Diaphorina citri psyllid: psy14699


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MKQLHNKVNIVPVIAKADCLTRKEIQRLKKKVMDEIKQNGITIYPLPDCDSDEDEDYKEQVRQLKEAVPFAVCGANTVLEVGGNKVRGRQYPWGVVEVENPEHCDFTKLRTMLVTHMQDLQEVTQEIHYENYRSERLVKGVPVPKRTVSLTEDSKPTANNLEKDRILQEKEAELQRMQEMIAKMQAQMQQAQSGQ
cccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccEEEEEccEEEEEccEEEEEEEcccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MKQLHNKVNIVPVIAKADCLTRKEIQRLKKKVMDEIKQNGITIYPLPDCDSDEDEDYKEQVRQLKEAVPFAVCGANTVLEVGGNKVRGRQYPWGVVEVENPEHCDFTKLRTMLVTHMQDLQEVTQEIHYENYRSERLVKG*******************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQLHNKVNIVPVIAKADCLTRKEIQRLKKKVMDEIKQNGITIYPLPDCDSDEDEDYKEQVRQLKEAVPFAVCGANTVLEVGGNKVRGRQYPWGVVEVENPEHCDFTKLRTMLVTHMQDLQEVTQEIHYENYRSERLVKGVPVPKRTVSLTEDSKPTANxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Septin-1 Involved in cytokinesis.confidentP42207
Septin-2 Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein.confidentQ5RA66
Septin-2 Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein.confidentQ2NKY7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031105 [CC]septin complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0005737, GO:0043232, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0032156, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0043228, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0043332 [CC]mating projection tipprobableGO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0033205 []cell cycle cytokinesisprobable
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0030030 [BP]cell projection organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0005619 [CC]ascospore wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0031160, GO:0071944, GO:0009277
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005545 [MF]1-phosphatidylinositol bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:2001244 [BP]positive regulation of intrinsic apoptotic signaling pathwayprobableGO:2001235, GO:0010646, GO:2001233, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0010941, GO:0050794, GO:0023056, GO:0043067, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0042981, GO:0050789, GO:2001242
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0000144 [CC]cellular bud neck septin ringprobableGO:0030427, GO:0032161, GO:0043229, GO:0071944, GO:0005622, GO:0043226, GO:0005856, GO:0005575, GO:0005940, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0032156, GO:0005938, GO:0005935, GO:0005933, GO:0043232, GO:0044464, GO:0005623, GO:0000399, GO:0044446, GO:0044444, GO:0043228, GO:0044422, GO:0044424, GO:0044448
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0000145 [CC]exocystprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0001411 [CC]hyphal tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0017157 [BP]regulation of exocytosisprobableGO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0002036 [BP]regulation of L-glutamate transportprobableGO:0032879, GO:0051049, GO:0032890, GO:0065007, GO:0051952, GO:0008150, GO:0044070, GO:0050789, GO:0043269, GO:0051955
GO:0072687 [CC]meiotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030234 [MF]enzyme regulator activityprobableGO:0003674
GO:0030428 [CC]cell septumprobableGO:0005575, GO:0044464, GO:0005623
GO:0032168 [CC]hyphal septin ringprobableGO:0005856, GO:0005737, GO:0005940, GO:0005575, GO:0043232, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0032156, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0044424, GO:0043228, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0060170 [CC]cilium membraneprobableGO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0031090, GO:0031514, GO:0016020, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0032160 [CC]septin filament arrayprobableGO:0005856, GO:0005575, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0032156, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0032947 [MF]protein complex scaffoldprobableGO:0003674, GO:0005488, GO:0005515, GO:0005198
GO:0007349 [BP]cellularizationprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0009653, GO:0007275, GO:0048646
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001400 [CC]mating projection baseprobableGO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0060429 [BP]epithelium developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0005628 [CC]prospore membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0042764, GO:0042763
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QAG, chain A
Confidence level:very confident
Coverage over the Query: 2-137
View the alignment between query and template
View the model in PyMOL