        37 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~   73 (102)
                      |.|..||..+...           ...+..|++||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            5677776655432           1244677777643


No 72 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=92.24  E-value=0.12  Score=28.70  Aligned_cols=19  Identities=16%  Similarity=0.177  Sum_probs=8.6

Q ss_pred             CCceeCCCCCCCCCCcchH
Q psy14694         34 RKKYDCFMCPYRTPYSGTM   52 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~~l   52 (102)
                      ...|.|+.|+..|+...++
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CCeEECCCCCcEeeHHHHH
Confidence            3444455555444444333


No 73 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=91.85  E-value=0.11  Score=19.07  Aligned_cols=7  Identities=0%  Similarity=-0.140  Sum_probs=4.0

Q ss_pred             ccccccc
Q psy14694         95 FKKIRIA  101 (102)
Q Consensus        95 C~~c~~~  101 (102)
                      |+.||..
T Consensus        16 C~~CG~~   22 (23)
T PF13240_consen   16 CPNCGTP   22 (23)
T ss_pred             hhhhCCc
Confidence            6666654


No 74 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=91.74  E-value=0.18  Score=27.64  Aligned_cols=34  Identities=15%  Similarity=0.155  Sum_probs=16.8

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      .-|.|+.|+..|.....+.. .  .. +..|.||.||.
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~-~--d~-~~~f~Cp~Cg~  131 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQL-L--DM-DGTFTCPRCGE  131 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHh-c--CC-CCcEECCCCCC
Confidence            34667777766664332211 0  11 22267777764


No 75 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=91.11  E-value=0.18  Score=28.64  Aligned_cols=13  Identities=23%  Similarity=0.424  Sum_probs=6.2

Q ss_pred             ccCCCCCCccCCc
Q psy14694         65 YKCFVCPYRSNQR   77 (102)
Q Consensus        65 ~~c~~c~~~f~~~   77 (102)
                      |.|+.|+..|+..
T Consensus       118 Y~Cp~C~~rytf~  130 (178)
T PRK06266        118 FFCPNCHIRFTFD  130 (178)
T ss_pred             EECCCCCcEEeHH
Confidence            4455555444443


No 76 
>PF14353 CpXC:  CpXC protein
Probab=90.97  E-value=0.094  Score=27.93  Aligned_cols=10  Identities=20%  Similarity=0.394  Sum_probs=5.4

Q ss_pred             eCCCCCCCCC
Q psy14694         38 DCFMCPYRTP   47 (102)
Q Consensus        38 ~c~~c~~~~~   47 (102)
                      +|+.|+..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            4566665543


No 77 
>KOG2186|consensus
Probab=90.75  E-value=0.16  Score=30.31  Aligned_cols=46  Identities=15%  Similarity=0.464  Sum_probs=35.7

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHHhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRHIR   57 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   57 (102)
                      |.|..||....  ...+..|+-..+      + ..|.|..|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvK--Kp~vekH~srCr------n-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVK--KPQVEKHMSRCR------N-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcc--ccchHHHHHhcc------C-CeeEEeeccccccc-chhhhhhh
Confidence            67899998874  456677887776      5 67999999999988 66667754


No 78 
>KOG2893|consensus
Probab=90.65  E-value=0.1  Score=30.92  Aligned_cols=41  Identities=27%  Similarity=0.639  Sum_probs=28.5

Q ss_pred             CCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCCCCCcchHHHH
Q psy14694          4 CTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYRTPYSGTMRRH   55 (102)
Q Consensus         4 c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h   55 (102)
                      |=.|++.|. +..-|++|++.          +.|.|-+|.+...+-..|..|
T Consensus        13 cwycnrefd-dekiliqhqka----------khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFD-DEKILIQHQKA----------KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccc-hhhhhhhhhhh----------ccceeeeehhhhccCCCceee
Confidence            446888887 77777777654          457788888776666666555


No 79 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=90.13  E-value=0.14  Score=22.61  Aligned_cols=12  Identities=25%  Similarity=0.669  Sum_probs=7.2

Q ss_pred             CceeCCCCCCCC
Q psy14694         35 KKYDCFMCPYRT   46 (102)
Q Consensus        35 ~~~~c~~c~~~~   46 (102)
                      ..|.|..|++.+
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            346666666655


No 80 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=89.74  E-value=0.13  Score=22.72  Aligned_cols=15  Identities=13%  Similarity=0.191  Sum_probs=8.2

Q ss_pred             CCccCCCCCCccCCc
Q psy14694         63 RPYKCFVCPYRSNQR   77 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~   77 (102)
                      +++.|..||..|...
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            445566666555443


No 81 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.60  E-value=0.35  Score=25.17  Aligned_cols=17  Identities=18%  Similarity=0.336  Sum_probs=7.9

Q ss_pred             CCCceeCCCCCCCCCCc
Q psy14694         33 SRKKYDCFMCPYRTPYS   49 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~   49 (102)
                      ++.|..|+.||..|...
T Consensus        23 nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   23 NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCCCccCCCCCCccCcc
Confidence            33444555555544433


No 82 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=88.36  E-value=0.35  Score=24.04  Aligned_cols=33  Identities=21%  Similarity=0.310  Sum_probs=19.4

Q ss_pred             CceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCc
Q psy14694         35 KKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQR   77 (102)
Q Consensus        35 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   77 (102)
                      ..+.|+.|++.        .+.++  +...|+|..|+..|.-.
T Consensus        34 ~~~~Cp~C~~~--------~VkR~--a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRI--ATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCc--------ceeee--ccCeEEcCCCCCeeccc
Confidence            45677777654        11232  23467888888777644


No 83 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=87.48  E-value=0.32  Score=26.33  Aligned_cols=12  Identities=25%  Similarity=0.395  Sum_probs=6.4

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      +.|..||..|..
T Consensus        71 ~~C~~CG~~~~~   82 (135)
T PRK03824         71 LKCRNCGNEWSL   82 (135)
T ss_pred             EECCCCCCEEec
Confidence            556666655543


No 84 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=87.48  E-value=0.17  Score=22.91  Aligned_cols=26  Identities=15%  Similarity=0.220  Sum_probs=19.9

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhh
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRA   58 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~   58 (102)
                      |+..+.|+.|++.|........|...
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhH
Confidence            67778888888888877777777653


No 85 
>KOG1146|consensus
Probab=87.37  E-value=0.28  Score=35.80  Aligned_cols=24  Identities=33%  Similarity=0.731  Sum_probs=14.4

Q ss_pred             CCccCCCCCCccCCchhhhhhhhh
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      ++|.|..|..++....+|-+|+..
T Consensus       517 ~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHHH
Confidence            456666666666666666666543


No 86 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=84.94  E-value=0.48  Score=25.62  Aligned_cols=27  Identities=15%  Similarity=0.161  Sum_probs=16.7

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQ   92 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   92 (102)
                      .-..|-+||+.|..   |.+|++.|+|--|
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             CeeEEccCCcccch---HHHHHHHccCCCH
Confidence            34679999999886   5899999877544


No 87 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=84.40  E-value=0.48  Score=17.98  Aligned_cols=9  Identities=0%  Similarity=-0.256  Sum_probs=4.5

Q ss_pred             ccccccccC
Q psy14694         94 RFKKIRIAV  102 (102)
Q Consensus        94 ~C~~c~~~~  102 (102)
                      .|+.||-.|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            355555544


No 88 
>KOG1146|consensus
Probab=84.28  E-value=0.37  Score=35.21  Aligned_cols=27  Identities=19%  Similarity=0.159  Sum_probs=16.6

Q ss_pred             cCCCCccCCCCCCccCCchhhhhhhhh
Q psy14694         60 IGDRPYKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        60 ~~~~~~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      .-.+.++|++|+-.+.....|..|+|+
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRs  487 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRS  487 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccc
Confidence            334556666666666666666666665


No 89 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.24  E-value=0.9  Score=18.17  Aligned_cols=7  Identities=29%  Similarity=0.842  Sum_probs=3.6

Q ss_pred             ccCCCCC
Q psy14694         65 YKCFVCP   71 (102)
Q Consensus        65 ~~c~~c~   71 (102)
                      ..|.+||
T Consensus        18 irC~~CG   24 (32)
T PF03604_consen   18 IRCPECG   24 (32)
T ss_dssp             SSBSSSS
T ss_pred             EECCcCC
Confidence            4555555


No 90 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=83.73  E-value=0.61  Score=20.17  Aligned_cols=11  Identities=27%  Similarity=0.262  Sum_probs=6.6

Q ss_pred             CCccccccccc
Q psy14694         90 DEQLRFKKIRI  100 (102)
Q Consensus        90 ~~~~~C~~c~~  100 (102)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            45566666653


No 91 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=83.65  E-value=0.84  Score=20.06  Aligned_cols=21  Identities=29%  Similarity=0.433  Sum_probs=12.2

Q ss_pred             ccCCCCCCccCCc-----hhhhhhhh
Q psy14694         65 YKCFVCPYRSNQR-----ANLMSHPL   85 (102)
Q Consensus        65 ~~c~~c~~~f~~~-----~~l~~h~~   85 (102)
                      ..|..|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666655433     56666666


No 92 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=83.02  E-value=0.98  Score=20.51  Aligned_cols=13  Identities=23%  Similarity=0.687  Sum_probs=6.7

Q ss_pred             ceeCCCCCCCCCC
Q psy14694         36 KYDCFMCPYRTPY   48 (102)
Q Consensus        36 ~~~c~~c~~~~~~   48 (102)
                      .+.|..||..|..
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            3555555555443


No 93 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=82.85  E-value=0.65  Score=19.73  Aligned_cols=24  Identities=25%  Similarity=0.314  Sum_probs=12.5

Q ss_pred             CCCccCCCCCCccCC----chhhhhhhh
Q psy14694         62 DRPYKCFVCPYRSNQ----RANLMSHPL   85 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~----~~~l~~h~~   85 (102)
                      .....|..|++.+..    .++|..|++
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            344667777766554    366667763


No 94 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=82.78  E-value=0.51  Score=18.61  Aligned_cols=8  Identities=13%  Similarity=-0.076  Sum_probs=4.5

Q ss_pred             cccccccc
Q psy14694         92 QLRFKKIR   99 (102)
Q Consensus        92 ~~~C~~c~   99 (102)
                      .|.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            45566554


No 95 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=82.33  E-value=1.3  Score=28.00  Aligned_cols=51  Identities=18%  Similarity=0.170  Sum_probs=32.2

Q ss_pred             CCCcchHHHHhhhhc---CCCC-ccCCCCCCccCCchhhhhhhhhcCCCCcccccc
Q psy14694         46 TPYSGTMRRHIRAHI---GDRP-YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKK   97 (102)
Q Consensus        46 ~~~~~~l~~h~~~h~---~~~~-~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~   97 (102)
                      .+....|..|...-.   |-+. -.|..|...|.....|..|.|..+ ++-|-|+.
T Consensus       198 lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~  252 (493)
T COG5236         198 LFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRH-EACHICDM  252 (493)
T ss_pred             eeecccccccccCCccccCcCCCchhhhccceecChHHHHHHHHhhh-hhhhhhhc
Confidence            444566666665422   2232 258888888999999999988755 44455544


No 96 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.88  E-value=1.4  Score=23.60  Aligned_cols=17  Identities=12%  Similarity=-0.039  Sum_probs=9.2

Q ss_pred             CCCceeCCCCCCCCCCc
Q psy14694         33 SRKKYDCFMCPYRTPYS   49 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~   49 (102)
                      ++.|..|+.||..|...
T Consensus        23 nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        23 NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCCCccCCCcCCccCcc
Confidence            44555666666555443


No 97 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=81.65  E-value=0.31  Score=24.48  Aligned_cols=32  Identities=25%  Similarity=0.506  Sum_probs=17.2

Q ss_pred             CceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCC
Q psy14694         35 KKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQ   76 (102)
Q Consensus        35 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~   76 (102)
                      ..|.|+.|++.-     +   .+.-.  -.|+|..|++.|.-
T Consensus        34 ~ky~Cp~Cgk~~-----v---kR~a~--GIW~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFCGKTS-----V---KRVAT--GIWKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSSSSSE-----E---EEEET--TEEEETTTTEEEE-
T ss_pred             CCCcCCCCCCce-----e---EEeee--EEeecCCCCCEEeC
Confidence            457777777642     1   12222  34778888776653


No 98 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=81.27  E-value=0.75  Score=25.44  Aligned_cols=33  Identities=24%  Similarity=0.355  Sum_probs=24.3

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      -+|.|. |+..+.+.   .+|-.+-.|+ .|.|..|+-
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCc
Confidence            468898 98776653   4566666777 899999974


No 99 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=81.11  E-value=0.81  Score=24.06  Aligned_cols=12  Identities=17%  Similarity=0.409  Sum_probs=7.5

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            567777766554


No 100
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=80.83  E-value=0.71  Score=22.22  Aligned_cols=41  Identities=12%  Similarity=0.220  Sum_probs=23.3

Q ss_pred             eeCCCCCCCCCCcchHHHHhhhhcCCCCccCC--CCCCccCCchh
Q psy14694         37 YDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCF--VCPYRSNQRAN   79 (102)
Q Consensus        37 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~--~c~~~f~~~~~   79 (102)
                      +.|+.|+..-.....-...  ...-++.++|.  +||.+|.....
T Consensus         2 m~CP~Cg~~a~irtSr~~s--~~~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYIT--DTTKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcC--hhhheeeeecCCCCCCCEEEEEEE
Confidence            4678887654222221111  12345668897  89999876543


No 101
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=80.53  E-value=0.82  Score=19.22  Aligned_cols=9  Identities=44%  Similarity=0.966  Sum_probs=4.5

Q ss_pred             ccCCCCCCc
Q psy14694         65 YKCFVCPYR   73 (102)
Q Consensus        65 ~~c~~c~~~   73 (102)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            455555543


No 102
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=80.45  E-value=0.64  Score=21.22  Aligned_cols=33  Identities=18%  Similarity=0.110  Sum_probs=18.9

Q ss_pred             CCCccCCCCCCccCCchhhhhhhhhcCCCCccccccc
Q psy14694         62 DRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKI   98 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c   98 (102)
                      +.|+....|+..|...+.+. ++   .......||+-
T Consensus        22 ~~PV~s~~C~H~fek~aI~~-~i---~~~~~~~CPv~   54 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAILQ-YI---QRNGSKRCPVA   54 (57)
T ss_dssp             SSEEEESSS--EEEHHHHHH-HC---TTTS-EE-SCC
T ss_pred             hCCcCcCCCCCeecHHHHHH-HH---HhcCCCCCCCC
Confidence            35677778999998776543 33   34567788873


No 103
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=80.04  E-value=0.39  Score=32.95  Aligned_cols=56  Identities=16%  Similarity=0.213  Sum_probs=36.8

Q ss_pred             eCCCCCCCCCCcchHHHHhhhhcCCCCc-cCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         38 DCFMCPYRTPYSGTMRRHIRAHIGDRPY-KCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        38 ~c~~c~~~~~~~~~l~~h~~~h~~~~~~-~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      .|..||=.|+...+|.- .|..+.-..| .|+.|.+.+..+.+..-|.      +|..||.||-
T Consensus       125 ~CT~CGPRfTIi~alPY-DR~nTsM~~F~lC~~C~~EY~dP~nRRfHA------Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPY-DRENTSMADFPLCPFCDKEYKDPLNRRFHA------QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCC-CcccCccccCcCCHHHHHHhcCcccccccc------ccccCcccCC
Confidence            46678888887777643 3333333333 4888988888886644333      3788999984


No 104
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=79.80  E-value=0.99  Score=23.68  Aligned_cols=12  Identities=17%  Similarity=0.354  Sum_probs=7.5

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            567777755554


No 105
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=78.99  E-value=1.2  Score=24.00  Aligned_cols=15  Identities=20%  Similarity=0.439  Sum_probs=10.9

Q ss_pred             CccCCCCCCccCCch
Q psy14694         64 PYKCFVCPYRSNQRA   78 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~   78 (102)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567788888777665


No 106
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=78.86  E-value=1.6  Score=19.55  Aligned_cols=15  Identities=27%  Similarity=0.498  Sum_probs=10.6

Q ss_pred             ccCCCCCCccCCchh
Q psy14694         65 YKCFVCPYRSNQRAN   79 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~   79 (102)
                      ++|..|+..+.....
T Consensus        29 W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   29 WKCPKCGHEWKASVN   43 (55)
T ss_pred             EECCCCCCeeEccHh
Confidence            788888877765543


No 107
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=78.68  E-value=1.3  Score=30.84  Aligned_cols=22  Identities=9%  Similarity=-0.174  Sum_probs=14.4

Q ss_pred             hhhhhhhhcCCCCccccccccc
Q psy14694         79 NLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        79 ~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      .|.-|.--+....|..||.||-
T Consensus       462 ~L~CH~Cg~~~~~p~~Cp~Cgs  483 (730)
T COG1198         462 QLRCHYCGYQEPIPQSCPECGS  483 (730)
T ss_pred             eeEeCCCCCCCCCCCCCCCCCC
Confidence            3444444456677888888874


No 108
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=78.42  E-value=1.7  Score=27.06  Aligned_cols=10  Identities=0%  Similarity=-0.276  Sum_probs=6.7

Q ss_pred             CCcccccccc
Q psy14694         90 DEQLRFKKIR   99 (102)
Q Consensus        90 ~~~~~C~~c~   99 (102)
                      .+...|..|+
T Consensus       250 ~r~e~C~~C~  259 (309)
T PRK03564        250 VKAESCGDCG  259 (309)
T ss_pred             eEeeeccccc
Confidence            4556777776


No 109
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=76.04  E-value=1.2  Score=23.34  Aligned_cols=11  Identities=18%  Similarity=0.332  Sum_probs=6.7

Q ss_pred             ccCCCCCCccC
Q psy14694         65 YKCFVCPYRSN   75 (102)
Q Consensus        65 ~~c~~c~~~f~   75 (102)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (114)
T PRK03681         71 CWCETCQQYVT   81 (114)
T ss_pred             EEcccCCCeee
Confidence            56667765544


No 110
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=75.64  E-value=1.5  Score=23.19  Aligned_cols=12  Identities=17%  Similarity=0.335  Sum_probs=6.7

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      ..|..|+..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            456666655543


No 111
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=75.18  E-value=2.4  Score=15.97  Aligned_cols=19  Identities=26%  Similarity=0.305  Sum_probs=11.9

Q ss_pred             cCCCCCCccCCchhhhhhhh
Q psy14694         66 KCFVCPYRSNQRANLMSHPL   85 (102)
Q Consensus        66 ~c~~c~~~f~~~~~l~~h~~   85 (102)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 4455666654


No 112
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=75.03  E-value=1.6  Score=18.25  Aligned_cols=9  Identities=22%  Similarity=0.859  Sum_probs=3.7

Q ss_pred             CCccCCCCC
Q psy14694         63 RPYKCFVCP   71 (102)
Q Consensus        63 ~~~~c~~c~   71 (102)
                      +.|.|..|+
T Consensus        23 ~~w~C~~C~   31 (40)
T PF04810_consen   23 KTWICNFCG   31 (40)
T ss_dssp             TEEEETTT-
T ss_pred             CEEECcCCC
Confidence            344444444


No 113
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=74.82  E-value=1.8  Score=17.82  Aligned_cols=31  Identities=16%  Similarity=0.273  Sum_probs=18.9

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      ..|+.|+.+-    .+..|=+...|..-|.|..|.
T Consensus         6 v~CP~C~s~~----~v~k~G~~~~G~qryrC~~C~   36 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGKSPSGHQRYRCKDCR   36 (36)
T ss_pred             eeCCCCCCCC----cceeCCCCCCCCEeEecCcCC
Confidence            3566665221    144566667777778888774


No 114
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=74.80  E-value=0.68  Score=19.72  Aligned_cols=11  Identities=9%  Similarity=0.138  Sum_probs=5.4

Q ss_pred             ccccccccccC
Q psy14694         92 QLRFKKIRIAV  102 (102)
Q Consensus        92 ~~~C~~c~~~~  102 (102)
                      |+.|+.|++.|
T Consensus        13 ~~~C~~C~~~F   23 (43)
T PF01428_consen   13 PFKCKHCGKSF   23 (43)
T ss_dssp             HEE-TTTS-EE
T ss_pred             CeECCCCCccc
Confidence            56666666554


No 115
>PF12907 zf-met2:  Zinc-binding
Probab=74.18  E-value=0.51  Score=19.96  Aligned_cols=26  Identities=15%  Similarity=0.249  Sum_probs=13.8

Q ss_pred             ccCCCCCCccC---Cchhhhhhhhh-cCCC
Q psy14694         65 YKCFVCPYRSN---QRANLMSHPLV-QISD   90 (102)
Q Consensus        65 ~~c~~c~~~f~---~~~~l~~h~~~-~~~~   90 (102)
                      ++|.+|..+|.   ....|..|... |..+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            35666665443   33446667655 4443


No 116
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=73.91  E-value=2  Score=19.42  Aligned_cols=9  Identities=22%  Similarity=0.552  Sum_probs=4.5

Q ss_pred             eCCCCCCCC
Q psy14694         38 DCFMCPYRT   46 (102)
Q Consensus        38 ~c~~c~~~~   46 (102)
                      .|+.|+..+
T Consensus         4 ~CP~CG~~i   12 (54)
T TIGR01206         4 ECPDCGAEI   12 (54)
T ss_pred             CCCCCCCEE
Confidence            455555543


No 117
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=73.81  E-value=1.9  Score=20.19  Aligned_cols=14  Identities=21%  Similarity=0.712  Sum_probs=9.2

Q ss_pred             CCCccCCCCCCccC
Q psy14694         62 DRPYKCFVCPYRSN   75 (102)
Q Consensus        62 ~~~~~c~~c~~~f~   75 (102)
                      .+.+.|+.||....
T Consensus        44 ~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   44 GRVFTCPNCGFEMD   57 (69)
T ss_pred             cceEEcCCCCCEEC
Confidence            35577777776644


No 118
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=73.58  E-value=1.6  Score=18.27  Aligned_cols=11  Identities=0%  Similarity=0.009  Sum_probs=5.5

Q ss_pred             ccccccccccC
Q psy14694         92 QLRFKKIRIAV  102 (102)
Q Consensus        92 ~~~C~~c~~~~  102 (102)
                      |+.|+.|+..|
T Consensus        12 ~f~C~~C~~~F   22 (39)
T smart00154       12 GFKCRHCGNLF   22 (39)
T ss_pred             CeECCccCCcc
Confidence            45555555443


No 119
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=73.45  E-value=3.6  Score=25.62  Aligned_cols=10  Identities=0%  Similarity=-0.190  Sum_probs=6.6

Q ss_pred             CCcccccccc
Q psy14694         90 DEQLRFKKIR   99 (102)
Q Consensus        90 ~~~~~C~~c~   99 (102)
                      .+...|..|+
T Consensus       250 ~r~e~C~~C~  259 (305)
T TIGR01562       250 LKAETCDSCQ  259 (305)
T ss_pred             eEEeeccccc
Confidence            3556677776


No 120
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=73.40  E-value=1.5  Score=27.06  Aligned_cols=26  Identities=8%  Similarity=-0.020  Sum_probs=13.8

Q ss_pred             CCCccCCchhhhhhhhhcCCCCcccccccccc
Q psy14694         70 CPYRSNQRANLMSHPLVQISDEQLRFKKIRIA  101 (102)
Q Consensus        70 c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~  101 (102)
                      ||.+|..-     -+|.|.|+.|+ ||.|...
T Consensus        43 CgHtFCsl-----CIR~hL~~qp~-CP~Cr~~   68 (391)
T COG5432          43 CGHTFCSL-----CIRRHLGTQPF-CPVCRED   68 (391)
T ss_pred             cccchhHH-----HHHHHhcCCCC-Ccccccc
Confidence            55555432     23556666666 6666543


No 121
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=73.13  E-value=2.2  Score=22.02  Aligned_cols=26  Identities=19%  Similarity=0.423  Sum_probs=22.4

Q ss_pred             CccC----CCCCCccCCchhhhhhhhhcCC
Q psy14694         64 PYKC----FVCPYRSNQRANLMSHPLVQIS   89 (102)
Q Consensus        64 ~~~c----~~c~~~f~~~~~l~~h~~~~~~   89 (102)
                      .|.|    ..|+........+.+|.+.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4889    8899999999999999988664


No 122
>KOG3408|consensus
Probab=72.42  E-value=1.5  Score=23.27  Aligned_cols=26  Identities=19%  Similarity=0.328  Sum_probs=21.7

Q ss_pred             CCCCccCCCCCCccCCchhhhhhhhh
Q psy14694         61 GDRPYKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        61 ~~~~~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      |.--|.|..|.+-|.....|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44458899999999999999988776


No 123
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=72.38  E-value=2.1  Score=19.26  Aligned_cols=41  Identities=20%  Similarity=0.351  Sum_probs=18.2

Q ss_pred             CceeCCC-CCCCCCCcchHHHHhhhhcCCCCccCCC----CCCccC
Q psy14694         35 KKYDCFM-CPYRTPYSGTMRRHIRAHIGDRPYKCFV----CPYRSN   75 (102)
Q Consensus        35 ~~~~c~~-c~~~~~~~~~l~~h~~~h~~~~~~~c~~----c~~~f~   75 (102)
                      .+..|+. |+..-.....|..|....-..++..|..    |...+.
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            3455554 2222222456666666555555666666    655444


No 124
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=72.23  E-value=2.1  Score=18.53  Aligned_cols=21  Identities=43%  Similarity=1.119  Sum_probs=13.1

Q ss_pred             ccCCCCCCccCCchhhhhhhh
Q psy14694         65 YKCFVCPYRSNQRANLMSHPL   85 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~   85 (102)
                      |+|-.|..+-...+.|.+|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            456666666666666666654


No 125
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=72.07  E-value=1.9  Score=17.76  Aligned_cols=9  Identities=0%  Similarity=-0.164  Sum_probs=5.3

Q ss_pred             ccccccccC
Q psy14694         94 RFKKIRIAV  102 (102)
Q Consensus        94 ~C~~c~~~~  102 (102)
                      .|+.|+++|
T Consensus         4 ~CprC~kg~   12 (36)
T PF14787_consen    4 LCPRCGKGF   12 (36)
T ss_dssp             C-TTTSSSC
T ss_pred             cCcccCCCc
Confidence            477777764


No 126
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=71.74  E-value=1.3  Score=23.25  Aligned_cols=13  Identities=15%  Similarity=0.299  Sum_probs=7.4

Q ss_pred             ccCCCCCCccCCc
Q psy14694         65 YKCFVCPYRSNQR   77 (102)
Q Consensus        65 ~~c~~c~~~f~~~   77 (102)
                      ..|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            5666777666543


No 127
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=71.58  E-value=2.6  Score=16.73  Aligned_cols=8  Identities=13%  Similarity=0.127  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      |.|..|++
T Consensus        28 f~C~~C~~   35 (39)
T smart00132       28 FKCSKCGK   35 (39)
T ss_pred             CCCcccCC
Confidence            44444444


No 128
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=71.20  E-value=5.4  Score=22.80  Aligned_cols=7  Identities=29%  Similarity=1.004  Sum_probs=3.7

Q ss_pred             ccCCCCC
Q psy14694         65 YKCFVCP   71 (102)
Q Consensus        65 ~~c~~c~   71 (102)
                      |.|+.||
T Consensus       133 F~Cp~Cg  139 (176)
T COG1675         133 FTCPKCG  139 (176)
T ss_pred             CCCCCCC
Confidence            4555555


No 129
>KOG0978|consensus
Probab=70.42  E-value=1.7  Score=30.02  Aligned_cols=16  Identities=19%  Similarity=0.154  Sum_probs=10.1

Q ss_pred             cCCCCccccccccccC
Q psy14694         87 QISDEQLRFKKIRIAV  102 (102)
Q Consensus        87 ~~~~~~~~C~~c~~~~  102 (102)
                      -.+.+.-.||.|+.+|
T Consensus       673 r~etRqRKCP~Cn~aF  688 (698)
T KOG0978|consen  673 RYETRQRKCPKCNAAF  688 (698)
T ss_pred             HHHHhcCCCCCCCCCC
Confidence            3445556677777766


No 130
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=70.25  E-value=7.8  Score=29.02  Aligned_cols=12  Identities=25%  Similarity=0.426  Sum_probs=7.9

Q ss_pred             CccCCCCCCccC
Q psy14694         64 PYKCFVCPYRSN   75 (102)
Q Consensus        64 ~~~c~~c~~~f~   75 (102)
                      ++.|+.||....
T Consensus       692 vy~CPsCGaev~  703 (1337)
T PRK14714        692 VYVCPDCGAEVP  703 (1337)
T ss_pred             ceeCccCCCccC
Confidence            567888876543


No 131
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=70.16  E-value=2.2  Score=22.99  Aligned_cols=15  Identities=7%  Similarity=0.082  Sum_probs=10.5

Q ss_pred             CCCCccccccccccC
Q psy14694         88 ISDEQLRFKKIRIAV  102 (102)
Q Consensus        88 ~~~~~~~C~~c~~~~  102 (102)
                      .|..-|.|+.|++.|
T Consensus        49 ~~~qRyrC~~C~~tf   63 (129)
T COG3677          49 RGHQRYKCKSCGSTF   63 (129)
T ss_pred             ccccccccCCcCcce
Confidence            345668888888776


No 132
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=69.82  E-value=0.63  Score=19.43  Aligned_cols=9  Identities=0%  Similarity=-0.355  Sum_probs=5.5

Q ss_pred             ccccccccc
Q psy14694         93 LRFKKIRIA  101 (102)
Q Consensus        93 ~~C~~c~~~  101 (102)
                      |.|..||..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            666666643


No 133
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=69.51  E-value=0.79  Score=26.90  Aligned_cols=27  Identities=11%  Similarity=0.250  Sum_probs=18.0

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCC
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISD   90 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~   90 (102)
                      -|.|..|+|.|.....+..|+...+.+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHH
Confidence            478888888888888888887764433


No 134
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=69.47  E-value=2.1  Score=21.59  Aligned_cols=34  Identities=21%  Similarity=0.343  Sum_probs=20.3

Q ss_pred             CCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCc
Q psy14694         34 RKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQR   77 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   77 (102)
                      ...|.|+.|++.-..        +  .+..+|.|..|++.|.-.
T Consensus        34 ~a~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         34 HAKYFCPFCGKHAVK--------R--QAVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             hCCccCCCCCCCcee--------e--eeeEEEEcCCCCCEEeCC
Confidence            345788888753211        1  122468888888877543


No 135
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=68.74  E-value=3.7  Score=26.73  Aligned_cols=14  Identities=21%  Similarity=0.674  Sum_probs=7.8

Q ss_pred             CccCCCCCCccCCc
Q psy14694         64 PYKCFVCPYRSNQR   77 (102)
Q Consensus        64 ~~~c~~c~~~f~~~   77 (102)
                      -|.|..|+..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56666666555433


No 136
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=68.43  E-value=1.3  Score=19.79  Aligned_cols=9  Identities=0%  Similarity=-0.297  Sum_probs=3.5

Q ss_pred             ccccccccC
Q psy14694         94 RFKKIRIAV  102 (102)
Q Consensus        94 ~C~~c~~~~  102 (102)
                      .||.|++.|
T Consensus        22 ~CPlC~r~l   30 (54)
T PF04423_consen   22 CCPLCGRPL   30 (54)
T ss_dssp             E-TTT--EE
T ss_pred             cCCCCCCCC
Confidence            566666543


No 137
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=67.89  E-value=3.5  Score=21.28  Aligned_cols=12  Identities=17%  Similarity=0.224  Sum_probs=6.5

Q ss_pred             ceeCCCCCCCCC
Q psy14694         36 KYDCFMCPYRTP   47 (102)
Q Consensus        36 ~~~c~~c~~~~~   47 (102)
                      +..|..||..|.
T Consensus         2 pH~CtrCG~vf~   13 (112)
T COG3364           2 PHQCTRCGEVFD   13 (112)
T ss_pred             Cceecccccccc
Confidence            345555665554


No 138
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=66.65  E-value=5.3  Score=17.73  Aligned_cols=28  Identities=18%  Similarity=0.308  Sum_probs=17.1

Q ss_pred             eCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCc
Q psy14694         38 DCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQR   77 (102)
Q Consensus        38 ~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   77 (102)
                      .|..|++.|..            ..+.+.|..||+.|-..
T Consensus         4 ~C~~C~~~F~~------------~~rk~~Cr~Cg~~~C~~   31 (57)
T cd00065           4 SCMGCGKPFTL------------TRRRHHCRNCGRIFCSK   31 (57)
T ss_pred             cCcccCccccC------------CccccccCcCcCCcChH
Confidence            46667766653            13446777788776543


No 139
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=66.54  E-value=3.2  Score=22.94  Aligned_cols=8  Identities=25%  Similarity=0.476  Sum_probs=4.4

Q ss_pred             ccCCCCCC
Q psy14694         65 YKCFVCPY   72 (102)
Q Consensus        65 ~~c~~c~~   72 (102)
                      |.|..||.
T Consensus       113 l~C~~Cg~  120 (146)
T PF07295_consen  113 LVCENCGH  120 (146)
T ss_pred             EecccCCC
Confidence            55555553


No 140
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=66.50  E-value=1.2  Score=19.76  Aligned_cols=8  Identities=0%  Similarity=-0.180  Sum_probs=3.2

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      |.||.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            77887765


No 141
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=65.36  E-value=5.3  Score=20.69  Aligned_cols=7  Identities=43%  Similarity=1.160  Sum_probs=3.8

Q ss_pred             ccCCCCC
Q psy14694         65 YKCFVCP   71 (102)
Q Consensus        65 ~~c~~c~   71 (102)
                      |.|..|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            5555554


No 142
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=65.08  E-value=10  Score=15.95  Aligned_cols=23  Identities=22%  Similarity=0.229  Sum_probs=12.6

Q ss_pred             cCCccccccc-cCHHHHHHHHhhh
Q psy14694          3 KCTHCKVDLN-LDTEIILQHYKLC   25 (102)
Q Consensus         3 ~c~~c~~~f~-~~~~~l~~h~~~~   25 (102)
                      .|+.||..|. ...++...|.+-|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            5777887663 1333444555544


No 143
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=64.91  E-value=9.8  Score=23.10  Aligned_cols=57  Identities=14%  Similarity=0.135  Sum_probs=29.2

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      ..+.|.|..|...+..        +.-.-...-.|..|.+.|..--     .....|---|.|+.|+..|
T Consensus       109 ~drqFaC~~Cd~~WwR--------rvp~rKeVSRCr~C~~rYDPVP-----~dkmwG~aef~C~~C~h~F  165 (278)
T PF15135_consen  109 VDRQFACSSCDHMWWR--------RVPQRKEVSRCRKCRKRYDPVP-----CDKMWGIAEFHCPKCRHNF  165 (278)
T ss_pred             cceeeeccccchHHHh--------ccCcccccccccccccccCCCc-----cccccceeeeecccccccc
Confidence            3466788877544321        2212222345666665554321     1224555557777777655


No 144
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=64.13  E-value=4.3  Score=18.49  Aligned_cols=13  Identities=8%  Similarity=0.105  Sum_probs=8.7

Q ss_pred             CCCcccccccccc
Q psy14694         89 SDEQLRFKKIRIA  101 (102)
Q Consensus        89 ~~~~~~C~~c~~~  101 (102)
                      +...|+|+.||..
T Consensus        11 ~~v~~~Cp~cGip   23 (55)
T PF13824_consen   11 AHVNFECPDCGIP   23 (55)
T ss_pred             cccCCcCCCCCCc
Confidence            3456788888763


No 145
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=63.13  E-value=2.5  Score=23.14  Aligned_cols=30  Identities=17%  Similarity=0.311  Sum_probs=19.4

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCcccccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIA  101 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~  101 (102)
                      .|.|..|+..+..      +.++  ....|.|..|+-.
T Consensus       123 ~~~C~~C~~~~~r------~~~~--~~~~~~C~~C~~~  152 (157)
T PF10263_consen  123 VYRCPSCGREYKR------HRRS--KRKRYRCGRCGGP  152 (157)
T ss_pred             EEEcCCCCCEeee------eccc--chhhEECCCCCCE
Confidence            4788889876643      3333  3334899999853


No 146
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=63.06  E-value=3.4  Score=17.25  Aligned_cols=19  Identities=16%  Similarity=0.016  Sum_probs=12.9

Q ss_pred             CCccCCCCCCccCCchhhh
Q psy14694         63 RPYKCFVCPYRSNQRANLM   81 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~   81 (102)
                      ....|..|+-.+.....|.
T Consensus        18 ~id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEEECCCCCeEEccHHHHH
Confidence            4467888887777666554


No 147
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.87  E-value=2.6  Score=25.16  Aligned_cols=26  Identities=19%  Similarity=0.340  Sum_probs=15.1

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhh
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRA   58 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~   58 (102)
                      -++..+|++|+-.|.....+..-.++
T Consensus        16 ~kk~ieCPvC~tkFkkeev~tgsiRi   41 (267)
T COG1655          16 YKKTIECPVCNTKFKKEEVKTGSIRI   41 (267)
T ss_pred             hhceeccCcccchhhhhheeccceeE
Confidence            35567777777766655444444443


No 148
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=62.05  E-value=4.2  Score=21.73  Aligned_cols=10  Identities=30%  Similarity=0.879  Sum_probs=5.8

Q ss_pred             ccCCCCCCccC
Q psy14694         65 YKCFVCPYRSN   75 (102)
Q Consensus        65 ~~c~~c~~~f~   75 (102)
                      ..| .|+..|.
T Consensus        71 ~~C-~Cg~~~~   80 (124)
T PRK00762         71 IEC-ECGYEGV   80 (124)
T ss_pred             EEe-eCcCccc
Confidence            456 6665554


No 149
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=60.97  E-value=2.3  Score=17.14  Aligned_cols=10  Identities=0%  Similarity=-0.140  Sum_probs=5.1

Q ss_pred             cccccccccc
Q psy14694         92 QLRFKKIRIA  101 (102)
Q Consensus        92 ~~~C~~c~~~  101 (102)
                      .+.|+.|++.
T Consensus         4 ~~~C~nC~R~   13 (33)
T PF08209_consen    4 YVECPNCGRP   13 (33)
T ss_dssp             EEE-TTTSSE
T ss_pred             eEECCCCcCC
Confidence            3566666653


No 150
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=60.90  E-value=4.3  Score=18.15  Aligned_cols=25  Identities=16%  Similarity=0.404  Sum_probs=11.0

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      ..|.|+.|...|-..-.+-.|...|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CeEECCCCCCccccCcChhhhcccc
Confidence            3477777777776655555554433


No 151
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=60.76  E-value=3.2  Score=17.43  Aligned_cols=13  Identities=8%  Similarity=-0.135  Sum_probs=7.9

Q ss_pred             CCCcccccccccc
Q psy14694         89 SDEQLRFKKIRIA  101 (102)
Q Consensus        89 ~~~~~~C~~c~~~  101 (102)
                      +-..+.|+.||..
T Consensus        29 ~vp~~~C~~CGE~   41 (46)
T TIGR03831        29 NVPALVCPQCGEE   41 (46)
T ss_pred             CCCccccccCCCE
Confidence            3344667777764


No 152
>PLN02294 cytochrome c oxidase subunit Vb
Probab=60.62  E-value=3.8  Score=23.26  Aligned_cols=17  Identities=0%  Similarity=-0.066  Sum_probs=11.9

Q ss_pred             hhcCCCCccccccccccC
Q psy14694         85 LVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        85 ~~~~~~~~~~C~~c~~~~  102 (102)
                      .++.| +|++|++||.-|
T Consensus       135 ~L~kG-kp~RCpeCG~~f  151 (174)
T PLN02294        135 WLEKG-KSFECPVCTQYF  151 (174)
T ss_pred             EecCC-CceeCCCCCCEE
Confidence            34444 699999998644


No 153
>PRK04023 DNA polymerase II large subunit; Validated
Probab=60.58  E-value=10  Score=27.85  Aligned_cols=9  Identities=11%  Similarity=-0.101  Sum_probs=6.0

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      ++.|+.||.
T Consensus       663 ~y~CPKCG~  671 (1121)
T PRK04023        663 EDECEKCGR  671 (1121)
T ss_pred             CCcCCCCCC
Confidence            366777775


No 154
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=60.46  E-value=4.9  Score=18.22  Aligned_cols=9  Identities=33%  Similarity=0.766  Sum_probs=4.5

Q ss_pred             CccCCCCCC
Q psy14694         64 PYKCFVCPY   72 (102)
Q Consensus        64 ~~~c~~c~~   72 (102)
                      |+-|+.|.+
T Consensus        28 PlyCpKCK~   36 (55)
T PF14205_consen   28 PLYCPKCKQ   36 (55)
T ss_pred             cccCCCCCc
Confidence            445555543


No 155
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=60.09  E-value=3.6  Score=15.92  Aligned_cols=9  Identities=22%  Similarity=0.608  Sum_probs=4.8

Q ss_pred             cCCCCCCcc
Q psy14694         66 KCFVCPYRS   74 (102)
Q Consensus        66 ~c~~c~~~f   74 (102)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            345555555


No 156
>PRK05978 hypothetical protein; Provisional
Probab=60.01  E-value=6.1  Score=21.93  Aligned_cols=10  Identities=20%  Similarity=0.484  Sum_probs=5.0

Q ss_pred             cCCCCCCccC
Q psy14694         66 KCFVCPYRSN   75 (102)
Q Consensus        66 ~c~~c~~~f~   75 (102)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4555554443


No 157
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=59.65  E-value=9.8  Score=16.01  Aligned_cols=11  Identities=9%  Similarity=0.123  Sum_probs=7.2

Q ss_pred             CCccccccccc
Q psy14694         90 DEQLRFKKIRI  100 (102)
Q Consensus        90 ~~~~~C~~c~~  100 (102)
                      .....||.|++
T Consensus        34 ~~~~~CP~C~k   44 (44)
T PF14634_consen   34 GKSVKCPICRK   44 (44)
T ss_pred             CCCCCCcCCCC
Confidence            45667777764


No 158
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=59.60  E-value=5.2  Score=17.95  Aligned_cols=10  Identities=20%  Similarity=0.079  Sum_probs=4.7

Q ss_pred             CCcccccccc
Q psy14694         90 DEQLRFKKIR   99 (102)
Q Consensus        90 ~~~~~C~~c~   99 (102)
                      +....||.||
T Consensus        44 ~~i~~Cp~Cg   53 (56)
T PF02591_consen   44 DEIVFCPNCG   53 (56)
T ss_pred             CCeEECcCCC
Confidence            3444455554


No 159
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=59.50  E-value=5.3  Score=21.92  Aligned_cols=13  Identities=23%  Similarity=0.031  Sum_probs=8.4

Q ss_pred             CCccccccccccC
Q psy14694         90 DEQLRFKKIRIAV  102 (102)
Q Consensus        90 ~~~~~C~~c~~~~  102 (102)
                      +.-|.|+.||+-|
T Consensus       122 ~~f~~C~~C~kiy  134 (147)
T PF01927_consen  122 DEFWRCPGCGKIY  134 (147)
T ss_pred             CeEEECCCCCCEe
Confidence            3357788887743


No 160
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the smart00661 RPOL9 RNA polymerase subunit 9.
Probab=57.54  E-value=9.8  Score=16.51  Aligned_cols=14  Identities=21%  Similarity=0.596  Sum_probs=10.0

Q ss_pred             CccCCCCCCccCCc
Q psy14694         64 PYKCFVCPYRSNQR   77 (102)
Q Consensus        64 ~~~c~~c~~~f~~~   77 (102)
                      .+.|+.|+..+...
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            57899898766543


No 162
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=57.44  E-value=5  Score=21.87  Aligned_cols=25  Identities=12%  Similarity=0.058  Sum_probs=16.9

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCc
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQ   92 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~   92 (102)
                      ..|.++|+.|..   |++|+.+|.|--|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            457777777764   6777777766543


No 163
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=57.32  E-value=7.7  Score=17.59  Aligned_cols=11  Identities=18%  Similarity=0.211  Sum_probs=6.1

Q ss_pred             CCccCCCCCCc
Q psy14694         63 RPYKCFVCPYR   73 (102)
Q Consensus        63 ~~~~c~~c~~~   73 (102)
                      ....|+.|+..
T Consensus        20 DiVvCp~Cgap   30 (54)
T PF14446_consen   20 DIVVCPECGAP   30 (54)
T ss_pred             CEEECCCCCCc
Confidence            34566666643


No 164
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.91  E-value=4.7  Score=18.74  Aligned_cols=51  Identities=18%  Similarity=0.263  Sum_probs=24.0

Q ss_pred             eCCCCCCC-CCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCc
Q psy14694         38 DCFMCPYR-TPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQ   92 (102)
Q Consensus        38 ~c~~c~~~-~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   92 (102)
                      .|.+|.+. +-....+..-+......+.|.|++|......+    .-.|+.+|...
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva~k----t~~R~~~g~f~   55 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVAIK----TISRVNSGHFN   55 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhchh----hHHHhccCCcc
Confidence            45566543 22223333222223334568899886544332    33455555443


No 165
>KOG2907|consensus
Probab=56.90  E-value=7.6  Score=20.46  Aligned_cols=36  Identities=14%  Similarity=0.105  Sum_probs=18.6

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCc--cccccccccC
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQ--LRFKKIRIAV  102 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~--~~C~~c~~~~  102 (102)
                      .+|+.||..=..-..+  .+|..-....  |.|+.|+..|
T Consensus        75 ~kCpkCghe~m~Y~T~--QlRSADEGQTVFYTC~kC~~k~  112 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTL--QLRSADEGQTVFYTCPKCKYKF  112 (116)
T ss_pred             ccCcccCCchhhhhhh--hcccccCCceEEEEcCccceee
Confidence            5788887432221121  2333333333  8888888654


No 166
>PRK01343 zinc-binding protein; Provisional
Probab=56.61  E-value=8  Score=17.76  Aligned_cols=9  Identities=22%  Similarity=0.382  Sum_probs=4.9

Q ss_pred             ccCCCCCCc
Q psy14694         65 YKCFVCPYR   73 (102)
Q Consensus        65 ~~c~~c~~~   73 (102)
                      ..|+.|++.
T Consensus        10 ~~CP~C~k~   18 (57)
T PRK01343         10 RPCPECGKP   18 (57)
T ss_pred             CcCCCCCCc
Confidence            456666643


No 167
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=56.31  E-value=5.3  Score=18.60  Aligned_cols=28  Identities=18%  Similarity=0.362  Sum_probs=11.2

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccC
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSN   75 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~   75 (102)
                      .-.|..|++.|..            ..+.+.|..||..|-
T Consensus         9 ~~~C~~C~~~F~~------------~~rrhhCr~CG~~vC   36 (69)
T PF01363_consen    9 ASNCMICGKKFSL------------FRRRHHCRNCGRVVC   36 (69)
T ss_dssp             -SB-TTT--B-BS------------SS-EEE-TTT--EEE
T ss_pred             CCcCcCcCCcCCC------------ceeeEccCCCCCEEC
Confidence            3467788887742            124456777777664


No 168
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=55.87  E-value=6.8  Score=21.41  Aligned_cols=31  Identities=23%  Similarity=0.266  Sum_probs=19.3

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCcccccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIA  101 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~  101 (102)
                      .|.|..|+..+..      +.+ +....-|.|..|+-.
T Consensus       112 ~y~C~~C~~~~~~------~rr-~~~~~~y~C~~C~g~  142 (146)
T smart00731      112 PYRCTGCGQRYLR------VRR-SNNVSRYRCGKCGGK  142 (146)
T ss_pred             EEECCCCCCCCce------Ecc-ccCcceEEcCCCCCE
Confidence            5888888866542      222 222256889888754


No 169
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=55.80  E-value=6.5  Score=21.91  Aligned_cols=13  Identities=23%  Similarity=0.506  Sum_probs=9.5

Q ss_pred             CccCCCCCCccCC
Q psy14694         64 PYKCFVCPYRSNQ   76 (102)
Q Consensus        64 ~~~c~~c~~~f~~   76 (102)
                      .-.|..|+..|.+
T Consensus        28 RReC~~C~~RFTT   40 (156)
T COG1327          28 RRECLECGERFTT   40 (156)
T ss_pred             hhcccccccccch
Confidence            3578888887764


No 170
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=55.60  E-value=2.3  Score=21.81  Aligned_cols=38  Identities=18%  Similarity=0.301  Sum_probs=20.6

Q ss_pred             CCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccC
Q psy14694         34 RKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSN   75 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~   75 (102)
                      ++.|+|+.|+..-...-.+..-    ...-...|..||..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEec----CceeEEEcccCcceEE
Confidence            5668888887654433222111    1112356888887664


No 171
>KOG2593|consensus
Probab=55.36  E-value=12  Score=24.58  Aligned_cols=38  Identities=13%  Similarity=0.241  Sum_probs=26.4

Q ss_pred             CCCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCc
Q psy14694         33 SRKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYR   73 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~   73 (102)
                      ....|.|+.|.+.|+...++.   -+....-.|.|..|+-.
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccCCccccchhhhHHHH---hhcccCceEEEecCCCc
Confidence            567799999999988766653   23333445888888753


No 172
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=55.09  E-value=4.5  Score=16.66  Aligned_cols=10  Identities=10%  Similarity=-0.004  Sum_probs=4.7

Q ss_pred             Cccccccccc
Q psy14694         91 EQLRFKKIRI  100 (102)
Q Consensus        91 ~~~~C~~c~~  100 (102)
                      +-|.|..||-
T Consensus         5 ~~YkC~~CGn   14 (36)
T PF06397_consen    5 EFYKCEHCGN   14 (36)
T ss_dssp             EEEE-TTT--
T ss_pred             cEEEccCCCC
Confidence            3477777763


No 173
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=55.06  E-value=6.6  Score=21.76  Aligned_cols=14  Identities=21%  Similarity=0.406  Sum_probs=10.5

Q ss_pred             CccCCCCCCccCCc
Q psy14694         64 PYKCFVCPYRSNQR   77 (102)
Q Consensus        64 ~~~c~~c~~~f~~~   77 (102)
                      .-.|..|++.|++-
T Consensus        28 RReC~~C~~RFTTy   41 (147)
T TIGR00244        28 RRECLECHERFTTF   41 (147)
T ss_pred             cccCCccCCcccee
Confidence            36788899888753


No 174
>KOG4173|consensus
Probab=54.56  E-value=1.5  Score=25.61  Aligned_cols=19  Identities=21%  Similarity=0.571  Sum_probs=9.4

Q ss_pred             cCCccccccccCHHHHHHHH
Q psy14694          3 KCTHCKVDLNLDTEIILQHY   22 (102)
Q Consensus         3 ~c~~c~~~f~~~~~~l~~h~   22 (102)
                      .|..|.++|. +...|..|+
T Consensus       108 sCs~C~r~~P-t~hLLd~HI  126 (253)
T KOG4173|consen  108 SCSFCKRAFP-TGHLLDAHI  126 (253)
T ss_pred             hhHHHHHhCC-chhhhhHHH
Confidence            3445555555 444444444


No 175
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=54.41  E-value=8.3  Score=17.09  Aligned_cols=9  Identities=33%  Similarity=0.966  Sum_probs=4.3

Q ss_pred             CccCCCCCC
Q psy14694         64 PYKCFVCPY   72 (102)
Q Consensus        64 ~~~c~~c~~   72 (102)
                      .+.|..|+.
T Consensus        37 r~~C~~Cgy   45 (50)
T PRK00432         37 RWHCGKCGY   45 (50)
T ss_pred             cEECCCcCC
Confidence            344555543


No 176
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=54.22  E-value=5.9  Score=16.93  Aligned_cols=8  Identities=0%  Similarity=-0.296  Sum_probs=4.2

Q ss_pred             cccccccC
Q psy14694         95 FKKIRIAV  102 (102)
Q Consensus        95 C~~c~~~~  102 (102)
                      |+.||+.|
T Consensus        11 C~~C~rpf   18 (42)
T PF10013_consen   11 CPVCGRPF   18 (42)
T ss_pred             CcccCCcc
Confidence            55555544


No 177
>KOG4167|consensus
Probab=54.10  E-value=3.3  Score=28.96  Aligned_cols=24  Identities=17%  Similarity=0.247  Sum_probs=19.4

Q ss_pred             ccCCccccccccCHHHHHHHHhhhc
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCS   26 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~   26 (102)
                      |.|.+|++.|- ....+..|+++|.
T Consensus       793 FpCreC~kvF~-KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFF-KIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHH-HHhhhhHHHHHHH
Confidence            78999999997 6666778888875


No 178
>PHA02998 RNA polymerase subunit; Provisional
Probab=53.83  E-value=5.8  Score=22.73  Aligned_cols=12  Identities=17%  Similarity=0.279  Sum_probs=5.9

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      |.|..|++.|..
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            445555554443


No 179
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=53.74  E-value=5.5  Score=20.41  Aligned_cols=18  Identities=6%  Similarity=-0.034  Sum_probs=12.6

Q ss_pred             hhhcCCCCccccccccccC
Q psy14694         84 PLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        84 ~~~~~~~~~~~C~~c~~~~  102 (102)
                      ...+.| +++.|+.||.-|
T Consensus        72 ~~l~~g-~~~rC~eCG~~f   89 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVF   89 (97)
T ss_pred             EEEeCC-CceeCCCCCcEE
Confidence            445666 689999988643


No 180
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=53.64  E-value=9.1  Score=25.63  Aligned_cols=21  Identities=10%  Similarity=-0.197  Sum_probs=11.1

Q ss_pred             hhhhhhhcCCCCccccccccc
Q psy14694         80 LMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        80 l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      |.-|.--+....|..||.||-
T Consensus       241 l~Ch~Cg~~~~~~~~Cp~C~s  261 (505)
T TIGR00595       241 LRCHYCGYQEPIPKTCPQCGS  261 (505)
T ss_pred             EEcCCCcCcCCCCCCCCCCCC
Confidence            333433344455667777764


No 181
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=53.14  E-value=6.5  Score=20.38  Aligned_cols=9  Identities=11%  Similarity=-0.152  Sum_probs=5.4

Q ss_pred             ccccccccc
Q psy14694         93 LRFKKIRIA  101 (102)
Q Consensus        93 ~~C~~c~~~  101 (102)
                      ..||+||..
T Consensus        50 t~CP~Cg~~   58 (115)
T COG1885          50 TSCPKCGEP   58 (115)
T ss_pred             ccCCCCCCc
Confidence            456666654


No 182
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=52.21  E-value=7.7  Score=23.89  Aligned_cols=12  Identities=33%  Similarity=0.811  Sum_probs=6.8

Q ss_pred             CCccCCCCCCcc
Q psy14694         63 RPYKCFVCPYRS   74 (102)
Q Consensus        63 ~~~~c~~c~~~f   74 (102)
                      +.+.|+.||..+
T Consensus       321 r~~~C~~cg~~~  332 (364)
T COG0675         321 RLFKCPRCGFVH  332 (364)
T ss_pred             eeEECCCCCCee
Confidence            445666666543


No 183
>PRK05580 primosome assembly protein PriA; Validated
Probab=52.12  E-value=11  Score=26.34  Aligned_cols=21  Identities=10%  Similarity=-0.176  Sum_probs=12.6

Q ss_pred             hhhhhhhcCCCCccccccccc
Q psy14694         80 LMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        80 l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      |.-|.--+....|..|+.||.
T Consensus       409 l~Ch~Cg~~~~~~~~Cp~Cg~  429 (679)
T PRK05580        409 LRCHHCGYQEPIPKACPECGS  429 (679)
T ss_pred             EECCCCcCCCCCCCCCCCCcC
Confidence            344444445555777888864


No 184
>KOG3214|consensus
Probab=51.51  E-value=4.9  Score=20.65  Aligned_cols=13  Identities=15%  Similarity=0.388  Sum_probs=8.7

Q ss_pred             ccCCCCCCccCCc
Q psy14694         65 YKCFVCPYRSNQR   77 (102)
Q Consensus        65 ~~c~~c~~~f~~~   77 (102)
                      ..|.+|+..|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            5677777777543


No 185
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=50.50  E-value=19  Score=20.15  Aligned_cols=43  Identities=21%  Similarity=0.389  Sum_probs=17.7

Q ss_pred             cCCcccccccc-----CHHHHHHHHhhhc--ccccc----CCCCceeCCCCCCC
Q psy14694          3 KCTHCKVDLNL-----DTEIILQHYKLCS--EGARQ----SSRKKYDCFMCPYR   45 (102)
Q Consensus         3 ~c~~c~~~f~~-----~~~~l~~h~~~~~--~~~~~----~~~~~~~c~~c~~~   45 (102)
                      +|..|+++|.+     ..+++..|+....  +...|    .++..++|-.||..
T Consensus        16 ~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~~   69 (152)
T PF09416_consen   16 KCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGSR   69 (152)
T ss_dssp             EETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT---
T ss_pred             EcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCCC
Confidence            57778888842     3345666654322  11222    24556778777753


No 186
>PF14369 zf-RING_3:  zinc-finger
Probab=50.23  E-value=6.3  Score=16.01  Aligned_cols=9  Identities=0%  Similarity=-0.134  Sum_probs=6.3

Q ss_pred             ccccccccC
Q psy14694         94 RFKKIRIAV  102 (102)
Q Consensus        94 ~C~~c~~~~  102 (102)
                      .||.|+-+|
T Consensus        23 ~CP~C~~gF   31 (35)
T PF14369_consen   23 ACPRCHGGF   31 (35)
T ss_pred             CCcCCCCcE
Confidence            577777665


No 187
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=49.56  E-value=12  Score=17.30  Aligned_cols=26  Identities=23%  Similarity=0.446  Sum_probs=15.7

Q ss_pred             CCCCCCCcchHHHHhhhhcCCCCccCCCCCC
Q psy14694         42 CPYRTPYSGTMRRHIRAHIGDRPYKCFVCPY   72 (102)
Q Consensus        42 c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~   72 (102)
                      ||..|...  |.   -...|++...|+.|..
T Consensus        27 CGDRFeIs--Le---Dl~~GE~VArCPSCSL   52 (67)
T COG5216          27 CGDRFEIS--LE---DLRNGEVVARCPSCSL   52 (67)
T ss_pred             CCCEeEEE--HH---HhhCCceEEEcCCceE
Confidence            66666542  32   2346777777877753


No 188
>PRK14873 primosome assembly protein PriA; Provisional
Probab=49.49  E-value=8.6  Score=26.77  Aligned_cols=10  Identities=10%  Similarity=0.062  Sum_probs=7.1

Q ss_pred             Cccccccccc
Q psy14694         91 EQLRFKKIRI  100 (102)
Q Consensus        91 ~~~~C~~c~~  100 (102)
                      .|+.|+.||-
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            4777888874


No 189
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=49.43  E-value=9.5  Score=21.80  Aligned_cols=38  Identities=8%  Similarity=0.070  Sum_probs=23.4

Q ss_pred             CCccCCCCCCccCCchhhhhhhhh--cCC----------CCccccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLV--QIS----------DEQLRFKKIRI  100 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~--~~~----------~~~~~C~~c~~  100 (102)
                      ....|..||+.|.....+..=...  +.+          +..+-|++|..
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~~~~~~l~~~~~~~~~~~~~~~~~~~Cp~Cr~  162 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVALAAELLAQQQNAPQNREMLRAQASVCPECKQ  162 (181)
T ss_pred             ccCcCcccCCccCcHhHHHHHHHHhhhccCcHhhHHHHHHHhccCHHHHh
Confidence            467899999999866544422211  221          12467999974


No 190
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=49.41  E-value=6.6  Score=14.61  Aligned_cols=6  Identities=0%  Similarity=-0.191  Sum_probs=3.2

Q ss_pred             cccccc
Q psy14694         95 FKKIRI  100 (102)
Q Consensus        95 C~~c~~  100 (102)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            555554


No 191
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=48.30  E-value=6.8  Score=17.91  Aligned_cols=36  Identities=17%  Similarity=0.346  Sum_probs=17.3

Q ss_pred             eeCCCCCCCCCCcchHHHHhhhh-cCCCCccCCCCCC
Q psy14694         37 YDCFMCPYRTPYSGTMRRHIRAH-IGDRPYKCFVCPY   72 (102)
Q Consensus        37 ~~c~~c~~~~~~~~~l~~h~~~h-~~~~~~~c~~c~~   72 (102)
                      ..|..|++..........-.+.- .....|.|..|..
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~   39 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKE   39 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHH
Confidence            35666666544443333222221 2234477777753


No 192
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=48.26  E-value=16  Score=21.38  Aligned_cols=36  Identities=14%  Similarity=0.170  Sum_probs=19.3

Q ss_pred             CceeCCCCCCCCCCcchHHHHhhhhc--CCCCccCCCCCCccCC
Q psy14694         35 KKYDCFMCPYRTPYSGTMRRHIRAHI--GDRPYKCFVCPYRSNQ   76 (102)
Q Consensus        35 ~~~~c~~c~~~~~~~~~l~~h~~~h~--~~~~~~c~~c~~~f~~   76 (102)
                      ..+.|+.|+.    ..  ..|.-+-.  .+-.+.|..||..+..
T Consensus         5 iy~~Cp~Cg~----ee--v~hEVik~~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           5 IYIECPSCGS----EE--VSHEVIKERGREPLVRCEECGTVHPA   42 (201)
T ss_pred             EEEECCCCCc----ch--hhHHHHHhcCCceEEEccCCCcEeec
Confidence            3467888871    11  12222222  2234789999877643


No 193
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=47.66  E-value=7.9  Score=17.08  Aligned_cols=15  Identities=27%  Similarity=0.454  Sum_probs=10.5

Q ss_pred             CccCCCCCCccCCch
Q psy14694         64 PYKCFVCPYRSNQRA   78 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~   78 (102)
                      =+.|..|++.+....
T Consensus        26 Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   26 CFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TSBETTTTCBTTTSS
T ss_pred             ccccCCCCCccCCCe
Confidence            478888887776553


No 194
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=47.21  E-value=11  Score=19.38  Aligned_cols=11  Identities=18%  Similarity=0.425  Sum_probs=7.3

Q ss_pred             ccCCCCCCccC
Q psy14694         65 YKCFVCPYRSN   75 (102)
Q Consensus        65 ~~c~~c~~~f~   75 (102)
                      ..|..||..+.
T Consensus        43 ~~C~~CG~y~~   53 (99)
T PRK14892         43 ITCGNCGLYTE   53 (99)
T ss_pred             EECCCCCCccC
Confidence            56777776554


No 195
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=47.18  E-value=5.3  Score=22.67  Aligned_cols=18  Identities=17%  Similarity=0.307  Sum_probs=13.7

Q ss_pred             CCccCCCCCCccCCchhh
Q psy14694         63 RPYKCFVCPYRSNQRANL   80 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l   80 (102)
                      .++.|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            467899999999765543


No 196
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=47.11  E-value=9.8  Score=20.69  Aligned_cols=14  Identities=0%  Similarity=-0.187  Sum_probs=10.1

Q ss_pred             CCCCcccccccccc
Q psy14694         88 ISDEQLRFKKIRIA  101 (102)
Q Consensus        88 ~~~~~~~C~~c~~~  101 (102)
                      .++....||+|+..
T Consensus       101 ~g~~~~~CPwCg~~  114 (131)
T PF15616_consen  101 DGEGEVTCPWCGNE  114 (131)
T ss_pred             CCCCCEECCCCCCe
Confidence            44557889999864


No 197
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=46.96  E-value=5.2  Score=16.89  Aligned_cols=11  Identities=0%  Similarity=-0.248  Sum_probs=6.8

Q ss_pred             ccccccccccC
Q psy14694         92 QLRFKKIRIAV  102 (102)
Q Consensus        92 ~~~C~~c~~~~  102 (102)
                      +-.|+.||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            56677776543


No 198
>KOG1729|consensus
Probab=46.89  E-value=12  Score=23.28  Aligned_cols=53  Identities=15%  Similarity=0.208  Sum_probs=25.5

Q ss_pred             CceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCc-cccccc
Q psy14694         35 KKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQ-LRFKKI   98 (102)
Q Consensus        35 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~-~~C~~c   98 (102)
                      ..-.|..|+...+.   |.  .|.|      -|..||..|...-.-..........++ +.|+.|
T Consensus       167 ea~~C~~C~~~~Ft---l~--~RRH------HCR~CG~ivC~~Cs~n~~~l~~~~~k~~rvC~~C  220 (288)
T KOG1729|consen  167 EATECMVCGCTEFT---LS--ERRH------HCRNCGDIVCAPCSRNRFLLPNLSTKPIRVCDIC  220 (288)
T ss_pred             cceecccCCCcccc---HH--HHHH------HHHhcchHhhhhhhcCcccccccCCCCceecHHH
Confidence            34567888875222   21  1222      266677666553332222222333444 477776


No 199
>KOG2482|consensus
Probab=45.90  E-value=22  Score=22.81  Aligned_cols=29  Identities=17%  Similarity=0.371  Sum_probs=22.4

Q ss_pred             ccCCccccccccCHHHHHHHHhhhcccccc
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQ   31 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~   31 (102)
                      +.|-.|.+.|+ +...|..||+.-.+.+.-
T Consensus       196 ~~CLyCekifr-dkntLkeHMrkK~Hrrin  224 (423)
T KOG2482|consen  196 LRCLYCEKIFR-DKNTLKEHMRKKRHRRIN  224 (423)
T ss_pred             heeeeeccccC-CcHHHHHHHHhccCcccC
Confidence            46888999999 999999999875544433


No 200
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=45.75  E-value=13  Score=20.82  Aligned_cols=16  Identities=19%  Similarity=0.281  Sum_probs=10.4

Q ss_pred             CCccCCCCCCccCCch
Q psy14694         63 RPYKCFVCPYRSNQRA   78 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~   78 (102)
                      .|.-|..||+.|.+..
T Consensus        67 ~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   67 APSYCHNCGKPYPWTE   82 (158)
T ss_pred             CChhHHhCCCCCchHH
Confidence            5666777777776653


No 201
>KOG0782|consensus
Probab=45.50  E-value=7.7  Score=26.62  Aligned_cols=24  Identities=8%  Similarity=0.112  Sum_probs=11.8

Q ss_pred             hhhhhhhhcCCCCccccccccccC
Q psy14694         79 NLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        79 ~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .|.+|.=+|..-.--+|..|||+|
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgF  263 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGF  263 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhh
Confidence            444444444444444555555554


No 202
>PTZ00448 hypothetical protein; Provisional
Probab=45.08  E-value=21  Score=23.02  Aligned_cols=23  Identities=35%  Similarity=0.716  Sum_probs=17.4

Q ss_pred             ccCCccccccccCHHHHHHHHhhh
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLC   25 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~   25 (102)
                      |.|..|+..|. +......|.++.
T Consensus       315 ~tC~~C~v~F~-~~~~qR~H~KSD  337 (373)
T PTZ00448        315 LLCRKCNIQLM-DHNAFKQHYRSE  337 (373)
T ss_pred             ccccccccccC-CHHHHHHHhhhh
Confidence            66888888887 777777777763


No 203
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=45.07  E-value=12  Score=14.61  Aligned_cols=12  Identities=8%  Similarity=-0.194  Sum_probs=5.0

Q ss_pred             CCCccccccccc
Q psy14694         89 SDEQLRFKKIRI  100 (102)
Q Consensus        89 ~~~~~~C~~c~~  100 (102)
                      ++..-.|+.|+.
T Consensus        18 ~g~~r~C~~Cg~   29 (32)
T PF09297_consen   18 GGWARRCPSCGH   29 (32)
T ss_dssp             SSS-EEESSSS-
T ss_pred             CcCEeECCCCcC
Confidence            344445555553


No 204
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=44.89  E-value=4.3  Score=19.98  Aligned_cols=39  Identities=23%  Similarity=0.365  Sum_probs=13.0

Q ss_pred             CCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCC
Q psy14694         34 RKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQ   76 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~   76 (102)
                      ++.|.|+.|+..-+..-.+.    .-.+.-...|..|+..|..
T Consensus        20 ~~~F~CPfC~~~~sV~v~id----kk~~~~~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   20 PKVFDCPFCNHEKSVSVKID----KKEGIGILSCRVCGESFQT   58 (81)
T ss_dssp             SS----TTT--SS-EEEEEE----TTTTEEEEEESSS--EEEE
T ss_pred             CceEcCCcCCCCCeEEEEEE----ccCCEEEEEecCCCCeEEE
Confidence            45677777764322222221    0112223567777766643


No 205
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=44.84  E-value=7.9  Score=15.52  Aligned_cols=9  Identities=0%  Similarity=-0.507  Sum_probs=4.4

Q ss_pred             ccccccccc
Q psy14694         93 LRFKKIRIA  101 (102)
Q Consensus        93 ~~C~~c~~~  101 (102)
                      +.|..||.+
T Consensus        22 ~~C~~Cg~~   30 (33)
T PF08792_consen   22 EVCIFCGSS   30 (33)
T ss_pred             EEcccCCcE
Confidence            345555544


No 206
>KOG2785|consensus
Probab=44.18  E-value=39  Score=22.01  Aligned_cols=23  Identities=22%  Similarity=0.293  Sum_probs=15.6

Q ss_pred             cCCccccccccCHHHHHHHHhhhc
Q psy14694          3 KCTHCKVDLNLDTEIILQHYKLCS   26 (102)
Q Consensus         3 ~c~~c~~~f~~~~~~l~~h~~~~~   26 (102)
                      .|-.|++.+. +...-..|+..++
T Consensus       168 ~CLfC~~~~k-~~e~~~~HM~~~H  190 (390)
T KOG2785|consen  168 DCLFCDKKSK-SLEENLKHMFKEH  190 (390)
T ss_pred             ceeecCCCcc-cHHHHHHHHhhcc
Confidence            4677888887 6665566776654


No 207
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=44.09  E-value=16  Score=24.37  Aligned_cols=16  Identities=19%  Similarity=0.505  Sum_probs=10.8

Q ss_pred             CCCccCCCCCCccCCc
Q psy14694         62 DRPYKCFVCPYRSNQR   77 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~   77 (102)
                      ...|+|..|+..+...
T Consensus       423 ~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        423 GPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCeEEECCCCeEECCC
Confidence            3457888888766543


No 208
>KOG0717|consensus
Probab=43.79  E-value=11  Score=25.15  Aligned_cols=22  Identities=23%  Similarity=0.381  Sum_probs=19.3

Q ss_pred             ccCCCCCCccCCchhhhhhhhh
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      +.|.+|.++|.....+.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999988765


No 209
>KOG1409|consensus
Probab=43.54  E-value=4.8  Score=25.63  Aligned_cols=37  Identities=19%  Similarity=0.023  Sum_probs=22.1

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      ..|.+|...|.+.. ...+.+.-.|-+.+-|++||+++
T Consensus       283 ~~cQ~c~qpffwn~-~~m~~~k~~glr~h~crkcg~av  319 (404)
T KOG1409|consen  283 DSCQKCNQPFFWNF-RQMWDRKQLGLRQHHCRKCGKAV  319 (404)
T ss_pred             chhhhhCchHHHHH-HHHHhhhhhhhhhhhhhhhhhhc
Confidence            45666666665432 23455556667777777777654


No 210
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=43.45  E-value=9.9  Score=16.63  Aligned_cols=9  Identities=0%  Similarity=-0.285  Sum_probs=4.6

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      .|.||.|+-
T Consensus        34 ~w~CP~C~a   42 (47)
T PF00301_consen   34 DWVCPVCGA   42 (47)
T ss_dssp             T-B-TTTSS
T ss_pred             CCcCcCCCC
Confidence            377888764


No 211
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=43.44  E-value=24  Score=15.28  Aligned_cols=8  Identities=38%  Similarity=1.036  Sum_probs=3.9

Q ss_pred             CccCCCCC
Q psy14694         64 PYKCFVCP   71 (102)
Q Consensus        64 ~~~c~~c~   71 (102)
                      .+.|..|+
T Consensus        28 g~~C~~C~   35 (53)
T PF00130_consen   28 GYRCSWCG   35 (53)
T ss_dssp             EEEETTTT
T ss_pred             eEEECCCC
Confidence            35555554


No 212
>KOG3002|consensus
Probab=43.27  E-value=34  Score=21.50  Aligned_cols=61  Identities=10%  Similarity=-0.033  Sum_probs=34.5

Q ss_pred             CCceeCCCCCCCCCCcchHHHHhhhhcCCCCccCC----CCCCccCCchhhhhhhhhcCCCCccccccc
Q psy14694         34 RKKYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCF----VCPYRSNQRANLMSHPLVQISDEQLRFKKI   98 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~----~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c   98 (102)
                      +....|+.|...+.....+..-.-  .......|+    -|.+.|.+... ..|.+.... .||.||.=
T Consensus        78 ~~~~~CP~Cr~~~g~~R~~amEkV--~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p  142 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGNIRCRAMEKV--AEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVP  142 (299)
T ss_pred             hhcccCCccccccccHHHHHHHHH--HHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCC
Confidence            444556666665554333322211  222334444    37777877766 578887776 78888754


No 213
>PRK04351 hypothetical protein; Provisional
Probab=43.19  E-value=12  Score=20.72  Aligned_cols=29  Identities=21%  Similarity=0.303  Sum_probs=18.9

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      .|.|..|+..+.+.       +.+ ...-|.|..|+-
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g  140 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKRYRCGKCRG  140 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCcEEeCCCCc
Confidence            38898898655432       222 246799999874


No 214
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=42.80  E-value=32  Score=24.14  Aligned_cols=8  Identities=25%  Similarity=1.103  Sum_probs=4.4

Q ss_pred             cCCccccc
Q psy14694          3 KCTHCKVD   10 (102)
Q Consensus         3 ~c~~c~~~   10 (102)
                      .|+.|+..
T Consensus         3 ~Cp~Cg~~   10 (645)
T PRK14559          3 ICPQCQFE   10 (645)
T ss_pred             cCCCCCCc
Confidence            45666544


No 215
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=42.68  E-value=24  Score=14.66  Aligned_cols=7  Identities=29%  Similarity=0.937  Sum_probs=3.2

Q ss_pred             ccCCCCC
Q psy14694         65 YKCFVCP   71 (102)
Q Consensus        65 ~~c~~c~   71 (102)
                      +.|..|+
T Consensus        28 ~~C~~C~   34 (49)
T smart00109       28 LRCSWCK   34 (49)
T ss_pred             cCCCCCC
Confidence            4454443


No 216
>PRK07591 threonine synthase; Validated
Probab=42.58  E-value=17  Score=23.80  Aligned_cols=27  Identities=19%  Similarity=0.260  Sum_probs=17.3

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccC
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSN   75 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~   75 (102)
                      .+.|..|++.+...            .. +.|+.|+-.+.
T Consensus        18 ~l~C~~Cg~~~~~~------------~~-~~C~~cg~~l~   44 (421)
T PRK07591         18 ALKCRECGAEYPLG------------PI-HVCEECFGPLE   44 (421)
T ss_pred             EEEeCCCCCcCCCC------------CC-ccCCCCCCeEE
Confidence            47888888766421            22 78888875543


No 217
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=42.49  E-value=21  Score=14.96  Aligned_cols=27  Identities=7%  Similarity=-0.079  Sum_probs=10.3

Q ss_pred             CCCccCCchhhhhhhhhcCCCCccccccc
Q psy14694         70 CPYRSNQRANLMSHPLVQISDEQLRFKKI   98 (102)
Q Consensus        70 c~~~f~~~~~l~~h~~~~~~~~~~~C~~c   98 (102)
                      ||.+|-..- |.+..+... ...+.||.|
T Consensus        16 CGH~FC~~C-l~~~~~~~~-~~~~~CP~C   42 (42)
T PF15227_consen   16 CGHSFCRSC-LERLWKEPS-GSGFSCPEC   42 (42)
T ss_dssp             SSSEEEHHH-HHHHHCCSS-SST---SSS
T ss_pred             CcCHHHHHH-HHHHHHccC-CcCCCCcCC
Confidence            566665443 223333222 223777766


No 218
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=41.97  E-value=11  Score=16.72  Aligned_cols=9  Identities=0%  Similarity=-0.285  Sum_probs=6.3

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      .|.||.|+-
T Consensus        34 ~w~CP~C~a   42 (50)
T cd00730          34 DWVCPVCGA   42 (50)
T ss_pred             CCCCCCCCC
Confidence            477888874


No 219
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.83  E-value=8.1  Score=18.85  Aligned_cols=10  Identities=30%  Similarity=0.849  Sum_probs=6.6

Q ss_pred             ccCCcccccc
Q psy14694          2 LKCTHCKVDL   11 (102)
Q Consensus         2 ~~c~~c~~~f   11 (102)
                      |.|.+|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            5677777555


No 220
>PRK12496 hypothetical protein; Provisional
Probab=41.35  E-value=24  Score=19.91  Aligned_cols=12  Identities=25%  Similarity=0.395  Sum_probs=9.2

Q ss_pred             eeCCCCCCCCCC
Q psy14694         37 YDCFMCPYRTPY   48 (102)
Q Consensus        37 ~~c~~c~~~~~~   48 (102)
                      +.|.-|++.|..
T Consensus       128 ~~C~gC~~~~~~  139 (164)
T PRK12496        128 KVCKGCKKKYPE  139 (164)
T ss_pred             EECCCCCccccC
Confidence            678888888865


No 221
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=40.79  E-value=12  Score=15.16  Aligned_cols=7  Identities=14%  Similarity=-0.088  Sum_probs=3.2

Q ss_pred             ccccccc
Q psy14694         93 LRFKKIR   99 (102)
Q Consensus        93 ~~C~~c~   99 (102)
                      +.|+.||
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            3444444


No 222
>KOG2923|consensus
Probab=40.78  E-value=34  Score=16.11  Aligned_cols=25  Identities=20%  Similarity=0.376  Sum_probs=13.7

Q ss_pred             CCCCCCCcchHHHHhhhhcCCCCccCCCCC
Q psy14694         42 CPYRTPYSGTMRRHIRAHIGDRPYKCFVCP   71 (102)
Q Consensus        42 c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~   71 (102)
                      ||-.|.....     -.-.|+....|+.|.
T Consensus        27 CGDrf~It~e-----dL~~ge~Va~CpsCS   51 (67)
T KOG2923|consen   27 CGDRFQITLE-----DLENGEDVARCPSCS   51 (67)
T ss_pred             CCCeeeecHH-----HHhCCCeeecCCCce
Confidence            6666554322     233566666777665


No 223
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=40.75  E-value=11  Score=14.92  Aligned_cols=9  Identities=0%  Similarity=-0.197  Sum_probs=5.9

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      -|+|..||.
T Consensus         4 ~ykC~~CGn   12 (34)
T cd00974           4 VYKCEICGN   12 (34)
T ss_pred             EEEcCCCCc
Confidence            467777764


No 224
>KOG2231|consensus
Probab=40.60  E-value=49  Score=23.37  Aligned_cols=19  Identities=32%  Similarity=0.607  Sum_probs=9.1

Q ss_pred             CCCCCCCCCCcchHHHHhh
Q psy14694         39 CFMCPYRTPYSGTMRRHIR   57 (102)
Q Consensus        39 c~~c~~~~~~~~~l~~h~~   57 (102)
                      |..|...|.....|..|++
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            4444444444444444444


No 225
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=40.26  E-value=8.1  Score=15.70  Aligned_cols=14  Identities=21%  Similarity=0.135  Sum_probs=7.1

Q ss_pred             ccCCCCCCccCCch
Q psy14694         65 YKCFVCPYRSNQRA   78 (102)
Q Consensus        65 ~~c~~c~~~f~~~~   78 (102)
                      -.|.+|++.|..+.
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            36888888888754


No 226
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=39.24  E-value=11  Score=14.43  Aligned_cols=10  Identities=10%  Similarity=-0.067  Sum_probs=3.4

Q ss_pred             Cccccccccc
Q psy14694         91 EQLRFKKIRI  100 (102)
Q Consensus        91 ~~~~C~~c~~  100 (102)
                      ..|.|..|+.
T Consensus        14 ~~Y~C~~Cdf   23 (30)
T PF07649_consen   14 WFYRCSECDF   23 (30)
T ss_dssp             -EEE-TTT--
T ss_pred             ceEECccCCC
Confidence            3455555554


No 227
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=39.07  E-value=12  Score=14.78  Aligned_cols=9  Identities=0%  Similarity=-0.182  Sum_probs=6.0

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      -|+|..||.
T Consensus         7 ~ykC~~Cgn   15 (34)
T TIGR00319         7 VYKCEVCGN   15 (34)
T ss_pred             EEEcCCCCc
Confidence            577777764


No 228
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=38.64  E-value=14  Score=22.17  Aligned_cols=15  Identities=7%  Similarity=-0.166  Sum_probs=10.7

Q ss_pred             CCCCccccccccccC
Q psy14694         88 ISDEQLRFKKIRIAV  102 (102)
Q Consensus        88 ~~~~~~~C~~c~~~~  102 (102)
                      ...++.+|+.||.-|
T Consensus       177 rEGkpqRCpECGqVF  191 (268)
T PTZ00043        177 REGFLYRCGECDQIF  191 (268)
T ss_pred             cCCCCccCCCCCcEE
Confidence            345589999998644


No 229
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=37.92  E-value=20  Score=16.06  Aligned_cols=17  Identities=24%  Similarity=0.395  Sum_probs=10.6

Q ss_pred             CCCCccCCCCCCccCCc
Q psy14694         61 GDRPYKCFVCPYRSNQR   77 (102)
Q Consensus        61 ~~~~~~c~~c~~~f~~~   77 (102)
                      +.....|+.|+..|-..
T Consensus        37 ~~~~v~C~~C~~~fC~~   53 (64)
T smart00647       37 GCNRVTCPKCGFSFCFR   53 (64)
T ss_pred             CCCeeECCCCCCeECCC
Confidence            34456777777777543


No 230
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=37.61  E-value=9.4  Score=20.89  Aligned_cols=18  Identities=6%  Similarity=-0.055  Sum_probs=12.4

Q ss_pred             hhhcCCCCccccccccccC
Q psy14694         84 PLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        84 ~~~~~~~~~~~C~~c~~~~  102 (102)
                      +.++.| ++.+|+.||.-|
T Consensus       105 ~~l~~g-~~~RCpeCG~~f  122 (136)
T PF01215_consen  105 FWLHKG-KPQRCPECGQVF  122 (136)
T ss_dssp             EEEETT-SEEEETTTEEEE
T ss_pred             EEEeCC-CccCCCCCCeEE
Confidence            344555 489999998644


No 231
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=37.53  E-value=23  Score=24.77  Aligned_cols=9  Identities=11%  Similarity=-0.285  Sum_probs=7.5

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      -+.||.||.
T Consensus       639 ~~~CP~CG~  647 (656)
T PRK08270        639 HEFCPKCGE  647 (656)
T ss_pred             CCCCcCCcC
Confidence            588999985


No 232
>KOG2636|consensus
Probab=37.48  E-value=24  Score=23.47  Aligned_cols=27  Identities=30%  Similarity=0.520  Sum_probs=21.6

Q ss_pred             hhhcCCCCccCCCCC-CccCCchhhhhh
Q psy14694         57 RAHIGDRPYKCFVCP-YRSNQRANLMSH   83 (102)
Q Consensus        57 ~~h~~~~~~~c~~c~-~~f~~~~~l~~h   83 (102)
                      +.|--...|.|.+|| +++.-+..+.+|
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHH
Confidence            456667789999999 788888888877


No 233
>PHA02942 putative transposase; Provisional
Probab=37.43  E-value=22  Score=23.01  Aligned_cols=11  Identities=0%  Similarity=-0.070  Sum_probs=7.2

Q ss_pred             CCccccccccc
Q psy14694         90 DEQLRFKKIRI  100 (102)
Q Consensus        90 ~~~~~C~~c~~  100 (102)
                      .+.|.|+.||.
T Consensus       340 ~r~f~C~~CG~  350 (383)
T PHA02942        340 HRYFHCPSCGY  350 (383)
T ss_pred             CCEEECCCCCC
Confidence            34677777774


No 234
>PRK10220 hypothetical protein; Provisional
Probab=36.90  E-value=44  Score=17.63  Aligned_cols=18  Identities=17%  Similarity=0.207  Sum_probs=12.5

Q ss_pred             CCCceeCCCCCCCCCCcc
Q psy14694         33 SRKKYDCFMCPYRTPYSG   50 (102)
Q Consensus        33 ~~~~~~c~~c~~~~~~~~   50 (102)
                      ....+.|++|+.-|....
T Consensus        17 d~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220         17 DNGMYICPECAHEWNDAE   34 (111)
T ss_pred             CCCeEECCcccCcCCccc
Confidence            344588888888776654


No 235
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=36.84  E-value=23  Score=21.69  Aligned_cols=28  Identities=18%  Similarity=0.166  Sum_probs=14.3

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      -.|+.||....-...|       ++-.-|+|+.|+
T Consensus       221 r~CP~Cg~~W~L~~pl-------h~iFdFKCD~CR  248 (258)
T PF10071_consen  221 RKCPSCGGDWRLKEPL-------HDIFDFKCDPCR  248 (258)
T ss_pred             CCCCCCCCccccCCch-------hhceeccCCcce
Confidence            3566666544433322       334456666664


No 236
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=36.39  E-value=18  Score=20.12  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=7.5

Q ss_pred             CCccCCCCCCcc
Q psy14694         63 RPYKCFVCPYRS   74 (102)
Q Consensus        63 ~~~~c~~c~~~f   74 (102)
                      ..|.|..|+...
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            446777776654


No 237
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=36.34  E-value=9.1  Score=14.94  Aligned_cols=9  Identities=11%  Similarity=0.172  Sum_probs=3.4

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      .|.|+.|+.
T Consensus        13 kY~Cp~C~~   21 (30)
T PF04438_consen   13 KYRCPRCGA   21 (30)
T ss_dssp             SEE-TTT--
T ss_pred             EEECCCcCC
Confidence            455665553


No 238
>PF14149 YhfH:  YhfH-like protein
Probab=36.14  E-value=5.6  Score=16.50  Aligned_cols=7  Identities=0%  Similarity=-0.045  Sum_probs=3.6

Q ss_pred             ccccccc
Q psy14694         94 RFKKIRI  100 (102)
Q Consensus        94 ~C~~c~~  100 (102)
                      .|..||+
T Consensus        15 ~C~~CG~   21 (37)
T PF14149_consen   15 KCTECGK   21 (37)
T ss_pred             ccHHHHH
Confidence            3555554


No 239
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.91  E-value=39  Score=18.33  Aligned_cols=16  Identities=25%  Similarity=0.407  Sum_probs=10.5

Q ss_pred             CCCccCCCCCCccCCc
Q psy14694         62 DRPYKCFVCPYRSNQR   77 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~   77 (102)
                      +.|--|..||..|.+.
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            3455677777777764


No 240
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=35.49  E-value=33  Score=21.31  Aligned_cols=25  Identities=24%  Similarity=0.223  Sum_probs=17.1

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .|.|+.|.-.|..              .|-+|+.||-.|
T Consensus       255 GyvCs~Clsi~C~--------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQ--------------YTPICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCC--------------CCCCCCCCCCCC
Confidence            4888888765553              234799998766


No 241
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=35.33  E-value=15  Score=16.76  Aligned_cols=9  Identities=0%  Similarity=-0.208  Sum_probs=2.9

Q ss_pred             Ccccccccc
Q psy14694         91 EQLRFKKIR   99 (102)
Q Consensus        91 ~~~~C~~c~   99 (102)
                      +.|.|+.||
T Consensus        32 r~y~Cp~Cg   40 (55)
T PF05741_consen   32 RKYVCPICG   40 (55)
T ss_dssp             GG---TTT-
T ss_pred             hcCcCCCCc
Confidence            446666665


No 242
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=35.24  E-value=13  Score=17.72  Aligned_cols=14  Identities=36%  Similarity=0.665  Sum_probs=7.2

Q ss_pred             cCCCCccCCCCCCcc
Q psy14694         60 IGDRPYKCFVCPYRS   74 (102)
Q Consensus        60 ~~~~~~~c~~c~~~f   74 (102)
                      .+.+.-+| .||+..
T Consensus        16 e~~kTkkC-~CG~~l   29 (68)
T PF09082_consen   16 EGAKTKKC-VCGKTL   29 (68)
T ss_dssp             TT-SEEEE-TTTEEE
T ss_pred             CCcceeEe-cCCCee
Confidence            33455566 666554


No 243
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=34.84  E-value=36  Score=17.93  Aligned_cols=17  Identities=18%  Similarity=0.266  Sum_probs=11.8

Q ss_pred             CCceeCCCCCCCCCCcc
Q psy14694         34 RKKYDCFMCPYRTPYSG   50 (102)
Q Consensus        34 ~~~~~c~~c~~~~~~~~   50 (102)
                      ...+.|++|+..|....
T Consensus        17 g~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686        17 GTQLICPSCLYEWNENE   33 (109)
T ss_pred             CCeeECccccccccccc
Confidence            34588888888776553


No 244
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=34.69  E-value=17  Score=19.22  Aligned_cols=12  Identities=8%  Similarity=-0.053  Sum_probs=7.2

Q ss_pred             CCCccccccccc
Q psy14694         89 SDEQLRFKKIRI  100 (102)
Q Consensus        89 ~~~~~~C~~c~~  100 (102)
                      ...+.+||.|++
T Consensus        66 kav~V~CP~C~K   77 (114)
T PF11023_consen   66 KAVQVECPNCGK   77 (114)
T ss_pred             cceeeECCCCCC
Confidence            334566777765


No 245
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=34.55  E-value=16  Score=17.71  Aligned_cols=37  Identities=8%  Similarity=-0.130  Sum_probs=14.7

Q ss_pred             CCccCCCCCCccCCchhhhhhhh---hcCCCCcccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPL---VQISDEQLRFKKIR   99 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~---~~~~~~~~~C~~c~   99 (102)
                      +..-|..|+-.+....+....++   ...+.-.+.|..||
T Consensus        45 kr~~Ck~C~~~liPG~~~~vri~~~~~~~~~l~~~C~~C~   84 (85)
T PF04032_consen   45 KRTICKKCGSLLIPGVNCSVRIRKKKKKKNFLVYTCLNCG   84 (85)
T ss_dssp             CCTB-TTT--B--CTTTEEEEEE---SSS-EEEEEETTTT
T ss_pred             hcccccCCCCEEeCCCccEEEEEecCCCCCEEEEEccccC
Confidence            33456666665555444322222   12333346777776


No 246
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=34.40  E-value=13  Score=18.81  Aligned_cols=10  Identities=10%  Similarity=-0.031  Sum_probs=5.6

Q ss_pred             cccccccccc
Q psy14694         92 QLRFKKIRIA  101 (102)
Q Consensus        92 ~~~C~~c~~~  101 (102)
                      .|.|..|++.
T Consensus        53 IW~C~~C~~~   62 (91)
T TIGR00280        53 IWTCRKCGAK   62 (91)
T ss_pred             EEEcCCCCCE
Confidence            4566666554


No 247
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.05  E-value=20  Score=18.88  Aligned_cols=11  Identities=0%  Similarity=-0.257  Sum_probs=6.2

Q ss_pred             ccccccccccC
Q psy14694         92 QLRFKKIRIAV  102 (102)
Q Consensus        92 ~~~C~~c~~~~  102 (102)
                      |-.||+||++|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            55566666554


No 248
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.64  E-value=16  Score=17.03  Aligned_cols=8  Identities=0%  Similarity=-0.230  Sum_probs=4.1

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      -.|+.|+.
T Consensus        49 v~CPYC~t   56 (62)
T COG4391          49 VVCPYCST   56 (62)
T ss_pred             EecCcccc
Confidence            44555554


No 249
>PRK11032 hypothetical protein; Provisional
Probab=33.64  E-value=24  Score=19.97  Aligned_cols=7  Identities=29%  Similarity=0.695  Sum_probs=3.9

Q ss_pred             ccCCCCC
Q psy14694         65 YKCFVCP   71 (102)
Q Consensus        65 ~~c~~c~   71 (102)
                      +.|..||
T Consensus       125 LvC~~Cg  131 (160)
T PRK11032        125 LVCEKCH  131 (160)
T ss_pred             EEecCCC
Confidence            4555555


No 250
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=33.59  E-value=41  Score=22.59  Aligned_cols=24  Identities=25%  Similarity=0.488  Sum_probs=20.2

Q ss_pred             ccCCccccccccCHHHHHHHHhhhc
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCS   26 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~   26 (102)
                      +.|+.|.+.|. +...+..|+...+
T Consensus        58 WiCp~CskkF~-d~~~~~~H~~~eH   81 (466)
T PF04780_consen   58 WICPRCSKKFS-DAESCLSHMEQEH   81 (466)
T ss_pred             eeCCcccceeC-CHHHHHHHHHHhh
Confidence            46889999999 9999999987654


No 251
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=33.46  E-value=25  Score=21.99  Aligned_cols=13  Identities=31%  Similarity=0.503  Sum_probs=7.5

Q ss_pred             CceeCCCCCCCCC
Q psy14694         35 KKYDCFMCPYRTP   47 (102)
Q Consensus        35 ~~~~c~~c~~~~~   47 (102)
                      ..+.|+.|+..|.
T Consensus        56 ~~~vcp~c~~h~r   68 (296)
T CHL00174         56 KMNICEQCGYHLK   68 (296)
T ss_pred             cCCCCCCCCCCcC
Confidence            3456666666554


No 252
>KOG2461|consensus
Probab=33.41  E-value=70  Score=21.07  Aligned_cols=57  Identities=4%  Similarity=-0.172  Sum_probs=26.9

Q ss_pred             CCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         44 YRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        44 ~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      ........+..+...+.++.+..+..+.........+...+.+++....+.+..|++
T Consensus       339 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  395 (396)
T KOG2461|consen  339 RTPAGQLIYTQSHSMEVAEPTDMAPNQIWKIYHTGVLGFLIITTDESECNNMSFVCK  395 (396)
T ss_pred             cccccccchhhhhhcccCCCCcccccccccceeccccceeeeeccccccccccccCC
Confidence            333344444455555555544444333333333333444555566666665555543


No 253
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=33.29  E-value=25  Score=19.84  Aligned_cols=12  Identities=17%  Similarity=0.548  Sum_probs=7.0

Q ss_pred             ccCCCCCCccCC
Q psy14694         65 YKCFVCPYRSNQ   76 (102)
Q Consensus        65 ~~c~~c~~~f~~   76 (102)
                      ..|..|++.+..
T Consensus       106 ~~C~~C~~~~~~  117 (178)
T PF02146_consen  106 LRCSKCGKEYDR  117 (178)
T ss_dssp             EEETTTSBEEEG
T ss_pred             eeecCCCccccc
Confidence            456666665543


No 254
>KOG3507|consensus
Probab=33.15  E-value=24  Score=16.30  Aligned_cols=13  Identities=31%  Similarity=0.613  Sum_probs=8.5

Q ss_pred             CCccCCCCCCccC
Q psy14694         63 RPYKCFVCPYRSN   75 (102)
Q Consensus        63 ~~~~c~~c~~~f~   75 (102)
                      .+..|.+||....
T Consensus        36 D~irCReCG~RIl   48 (62)
T KOG3507|consen   36 DVIRCRECGYRIL   48 (62)
T ss_pred             CcEehhhcchHHH
Confidence            4577888876544


No 255
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=32.55  E-value=15  Score=18.60  Aligned_cols=10  Identities=10%  Similarity=-0.011  Sum_probs=5.7

Q ss_pred             cccccccccc
Q psy14694         92 QLRFKKIRIA  101 (102)
Q Consensus        92 ~~~C~~c~~~  101 (102)
                      .|.|..|++.
T Consensus        54 IW~C~~C~~~   63 (90)
T PRK03976         54 IWECRKCGAK   63 (90)
T ss_pred             EEEcCCCCCE
Confidence            4566666554


No 256
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=32.51  E-value=3.4  Score=16.87  Aligned_cols=7  Identities=29%  Similarity=0.667  Sum_probs=2.5

Q ss_pred             cCCCCCC
Q psy14694         66 KCFVCPY   72 (102)
Q Consensus        66 ~c~~c~~   72 (102)
                      .|..||-
T Consensus        23 sC~~CGP   29 (35)
T PF07503_consen   23 SCTNCGP   29 (35)
T ss_dssp             -BTTCC-
T ss_pred             cCCCCCC
Confidence            4444543


No 257
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=32.04  E-value=31  Score=23.59  Aligned_cols=8  Identities=0%  Similarity=-0.247  Sum_probs=5.1

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      |.|+.||.
T Consensus       230 y~C~~Cg~  237 (557)
T PF05876_consen  230 YVCPHCGC  237 (557)
T ss_pred             EECCCCcC
Confidence            66666664


No 258
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=31.81  E-value=31  Score=14.73  Aligned_cols=38  Identities=13%  Similarity=0.086  Sum_probs=18.1

Q ss_pred             CCCccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         62 DRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      +....|..|+..|-..=.-......-.....|.|+.|.
T Consensus        12 ~~~i~C~~C~~~~H~~C~~~~~~~~~~~~~~w~C~~C~   49 (51)
T PF00628_consen   12 GDMIQCDSCNRWYHQECVGPPEKAEEIPSGDWYCPNCR   49 (51)
T ss_dssp             SSEEEBSTTSCEEETTTSTSSHSHHSHHSSSBSSHHHH
T ss_pred             CCeEEcCCCChhhCcccCCCChhhccCCCCcEECcCCc
Confidence            44577888887654321111111111111278887774


No 259
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=31.53  E-value=20  Score=15.51  Aligned_cols=6  Identities=17%  Similarity=0.135  Sum_probs=3.3

Q ss_pred             cccccc
Q psy14694         94 RFKKIR   99 (102)
Q Consensus        94 ~C~~c~   99 (102)
                      +||.||
T Consensus        13 kCp~CG   18 (44)
T PF14952_consen   13 KCPKCG   18 (44)
T ss_pred             cCCcCc
Confidence            455555


No 260
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=31.53  E-value=37  Score=23.26  Aligned_cols=9  Identities=11%  Similarity=0.062  Sum_probs=7.2

Q ss_pred             ccccccccc
Q psy14694         92 QLRFKKIRI  100 (102)
Q Consensus        92 ~~~C~~c~~  100 (102)
                      .++||.||.
T Consensus       532 ~~~CP~CGs  540 (555)
T cd01675         532 GFKCPKCGS  540 (555)
T ss_pred             CCCCcCCCC
Confidence            488999984


No 261
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=31.52  E-value=39  Score=21.14  Aligned_cols=26  Identities=19%  Similarity=0.341  Sum_probs=20.1

Q ss_pred             CCCccCCCCCCccCCchhhhhhhhhc
Q psy14694         62 DRPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      ...|.|..|-+-|.....+.+|+...
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C   71 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKC   71 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhC
Confidence            45688888888888888888887643


No 262
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=31.29  E-value=17  Score=18.40  Aligned_cols=10  Identities=30%  Similarity=0.298  Sum_probs=7.3

Q ss_pred             cccccccccc
Q psy14694         92 QLRFKKIRIA  101 (102)
Q Consensus        92 ~~~C~~c~~~  101 (102)
                      -|+|.+||++
T Consensus        68 r~~Ct~Cgka   77 (94)
T COG1631          68 RLRCTECGKA   77 (94)
T ss_pred             EEEehhhccc
Confidence            3778888875


No 263
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=30.87  E-value=6.9  Score=24.04  Aligned_cols=12  Identities=0%  Similarity=-0.324  Sum_probs=7.1

Q ss_pred             CCCCcccccccc
Q psy14694         88 ISDEQLRFKKIR   99 (102)
Q Consensus        88 ~~~~~~~C~~c~   99 (102)
                      .+.+.+.|..|+
T Consensus       234 ~~~rve~C~~C~  245 (290)
T PF04216_consen  234 PAYRVEVCESCG  245 (290)
T ss_dssp             -SEEEEEETTTT
T ss_pred             CcEEEEECCccc
Confidence            345556677776


No 264
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=30.71  E-value=29  Score=21.56  Aligned_cols=11  Identities=18%  Similarity=0.256  Sum_probs=5.8

Q ss_pred             eeCCCCCCCCC
Q psy14694         37 YDCFMCPYRTP   47 (102)
Q Consensus        37 ~~c~~c~~~~~   47 (102)
                      +.|+.|+..+.
T Consensus        46 ~vc~~c~~h~r   56 (285)
T TIGR00515        46 EVCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCCcCc
Confidence            45555555543


No 265
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=30.34  E-value=12  Score=19.48  Aligned_cols=24  Identities=21%  Similarity=0.223  Sum_probs=17.3

Q ss_pred             CCccCCCCCCccCCchhhhhhhhh
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      ..+-|-+|.+-|.....|..|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            346777888888888777777653


No 266
>KOG0696|consensus
Probab=30.13  E-value=23  Score=23.70  Aligned_cols=36  Identities=6%  Similarity=0.003  Sum_probs=17.7

Q ss_pred             CccCCCCCCccCCchhhhhh-hhhcCCCCcccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSH-PLVQISDEQLRFKKIR   99 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h-~~~~~~~~~~~C~~c~   99 (102)
                      .|.|+--++.+........| .++|+=.-|-=|+.||
T Consensus        92 tF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCG  128 (683)
T KOG0696|consen   92 TFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCG  128 (683)
T ss_pred             EEECCCCCCCCCCCCcccccceeeeecCCCchhhhHH
Confidence            34555444545444444455 3335444444466665


No 267
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=30.12  E-value=37  Score=23.39  Aligned_cols=8  Identities=13%  Similarity=-0.139  Sum_probs=6.3

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      ++||.||.
T Consensus       539 ~~CP~Cgs  546 (579)
T TIGR02487       539 DKCPKCGS  546 (579)
T ss_pred             CcCcCCCC
Confidence            78888883


No 268
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=29.65  E-value=19  Score=20.91  Aligned_cols=13  Identities=46%  Similarity=0.802  Sum_probs=8.7

Q ss_pred             CccCCCCCCccCC
Q psy14694         64 PYKCFVCPYRSNQ   76 (102)
Q Consensus        64 ~~~c~~c~~~f~~   76 (102)
                      .+.|..||...+.
T Consensus        30 sf~C~~CGyr~~e   42 (192)
T TIGR00310        30 STICEHCGYRSND   42 (192)
T ss_pred             EEECCCCCCccce
Confidence            4778888865543


No 269
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=29.48  E-value=68  Score=18.79  Aligned_cols=12  Identities=17%  Similarity=0.094  Sum_probs=6.9

Q ss_pred             CccCCCCCCccC
Q psy14694         64 PYKCFVCPYRSN   75 (102)
Q Consensus        64 ~~~c~~c~~~f~   75 (102)
                      ...|..|+..+.
T Consensus        95 ~~~C~~C~~~~~  106 (206)
T cd01410          95 IEVCKSCGPEYV  106 (206)
T ss_pred             cccCCCCCCccc
Confidence            355666665544


No 270
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=29.16  E-value=12  Score=16.19  Aligned_cols=11  Identities=18%  Similarity=0.322  Sum_probs=5.4

Q ss_pred             ccCCC--CCCccC
Q psy14694         65 YKCFV--CPYRSN   75 (102)
Q Consensus        65 ~~c~~--c~~~f~   75 (102)
                      ++|..  ||.+|.
T Consensus        26 ~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   26 CQCTNPECGHTFV   38 (47)
T ss_pred             EEECCCcCCCEEE
Confidence            44533  555554


No 271
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=29.15  E-value=18  Score=21.41  Aligned_cols=30  Identities=10%  Similarity=0.129  Sum_probs=0.0

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCcc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQL   93 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   93 (102)
                      ....|+.||....- +.+..|+|+...+..|
T Consensus       167 ~~~~cPitGe~IP~-~e~~eHmRi~LlDP~w  196 (229)
T PF12230_consen  167 KMIICPITGEMIPA-DEMDEHMRIELLDPRW  196 (229)
T ss_dssp             -------------------------------
T ss_pred             cccccccccccccc-cccccccccccccccc
Confidence            33567777765553 3466677766655544


No 272
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=29.01  E-value=38  Score=23.60  Aligned_cols=7  Identities=0%  Similarity=-0.282  Sum_probs=6.1

Q ss_pred             ccccccc
Q psy14694         93 LRFKKIR   99 (102)
Q Consensus        93 ~~C~~c~   99 (102)
                      +.||.||
T Consensus       573 ~~CP~CG  579 (618)
T PRK14704        573 NECPSCG  579 (618)
T ss_pred             ccCcCCC
Confidence            8899998


No 273
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=28.62  E-value=57  Score=19.32  Aligned_cols=15  Identities=13%  Similarity=0.368  Sum_probs=9.0

Q ss_pred             CCccCCCCCCccCCc
Q psy14694         63 RPYKCFVCPYRSNQR   77 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~   77 (102)
                      ....|..|+..+...
T Consensus       112 ~~~~C~~C~~~~~~~  126 (222)
T cd01413         112 QTAYCVNCGSKYDLE  126 (222)
T ss_pred             CcceECCCCCCcchh
Confidence            345677777666543


No 274
>KOG4602|consensus
Probab=28.54  E-value=30  Score=21.26  Aligned_cols=38  Identities=21%  Similarity=0.268  Sum_probs=19.6

Q ss_pred             CCccCCCCCCccCCchhhhhhhhh-------cCCCCccccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLV-------QISDEQLRFKKIRI  100 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~-------~~~~~~~~C~~c~~  100 (102)
                      ++..|..|...-.....+..|...       .-.-+.|.|+.||-
T Consensus       232 r~l~CvFC~nN~E~~A~y~tH~lkd~dgRVLCPkLR~YVCPiCGA  276 (318)
T KOG4602|consen  232 RPLCCVFCFNNAEEFARYHTHPLKDKDGRVLCPKLRSYVCPICGA  276 (318)
T ss_pred             CceeEEeecCCCchhhheecccccCCCCcEechhHhhhcCccccc
Confidence            345666665443333334444221       33445588888874


No 275
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=28.51  E-value=21  Score=17.65  Aligned_cols=8  Identities=0%  Similarity=-0.230  Sum_probs=3.3

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      |.|+.|++
T Consensus        66 ~~Cp~Cg~   73 (81)
T PF10609_consen   66 FVCPHCGE   73 (81)
T ss_dssp             EE-TTT--
T ss_pred             cCCCCCCC
Confidence            66666664


No 276
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=28.40  E-value=30  Score=19.95  Aligned_cols=11  Identities=18%  Similarity=0.419  Sum_probs=6.9

Q ss_pred             ccCCCCCCccC
Q psy14694         65 YKCFVCPYRSN   75 (102)
Q Consensus        65 ~~c~~c~~~f~   75 (102)
                      +.|.-|.+.|.
T Consensus       140 ~rC~GC~~~f~  150 (177)
T COG1439         140 LRCHGCKRIFP  150 (177)
T ss_pred             EEEecCceecC
Confidence            45666666665


No 277
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=28.16  E-value=24  Score=15.94  Aligned_cols=8  Identities=25%  Similarity=0.077  Sum_probs=5.3

Q ss_pred             cccccccc
Q psy14694         92 QLRFKKIR   99 (102)
Q Consensus        92 ~~~C~~c~   99 (102)
                      .|.|+.||
T Consensus        44 ~y~C~~Cg   51 (54)
T PF10058_consen   44 QYRCPYCG   51 (54)
T ss_pred             EEEcCCCC
Confidence            46677666


No 278
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=28.15  E-value=55  Score=19.59  Aligned_cols=15  Identities=13%  Similarity=0.255  Sum_probs=9.8

Q ss_pred             CCccCCCCCCccCCc
Q psy14694         63 RPYKCFVCPYRSNQR   77 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~   77 (102)
                      ....|..|++.+...
T Consensus       121 ~~~~C~~C~~~~~~~  135 (242)
T PRK00481        121 LRARCTKCGQTYDLD  135 (242)
T ss_pred             CceeeCCCCCCcChh
Confidence            446788887766544


No 279
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=27.98  E-value=27  Score=22.24  Aligned_cols=13  Identities=15%  Similarity=0.054  Sum_probs=10.4

Q ss_pred             CCCCccccccccc
Q psy14694         88 ISDEQLRFKKIRI  100 (102)
Q Consensus        88 ~~~~~~~C~~c~~  100 (102)
                      .|.-.|.||+|++
T Consensus       280 ~g~d~W~CpkC~~  292 (415)
T COG5533         280 EGKDAWRCPKCGR  292 (415)
T ss_pred             cCcccccCchhcc
Confidence            4566799999986


No 280
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=27.73  E-value=47  Score=13.68  Aligned_cols=11  Identities=36%  Similarity=0.664  Sum_probs=4.4

Q ss_pred             ccCCccccccc
Q psy14694          2 LKCTHCKVDLN   12 (102)
Q Consensus         2 ~~c~~c~~~f~   12 (102)
                      |-|+.|...+.
T Consensus         4 yyCdyC~~~~~   14 (38)
T PF06220_consen    4 YYCDYCKKYLT   14 (38)
T ss_dssp             -B-TTT--B-S
T ss_pred             eecccccceec
Confidence            56888888873


No 281
>KOG2071|consensus
Probab=27.62  E-value=41  Score=23.21  Aligned_cols=26  Identities=23%  Similarity=0.455  Sum_probs=20.5

Q ss_pred             CCCccCCCCCCccCCchhhhhhhhhc
Q psy14694         62 DRPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      .+|.+|..||..|........|+..|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            56789999999998877776666655


No 282
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.37  E-value=22  Score=15.72  Aligned_cols=7  Identities=0%  Similarity=-0.225  Sum_probs=3.3

Q ss_pred             ccccccc
Q psy14694         95 FKKIRIA  101 (102)
Q Consensus        95 C~~c~~~  101 (102)
                      |++|++-
T Consensus        15 CpvCqRP   21 (54)
T COG4338          15 CPVCQRP   21 (54)
T ss_pred             hhhhcCc
Confidence            4555443


No 283
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=27.19  E-value=26  Score=15.54  Aligned_cols=6  Identities=17%  Similarity=0.135  Sum_probs=3.3

Q ss_pred             cccccc
Q psy14694         94 RFKKIR   99 (102)
Q Consensus        94 ~C~~c~   99 (102)
                      .||+||
T Consensus        15 ~Cp~CG   20 (49)
T PF12677_consen   15 KCPKCG   20 (49)
T ss_pred             cCcccC
Confidence            356555


No 284
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=26.96  E-value=20  Score=16.75  Aligned_cols=16  Identities=13%  Similarity=0.088  Sum_probs=9.2

Q ss_pred             cCCCCccccccccccC
Q psy14694         87 QISDEQLRFKKIRIAV  102 (102)
Q Consensus        87 ~~~~~~~~C~~c~~~~  102 (102)
                      +..+-...|+.||..|
T Consensus        48 ~i~eg~L~Cp~c~r~Y   63 (68)
T PF03966_consen   48 EIVEGELICPECGREY   63 (68)
T ss_dssp             ETTTTEEEETTTTEEE
T ss_pred             cccCCEEEcCCCCCEE
Confidence            4445556677776643


No 285
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=26.80  E-value=35  Score=21.34  Aligned_cols=11  Identities=18%  Similarity=0.268  Sum_probs=6.3

Q ss_pred             eeCCCCCCCCC
Q psy14694         37 YDCFMCPYRTP   47 (102)
Q Consensus        37 ~~c~~c~~~~~   47 (102)
                      +.|+.|+..+.
T Consensus        47 ~vc~~c~~h~r   57 (292)
T PRK05654         47 NVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCee
Confidence            45666666554


No 286
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=26.76  E-value=14  Score=20.46  Aligned_cols=35  Identities=9%  Similarity=0.051  Sum_probs=17.4

Q ss_pred             ccCCCCCCccCCchhhhhhhhhcCCCCccccccccccC
Q psy14694         65 YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      ..|+.||.......+   ..-.-.-.-.|.|..|..-|
T Consensus       106 ~~cp~c~s~~t~~~s---~fg~t~cka~~~c~~c~epf  140 (146)
T TIGR02159       106 VQCPRCGSADTTITS---IFGPTACKALYRCRACKEPF  140 (146)
T ss_pred             CcCCCCCCCCcEeec---CCCChhhHHHhhhhhhCCcH
Confidence            577778754443211   11111223357777776644


No 287
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=26.34  E-value=1.1e+02  Score=15.92  Aligned_cols=36  Identities=14%  Similarity=0.162  Sum_probs=24.6

Q ss_pred             ccCCccccccccCHHHHHHHHhhhccccccCCCCceeCCCCCCC
Q psy14694          2 LKCTHCKVDLNLDTEIILQHYKLCSEGARQSSRKKYDCFMCPYR   45 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~   45 (102)
                      |.|+.=|..|. +...+..-+...       ..+-|.|...|+.
T Consensus         4 f~i~~T~EiF~-dYe~Y~~R~~~y-------~~~vwtC~~TGk~   39 (102)
T PF10537_consen    4 FYIPFTGEIFR-DYEEYLKRMILY-------NQRVWTCEITGKS   39 (102)
T ss_pred             EEeCCCCcccC-CHHHHHHHHHHH-------hCCeeEEecCCCC
Confidence            45667788888 766665544444       5678899887763


No 288
>PF00935 Ribosomal_L44:  Ribosomal protein L44;  InterPro: IPR000552 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of mammalian [], Trypanosoma brucei, Caenorhabditis elegans and fungal L44, and Haloarcula marismortui LA [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZS_r 1S1I_Z 3O5H_f 3O58_f 3IZR_r 1M1K_4 3CCQ_3 3CCL_3 3CME_3 1K73_4 ....
Probab=26.20  E-value=24  Score=17.34  Aligned_cols=10  Identities=20%  Similarity=0.155  Sum_probs=5.9

Q ss_pred             cccccccccc
Q psy14694         92 QLRFKKIRIA  101 (102)
Q Consensus        92 ~~~C~~c~~~  101 (102)
                      -|+|.+|+++
T Consensus        53 rl~C~~C~~~   62 (77)
T PF00935_consen   53 RLECTECGKA   62 (77)
T ss_dssp             EEEETTTS-E
T ss_pred             EEEeCCCCcc
Confidence            3677777654


No 289
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=25.50  E-value=48  Score=23.70  Aligned_cols=7  Identities=14%  Similarity=-0.073  Sum_probs=6.0

Q ss_pred             ccccccc
Q psy14694         93 LRFKKIR   99 (102)
Q Consensus        93 ~~C~~c~   99 (102)
                      +.||.||
T Consensus       694 ~~CP~CG  700 (735)
T PRK07111        694 DKCPKCG  700 (735)
T ss_pred             ccCcCCC
Confidence            7888888


No 290
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=25.44  E-value=30  Score=21.37  Aligned_cols=11  Identities=36%  Similarity=1.002  Sum_probs=4.8

Q ss_pred             CCccCCCCCCc
Q psy14694         63 RPYKCFVCPYR   73 (102)
Q Consensus        63 ~~~~c~~c~~~   73 (102)
                      +++.|++|+..
T Consensus       208 k~~PCPKCg~e  218 (314)
T PF06524_consen  208 KPIPCPKCGYE  218 (314)
T ss_pred             CCCCCCCCCCc
Confidence            34444444443


No 291
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=25.25  E-value=12  Score=26.40  Aligned_cols=55  Identities=13%  Similarity=0.150  Sum_probs=27.6

Q ss_pred             eCCCCCCCCCCcchHHHHhhhhcCCCC-ccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         38 DCFMCPYRTPYSGTMRRHIRAHIGDRP-YKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        38 ~c~~c~~~~~~~~~l~~h~~~h~~~~~-~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      .|..||=.|+....|.. .+..+.-.. -.|..|.+.+..+.+..-|      -.+-.|+.||
T Consensus        92 nCt~CGPr~~i~~~lpy-dr~~t~m~~f~~C~~C~~ey~~p~~rr~h------~~~~~C~~Cg  147 (711)
T TIGR00143        92 SCTHCGPRFTIIEALPY-DRENTSMADFPLCPDCAKEYKDPLDRRFH------AQPIACPRCG  147 (711)
T ss_pred             cccCCCCCeEEeecCCC-CCCCcCCCCCcCCHHHHHHhcCCccccCC------CCCccCCCCC
Confidence            46667766666555442 222222122 2466776666555432222      2355677776


No 292
>KOG4118|consensus
Probab=24.91  E-value=33  Score=16.27  Aligned_cols=23  Identities=22%  Similarity=0.261  Sum_probs=15.6

Q ss_pred             CccCCCCCCccCCchhhhhhhhh
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      .++|.+|.-....+..+..|...
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~   60 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFEN   60 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhh
Confidence            36777777777777666666555


No 293
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=24.50  E-value=34  Score=17.18  Aligned_cols=7  Identities=0%  Similarity=-0.296  Sum_probs=4.2

Q ss_pred             ccccccc
Q psy14694         95 FKKIRIA  101 (102)
Q Consensus        95 C~~c~~~  101 (102)
                      |..|++.
T Consensus        81 C~vC~k~   87 (109)
T PF10367_consen   81 CSVCGKP   87 (109)
T ss_pred             ccCcCCc
Confidence            6666654


No 294
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=24.42  E-value=8.3  Score=18.39  Aligned_cols=30  Identities=7%  Similarity=-0.025  Sum_probs=13.8

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCcccccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRIA  101 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~~  101 (102)
                      ...|..|+..+.....       ..+ ..|.|+.|+-.
T Consensus        41 ~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~   70 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEY-------SCG-ADYFCPICGLY   70 (71)
T ss_dssp             EEEETTT--EEES-SB-------TT---SEEETTTTEE
T ss_pred             CeECCCCCCccChhhh-------hcC-CCccCcCcCCC
Confidence            4556666655554322       111 45777777654


No 295
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=24.20  E-value=54  Score=22.80  Aligned_cols=8  Identities=13%  Similarity=-0.164  Sum_probs=5.4

Q ss_pred             cccccccc
Q psy14694         92 QLRFKKIR   99 (102)
Q Consensus        92 ~~~C~~c~   99 (102)
                      .+.||.||
T Consensus       546 ~~~CP~CG  553 (586)
T TIGR02827       546 LHRCPVCG  553 (586)
T ss_pred             CCcCcCCC
Confidence            36677776


No 296
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=23.60  E-value=25  Score=15.70  Aligned_cols=13  Identities=15%  Similarity=-0.010  Sum_probs=6.0

Q ss_pred             CCCCccccccccc
Q psy14694         88 ISDEQLRFKKIRI  100 (102)
Q Consensus        88 ~~~~~~~C~~c~~  100 (102)
                      .+...|+|..|++
T Consensus        31 ~~~~~~rC~YCe~   43 (52)
T PF02748_consen   31 KEPIKLRCHYCER   43 (52)
T ss_dssp             TTTCEEEETTT--
T ss_pred             CCCCEEEeeCCCC
Confidence            3444566666654


No 297
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=23.44  E-value=31  Score=18.16  Aligned_cols=49  Identities=14%  Similarity=0.198  Sum_probs=24.4

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      ...|..|+..|....+           ....|..|.+.+-..-...     ..++..|.|..|.+
T Consensus        54 ~~~C~~C~~~fg~l~~-----------~~~~C~~C~~~VC~~C~~~-----~~~~~~WlC~vC~k  102 (118)
T PF02318_consen   54 ERHCARCGKPFGFLFN-----------RGRVCVDCKHRVCKKCGVY-----SKKEPIWLCKVCQK  102 (118)
T ss_dssp             CSB-TTTS-BCSCTST-----------TCEEETTTTEEEETTSEEE-----TSSSCCEEEHHHHH
T ss_pred             CcchhhhCCcccccCC-----------CCCcCCcCCccccCccCCc-----CCCCCCEEChhhHH
Confidence            3478888776643221           2245555554443332111     44566788887754


No 298
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=23.42  E-value=33  Score=18.07  Aligned_cols=9  Identities=0%  Similarity=0.050  Sum_probs=6.9

Q ss_pred             ccccccccc
Q psy14694         93 LRFKKIRIA  101 (102)
Q Consensus        93 ~~C~~c~~~  101 (102)
                      |+|..||..
T Consensus       101 y~C~~Cg~~  109 (113)
T COG1594         101 YKCTRCGYR  109 (113)
T ss_pred             EEecccCCE
Confidence            888888764


No 299
>PRK06921 hypothetical protein; Provisional
Probab=23.08  E-value=43  Score=20.46  Aligned_cols=11  Identities=18%  Similarity=0.126  Sum_probs=7.0

Q ss_pred             CCccccccccc
Q psy14694         90 DEQLRFKKIRI  100 (102)
Q Consensus        90 ~~~~~C~~c~~  100 (102)
                      +..|.||.|+.
T Consensus        30 ~~~~~Cp~C~d   40 (266)
T PRK06921         30 AERYDCPKCKD   40 (266)
T ss_pred             CCCCCCCCCCC
Confidence            34577777764


No 300
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=23.03  E-value=28  Score=20.43  Aligned_cols=25  Identities=28%  Similarity=0.437  Sum_probs=0.0

Q ss_pred             hcCCCCccCCCCCC-ccCCchhhhhh
Q psy14694         59 HIGDRPYKCFVCPY-RSNQRANLMSH   83 (102)
Q Consensus        59 h~~~~~~~c~~c~~-~f~~~~~l~~h   83 (102)
                      |--.+.|.|.+||- .+.-+..+.+|
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             --------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHHh
Confidence            33346688888873 44555556655


No 301
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=22.98  E-value=52  Score=20.09  Aligned_cols=34  Identities=12%  Similarity=0.131  Sum_probs=16.9

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCccccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIRI  100 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~~  100 (102)
                      ..+.|..|+..+......   .....++ +=.|++||.
T Consensus       121 ~~~~C~~C~~~~~~~~~~---~~~~~~~-~p~C~~Cg~  154 (250)
T COG0846         121 KRVRCSKCGNQYYDEDVI---KFIEDGL-IPRCPKCGG  154 (250)
T ss_pred             eeeEeCCCcCccchhhhh---hhcccCC-CCcCccCCC
Confidence            456777787666533211   1112222 334777764


No 302
>PRK12722 transcriptional activator FlhC; Provisional
Probab=22.89  E-value=71  Score=18.66  Aligned_cols=28  Identities=11%  Similarity=-0.003  Sum_probs=16.6

Q ss_pred             CccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      ...|..|+-.|....        +.....|.|+-|.
T Consensus       134 l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (187)
T PRK12722        134 LSSCNCCGGHFVTHA--------HDPVGSFVCGLCQ  161 (187)
T ss_pred             eccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            356788886666432        1223467777774


No 303
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=22.79  E-value=26  Score=14.13  Aligned_cols=7  Identities=43%  Similarity=1.217  Sum_probs=2.8

Q ss_pred             cCCCCCC
Q psy14694         66 KCFVCPY   72 (102)
Q Consensus        66 ~c~~c~~   72 (102)
                      .|..|+.
T Consensus        22 ~C~~C~Y   28 (35)
T PF02150_consen   22 ACRTCGY   28 (35)
T ss_dssp             EESSSS-
T ss_pred             CCCCCCC
Confidence            3444443


No 304
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=22.57  E-value=63  Score=21.34  Aligned_cols=33  Identities=15%  Similarity=0.264  Sum_probs=17.6

Q ss_pred             ceeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccCC
Q psy14694         36 KYDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSNQ   76 (102)
Q Consensus        36 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~   76 (102)
                      -..|++|+..+.-+ .|      ..++ .-.|+.|+....+
T Consensus        18 ~~~C~eCd~~~~~P-~l------~~~q-~A~CPRC~~~l~~   50 (418)
T COG2995          18 LILCPECDMLVSLP-RL------DSGQ-SAYCPRCGHTLTR   50 (418)
T ss_pred             eecCCCCCceeccc-cC------CCCC-cccCCCCCCcccc
Confidence            35677787765543 22      2222 2467777755443


No 305
>KOG4727|consensus
Probab=22.41  E-value=37  Score=19.52  Aligned_cols=21  Identities=29%  Similarity=0.556  Sum_probs=17.5

Q ss_pred             CccCCCCCCccCCchhhhhhh
Q psy14694         64 PYKCFVCPYRSNQRANLMSHP   84 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~   84 (102)
                      .|-|.+|+-.+....++..|+
T Consensus        75 GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             ceeeeecceeehhhHHHHHHh
Confidence            488999999998888877764


No 306
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=22.34  E-value=1e+02  Score=16.03  Aligned_cols=19  Identities=26%  Similarity=0.434  Sum_probs=13.2

Q ss_pred             ccCCccccccccCHHHHHHH
Q psy14694          2 LKCTHCKVDLNLDTEIILQH   21 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l~~h   21 (102)
                      +.|+.||..+- +.......
T Consensus        32 ~~C~~CGe~~~-~~e~~~~~   50 (127)
T TIGR03830        32 WYCPACGEELL-DPEESKRN   50 (127)
T ss_pred             eECCCCCCEEE-cHHHHHHH
Confidence            47899998886 66655433


No 308
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=22.06  E-value=42  Score=16.77  Aligned_cols=10  Identities=40%  Similarity=1.268  Sum_probs=6.5

Q ss_pred             cCCccccccc
Q psy14694          3 KCTHCKVDLN   12 (102)
Q Consensus         3 ~c~~c~~~f~   12 (102)
                      .|+.||..|.
T Consensus        10 ~C~~CG~d~~   19 (86)
T PF06170_consen   10 RCPHCGLDYS   19 (86)
T ss_pred             cccccCCccc
Confidence            4677776664


No 309
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=21.91  E-value=83  Score=15.97  Aligned_cols=16  Identities=25%  Similarity=0.924  Sum_probs=11.0

Q ss_pred             ccCCccccccccCHHHH
Q psy14694          2 LKCTHCKVDLNLDTEII   18 (102)
Q Consensus         2 ~~c~~c~~~f~~~~~~l   18 (102)
                      ..|++||..|. +..-+
T Consensus        36 ~~C~~CGe~y~-~dev~   51 (89)
T TIGR03829        36 ISCSHCGMEYQ-DDTTV   51 (89)
T ss_pred             ccccCCCcEee-cHHHH
Confidence            36888998886 54443


No 310
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=21.81  E-value=67  Score=19.56  Aligned_cols=11  Identities=18%  Similarity=-0.013  Sum_probs=4.9

Q ss_pred             CCCcccccccc
Q psy14694         89 SDEQLRFKKIR   99 (102)
Q Consensus        89 ~~~~~~C~~c~   99 (102)
                      ++..-.||.||
T Consensus       218 ~d~iv~CP~Cg  228 (239)
T COG1579         218 KDEIVFCPYCG  228 (239)
T ss_pred             CCCCccCCccc
Confidence            33344455554


No 311
>PRK03922 hypothetical protein; Provisional
Probab=21.78  E-value=42  Score=17.72  Aligned_cols=7  Identities=14%  Similarity=-0.126  Sum_probs=3.7

Q ss_pred             ccccccc
Q psy14694         95 FKKIRIA  101 (102)
Q Consensus        95 C~~c~~~  101 (102)
                      ||.||.-
T Consensus        52 cP~cge~   58 (113)
T PRK03922         52 CPKCGEP   58 (113)
T ss_pred             CCCCCCc
Confidence            5555543


No 312
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=21.51  E-value=72  Score=22.43  Aligned_cols=8  Identities=13%  Similarity=-0.164  Sum_probs=5.8

Q ss_pred             cccccccc
Q psy14694         92 QLRFKKIR   99 (102)
Q Consensus        92 ~~~C~~c~   99 (102)
                      -+.||.||
T Consensus       580 ~~~CP~CG  587 (623)
T PRK08271        580 GKRCPICG  587 (623)
T ss_pred             CcCCcCCC
Confidence            36788887


No 313
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=21.47  E-value=41  Score=14.05  Aligned_cols=8  Identities=25%  Similarity=0.571  Sum_probs=3.3

Q ss_pred             ccCCCCCC
Q psy14694         65 YKCFVCPY   72 (102)
Q Consensus        65 ~~c~~c~~   72 (102)
                      +.|..||.
T Consensus        20 ~vC~~CG~   27 (43)
T PF08271_consen   20 LVCPNCGL   27 (43)
T ss_dssp             EEETTT-B
T ss_pred             EECCCCCC
Confidence            34555543


No 314
>KOG1280|consensus
Probab=21.31  E-value=95  Score=20.16  Aligned_cols=23  Identities=17%  Similarity=0.359  Sum_probs=10.5

Q ss_pred             CccCCCCCCccCCchhhhhhhhh
Q psy14694         64 PYKCFVCPYRSNQRANLMSHPLV   86 (102)
Q Consensus        64 ~~~c~~c~~~f~~~~~l~~h~~~   86 (102)
                      .|.|++|+..=.....|..|...
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s  101 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLS  101 (381)
T ss_pred             cccCCcccccccchhHHHHHhhh
Confidence            34555555443334444445433


No 315
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=21.30  E-value=94  Score=13.45  Aligned_cols=8  Identities=25%  Similarity=0.795  Sum_probs=4.2

Q ss_pred             CceeCCCC
Q psy14694         35 KKYDCFMC   42 (102)
Q Consensus        35 ~~~~c~~c   42 (102)
                      ..+.|.+|
T Consensus        14 ~r~~C~~C   21 (49)
T cd02335          14 IRIKCAEC   21 (49)
T ss_pred             cEEECCCC
Confidence            44555555


No 316
>PRK02935 hypothetical protein; Provisional
Probab=21.30  E-value=44  Score=17.54  Aligned_cols=13  Identities=8%  Similarity=-0.118  Sum_probs=7.1

Q ss_pred             CCCCccccccccc
Q psy14694         88 ISDEQLRFKKIRI  100 (102)
Q Consensus        88 ~~~~~~~C~~c~~  100 (102)
                      +...+..||.|+|
T Consensus        66 tkavqV~CP~C~K   78 (110)
T PRK02935         66 TKAVQVICPSCEK   78 (110)
T ss_pred             ccceeeECCCCCc
Confidence            3334456666665


No 317
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=21.22  E-value=75  Score=23.32  Aligned_cols=32  Identities=22%  Similarity=0.268  Sum_probs=17.5

Q ss_pred             eeCCCCCCCCCCcchHHHHhhhhcCCCCccCCCCCCccC
Q psy14694         37 YDCFMCPYRTPYSGTMRRHIRAHIGDRPYKCFVCPYRSN   75 (102)
Q Consensus        37 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~c~~c~~~f~   75 (102)
                      -.|..|++.|.......       +.+.+-|..||..|.
T Consensus       461 dtC~~C~kkFfSlsK~L-------~~RKHHCRkCGrVFC  492 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPL-------GTRAHHCRSCGIRLC  492 (1374)
T ss_pred             CcccCcCCccccccccc-------ccccccccCCccccC
Confidence            35778888776542111       223445666666553


No 318
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=21.08  E-value=38  Score=15.05  Aligned_cols=9  Identities=0%  Similarity=-0.086  Sum_probs=4.2

Q ss_pred             ccccccccc
Q psy14694         93 LRFKKIRIA  101 (102)
Q Consensus        93 ~~C~~c~~~  101 (102)
                      ..|+.|+..
T Consensus        41 ~~C~~C~~~   49 (64)
T PF01485_consen   41 VTCPSCGTE   49 (64)
T ss_dssp             CCTTSCCSE
T ss_pred             eECCCCCCc
Confidence            445555443


No 319
>PRK07218 replication factor A; Provisional
Probab=21.02  E-value=61  Score=21.51  Aligned_cols=10  Identities=20%  Similarity=0.338  Sum_probs=6.3

Q ss_pred             ccCCCCCCcc
Q psy14694         65 YKCFVCPYRS   74 (102)
Q Consensus        65 ~~c~~c~~~f   74 (102)
                      ..|+.|++..
T Consensus       298 ~rCP~C~r~v  307 (423)
T PRK07218        298 ERCPECGRVI  307 (423)
T ss_pred             ecCcCccccc
Confidence            4577776554


No 320
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=21.01  E-value=52  Score=22.03  Aligned_cols=26  Identities=19%  Similarity=0.277  Sum_probs=21.9

Q ss_pred             CCCccCCCCCCccCCchhhhhhhhhc
Q psy14694         62 DRPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      ...|.|..|-+-|.....|.+|+...
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C  221 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKC  221 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcC
Confidence            45689999999999999999998754


No 321
>PRK12860 transcriptional activator FlhC; Provisional
Probab=20.86  E-value=80  Score=18.49  Aligned_cols=29  Identities=10%  Similarity=0.088  Sum_probs=17.3

Q ss_pred             CCccCCCCCCccCCchhhhhhhhhcCCCCcccccccc
Q psy14694         63 RPYKCFVCPYRSNQRANLMSHPLVQISDEQLRFKKIR   99 (102)
Q Consensus        63 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~C~~c~   99 (102)
                      ....|..|+-.|....        +.....|.|+-|.
T Consensus       133 ~l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (189)
T PRK12860        133 QLARCCRCGGKFVTHA--------HDLRHNFVCGLCQ  161 (189)
T ss_pred             eeccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            3467888887666432        2333467787774


No 322
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=20.80  E-value=52  Score=15.48  Aligned_cols=9  Identities=44%  Similarity=0.958  Sum_probs=6.2

Q ss_pred             ccCCCCCCc
Q psy14694         65 YKCFVCPYR   73 (102)
Q Consensus        65 ~~c~~c~~~   73 (102)
                      |.|++|+..
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            578888743


No 323
>PTZ00064 histone acetyltransferase; Provisional
Probab=20.58  E-value=61  Score=22.18  Aligned_cols=26  Identities=19%  Similarity=0.050  Sum_probs=22.0

Q ss_pred             CCCccCCCCCCccCCchhhhhhhhhc
Q psy14694         62 DRPYKCFVCPYRSNQRANLMSHPLVQ   87 (102)
Q Consensus        62 ~~~~~c~~c~~~f~~~~~l~~h~~~~   87 (102)
                      ...|.|..|-+-|.....|.+|+...
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~C  303 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSRC  303 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhcC
Confidence            45689999999999999999997754


No 324
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=20.52  E-value=42  Score=13.42  Aligned_cols=8  Identities=0%  Similarity=-0.143  Sum_probs=4.6

Q ss_pred             cccccccc
Q psy14694         93 LRFKKIRI  100 (102)
Q Consensus        93 ~~C~~c~~  100 (102)
                      |.|..|++
T Consensus         9 Y~C~~C~~   16 (32)
T PF13696_consen    9 YVCHRCGQ   16 (32)
T ss_pred             CEeecCCC
Confidence            56666654


No 325
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=20.52  E-value=36  Score=17.35  Aligned_cols=9  Identities=22%  Similarity=0.128  Sum_probs=6.8

Q ss_pred             ccccccccc
Q psy14694         93 LRFKKIRIA  101 (102)
Q Consensus        93 ~~C~~c~~~  101 (102)
                      |+|.+|+++
T Consensus        68 ~~C~~C~~~   76 (92)
T PRK05767         68 YRCTECGKA   76 (92)
T ss_pred             EEecccChh
Confidence            778888764


No 326
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=20.41  E-value=54  Score=13.69  Aligned_cols=6  Identities=50%  Similarity=1.702  Sum_probs=2.7

Q ss_pred             cCCccc
Q psy14694          3 KCTHCK    8 (102)
Q Consensus         3 ~c~~c~    8 (102)
                      .|+.||
T Consensus         4 ~Cp~Cg    9 (47)
T PF14690_consen    4 RCPHCG    9 (47)
T ss_pred             cCCCcC
Confidence            344444


No 327
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=20.25  E-value=76  Score=22.32  Aligned_cols=8  Identities=13%  Similarity=0.040  Sum_probs=5.7

Q ss_pred             cccccccc
Q psy14694         92 QLRFKKIR   99 (102)
Q Consensus        92 ~~~C~~c~   99 (102)
                      -+.||.||
T Consensus       582 ~~~CP~CG  589 (625)
T PRK08579        582 YTRCPRCG  589 (625)
T ss_pred             CCcCcCCC
Confidence            36788887


No 328
>KOG1088|consensus
Probab=20.23  E-value=54  Score=17.58  Aligned_cols=22  Identities=5%  Similarity=-0.120  Sum_probs=16.0

Q ss_pred             hhcCCCCccCCCCCCccCCchh
Q psy14694         58 AHIGDRPYKCFVCPYRSNQRAN   79 (102)
Q Consensus        58 ~h~~~~~~~c~~c~~~f~~~~~   79 (102)
                      ++..+...+|++||+.|.-...
T Consensus        92 ~~v~EG~l~CpetG~vfpI~~G  113 (124)
T KOG1088|consen   92 IDVIEGELVCPETGRVFPISDG  113 (124)
T ss_pred             hhhccceEecCCCCcEeecccC
Confidence            3455667899999999875443


No 329
>KOG1008|consensus
Probab=20.14  E-value=39  Score=23.85  Aligned_cols=38  Identities=11%  Similarity=0.049  Sum_probs=21.4

Q ss_pred             ccCCCCCCccCCchhhh--hhhhhcCCCCccccccccccC
Q psy14694         65 YKCFVCPYRSNQRANLM--SHPLVQISDEQLRFKKIRIAV  102 (102)
Q Consensus        65 ~~c~~c~~~f~~~~~l~--~h~~~~~~~~~~~C~~c~~~~  102 (102)
                      .+|..|++....+..-.  .-.++-.+...+.||.||++|
T Consensus       737 ~~c~~c~~~i~~~~~~~p~~~~~ts~~n~~~~cp~c~s~~  776 (783)
T KOG1008|consen  737 IQCQNCKQNINTPRTSSPSSAVSTSAGNYKNGCPHCGSSF  776 (783)
T ss_pred             ehhhhHHhhhccccCCCCCccccccccccccCCCCCCCCC
Confidence            35777765443221111  123345666677899998876


Done!